The Boring PartsFederalLocal · USLocal · Canada
Yates County, NY

Yates County public meetings in 2023

122 substantive meetings from 2023, with official agendas or minutes and plain-English summaries.

Thu Dec 28, 2023

Yates County Legislature

Yates County Legislature to adopt 2024 salaries, fill vacancies, and amend agricultural district

The Yates County Legislature is meeting to vote on a series of resolutions, including adopting the 2024 salary and wage schedules for non-union employees, authorizing the Sheriff to fill deputy positions, and amending the agricultural district. They will also hold public hearings on adding agricultural lands and a local law for filling elective office vacancies.

budgetsalariesagriculturepublic-safetylocal-lawcontracts
Thu Dec 28, 2023

Yates County Legislature

County Legislature to hold public hearings on ag district and vacancy law

The Yates County Legislature will meet in special session on December 28, 2023, to hold two public hearings: one on adding viable agricultural lands to the county agricultural district, and another on Local Law No. 5-2023, which would change how vacancies in elective county offices are filled. The law would allow the Legislature to appoint replacements for County Legislator, County Treasurer, or Coroner until the next general election, and would repeal the previous 2012 vacancy law.

agriculturecounty-legislatureelectionspublic-hearinglocal-law
Thu Dec 14, 2023

Planning Board

Planning Board to review four referrals including cannabis dispensary and subdivisions

The Yates County Planning Board will meet to elect new officers, approve prior minutes, and consider four General Municipal Law 239 referrals. These include a proposed amendment to the Town of Starkey's subdivision regulations, two subdivision proposals in the Town of Torrey, and a special use permit for a new cannabis dispensary in Penn Yan. No other business is listed.

planning-boardsubdivisioncannabiszoningspecial-use-permit
Mon Dec 11, 2023

Yates County Legislature

Yates County Legislature to vote on 2024 contracts, local laws, and agricultural district review

The Yates County Legislature is meeting to vote on numerous resolutions, including 2024 contract renewals for sheriff's office services, EMS training, and shared services with Schuyler County. They will also hold public hearings on a local law establishing a residency requirement for Deputy County Clerk and on the eight-year review of Agricultural District 1. The agenda includes many routine approvals such as appointments, budget transfers, and contract authorizations.

agriculturebudgetcontractsemergency-serviceslocal-lawpublic-hearingsheriffshared-services
Mon Dec 11, 2023

Yates County Legislature

Public hearing on deputy county clerk residency law

The Yates County Legislature will hold a public hearing on proposed Local Law 4-23, which would allow the Deputy County Clerk to reside in Yates County or an adjoining county, superseding state law. The hearing takes place during the regular legislative meeting on December 11, 2023, at 1:00 p.m. in the Legislative Chambers, 417 Liberty St., Penn Yan, NY.

local-lawpublic-hearingcounty-clerkresidencyyates-county
Tue Dec 5, 2023

Public Safety Committee

Yates County Public Safety Committee to vote on multiple 2024 contracts and appointments

The Yates County Public Safety Committee is meeting to consider a wide range of resolutions, including filling a District Attorney staff vacancy, amending a probation contract, appointing a deputy fire coordinator, and authorizing numerous 2024 agreements for the Sheriff's Office, such as jail contracts, mutual aid agreements, and service renewals. The committee will also receive monthly statistics reports from the District Attorney, Probation, Emergency Services, and Sheriff's Office, and discuss the public safety communications project.

public-safetysheriffdistrict-attorneyprobationemergency-servicescontractsappointments
Tue Dec 5, 2023

Finance Committee

Yates County considers $2 million funding for new community Field House

The Finance Committee is reviewing several contracts for broadband expansion and tax map software upgrades. The body is also discussing a $2 million funding agreement for a multi-use building facility and addressing power availability issues at the county airport.

budgetbroadbandzoninginfrastructureairport
Mon Dec 4, 2023

Government Operations

Yates County discusses election staffing, software contracts, and local laws

The Government Operations Committee is reviewing several resolutions including election deputy positions and software maintenance. The committee will also discuss a public hearing for a law regarding filling elective office vacancies and a residency requirement for the Deputy County Clerk.

electionsgovernment-operationslocal-lawagriculturepersonnelbudget
Mon Dec 4, 2023

Human Services Committee

Human Services Committee reviews social service contracts and public defender grants

The committee is considering several resolutions to authorize service contracts for the Department of Social Services and a legal research agreement for the Public Defender. Members are also reviewing grant balances and program updates for public health, aging, and veterans services.

social-servicespublic-defenderpublic-healthcontractsveteransgrants
Mon Dec 4, 2023

Public Works Committee

Yates County to consider $128K vehicle lift, chiller, sprinkler contracts

The Public Works Committee will review highway and buildings/grounds reports and vote on several contracts, including a $128,312 vehicle lift for the new highway facility, a $250,979 chiller update, and a $2,225 annual sprinkler maintenance deal. The committee will also consider a five-year shared weights and measures director agreement with Schuyler County. Construction updates on the new Highway/OES/Public Health facility will be discussed.

public-workshighwaybuildings-and-groundscontractsconstructionfacilities
Wed Nov 29, 2023

Airport Council

Airport Council reviews taxiway extensions and grant funding

The Yates County Airport Council discussed infrastructure projects including a taxiway extension for runways 10/28 and a ramp rehabilitation project. The body reviewed remaining balances for CARES, CRSSA, and ARPA grants and discussed the status of a new 8-bay T-hanger grant from NYSDOT.

airportinfrastructuregrantsaviation
Thu Nov 16, 2023

Planning Board

Planning Board to review four referrals including hardware store, carwash

The Yates County Planning Board is meeting to consider four General Municipal Law 239 referrals from local towns and villages. These include a special use permit for a hardware store in Barrington, a site plan for a pole structure in Penn Yan, a special use permit for glamping sites in Starkey, and a use variance for a carwash in Penn Yan. The board will also approve minutes from the October 26th meeting. No other business is listed.

planning-boardspecial-use-permitsite-planuse-variancehardware-storecarwashglamping
Thu Nov 16, 2023

Yates County Legislature

Yates County Legislature to hold public hearing and adopt 2024 budget

The Yates County Legislature will meet on November 16, 2023, to hold a public hearing on the proposed 2024 county budget and then consider adopting it. The agenda also includes resolutions to authorize a new electricity supply agreement with Constellation New Energy and to create a Communications Support Specialist position in the Sheriff's office.

budgetpublic-hearingenergysheriffpersonnel
Mon Nov 13, 2023

Finance Committee

Finance Committee to review creating a Senior Account Clerk Typist position

The Yates County Finance Committee is meeting to discuss a proposed resolution to create and fill a full-time Senior Account Clerk Typist position. This action is intended for succession planning within the Department of Real Property Tax Services.

personnelbudgetreal-property-tax
Mon Nov 13, 2023

Yates County Legislature

Yates County Legislature to adopt sheriff defense law, new voting system

The Yates County Legislature is meeting to vote on resolutions including adopting Local Law 3-2023 for sheriff defense and indemnification, authorizing a new voting system, and setting a public hearing for a deputy county clerk residency law. They will also hear presentations from the Tourism Advisory Council, Keuka College, and Yates Transit Service, and consider numerous contracts, appointments, and budget transfers.

sheriffvoting-systemlocal-lawjailpublic-safetybudgetappointments
Mon Nov 13, 2023

Yates County Legislature

Public hearing on law to defend, indemnify Sheriff's office

The Yates County Legislature will hold a public hearing on November 13, 2023, to consider proposed Local Law 3-23, which would provide defense and indemnification for the Sheriff and former Sheriffs, mirroring Section 18 of the Public Officers Law. The hearing will occur during the regularly scheduled legislative meeting at 417 Liberty St., Penn Yan, NY.

public-hearinglocal-lawsheriffindemnificationyates-county
Tue Nov 7, 2023

Public Safety Committee

Yates County Public Safety Committee to vote on jail contract, K9 retirement, and officer hires

The Yates County Public Safety Committee is meeting to discuss and vote on several resolutions, including authorizing a jail contract with Seneca County, filling two correction officer positions, and approving a storage lease. The agenda also includes updates from the District Attorney, Probation, Emergency Services, and Sheriff's office, along with a public hearing reminder for the 2024 budget.

public-safetysheriffcorrectionsjail-contractbudgetk9-retirementstorage-lease
Tue Nov 7, 2023

Finance Committee

Yates County Finance Committee reviews budget transfers and airport projects

The committee is discussing 2023 budget transfers, additional state aid appropriations, and the proposed 2024 budget. The body is also reviewing progress on the ReConnect broadband project and airport safety assessments.

budgetbroadbandairportstate-aidtaxes
Tue Nov 7, 2023

Yates County Legislature

County to vote on $180K airport services contract with Seneca Flight

The Yates County Legislature is holding a special meeting to discuss and review Resolution 474-23, which would authorize the Chair to sign a contract with Seneca Flight Operations for Fixed Based Operator (FBO) services at the Penn Yan-Yates County Airport. The current FBO contract ends November 10, 2023, and the new agreement is for $180,000, fully locally funded. The resolution would be voted on after discussion.

airportcontractsbudget
Mon Nov 6, 2023

Government Operations

Yates County considers new voting system and IT contract

The Government Operations Committee will discuss election updates, IT projects, and personnel matters. Key resolutions include authorizing a new voting system and an IT service contract.

electionsitbudgetpersonnelgovernment-operations
Mon Nov 6, 2023

Human Services Committee

Human Services Committee reviews HEAP updates and public health reports

The committee is discussing updates to the Heating and Energy Assistance Program (HEAP) and child care eligibility. Members are considering resolutions for board appointments and contract corrections.

social-servicespublic-healthheating-assistanceappointmentscontracts
Mon Nov 6, 2023

Public Works Committee

Yates County Public Works to vote on $210K in building reserve transfers

The Public Works Committee is reviewing two resolutions to transfer funds from the Building Reserve Fund to the Capital Projects Fund: $60,477 for replacing the fuel island canopy and $150,000 to cover NYSEG cost overruns for the new natural gas main. The committee will also hear updates on the new Highway/OES/Public Health facility, bridge projects, and routine maintenance.

public-worksbudgethighwaybridgesconstructionnatural-gasresolutions
Wed Nov 1, 2023

Yates County Legislature

Yates County opens 30-day window for Ag District land inclusion requests

The Yates County Legislature is accepting requests from landowners to include viable agricultural property into the Agricultural District. The 30-day application period runs from November 1 to November 30, 2023. Requests must be submitted to the Yates County Soil & Water District Manager with tax parcel IDs and land descriptions.

agricultureagricultural-districtland-usepublic-notice
Mon Oct 30, 2023

Yates County Legislature

Yates County Legislature to adopt 2024 tentative budget

The Legislature will hold special meetings on October 30 and 31, 2023, to conduct budget workshops. The body is scheduled to adopt the 2024 Tentative Budget as recommended by the Finance Committee.

budgetfinancegovernment-operations
Mon Oct 30, 2023

Yates County Legislature

Legislature to appoint acting county administrator and budget officer

The Yates County Legislature will hold a special meeting to consider appointing Jessica Mullins as Acting County Administrator and Budget Officer, and to authorize a consulting agreement with Winona B. Flynn. The meeting will begin with an executive session to discuss employment history and the proposed resolutions.

appointmentsbudgetcounty-administratorconsultingexecutive-session
Thu Oct 26, 2023

Planning Board

Planning Board to review four referrals including new store, subdivision, event center, winery tasting room

The Yates County Planning Board is meeting to consider four General Municipal Law 239 referrals from the Villages of Penn Yan and Dresden and the Town of Benton. These include a site plan for a clothing store, a subdivision for a single-family dwelling, a special use permit for an event center, and a special use permit for a wine tasting room. The board will also hear a communication about the Town of Benton extending its water district down Angus Road. The agenda is otherwise procedural, with no old, member, or new business.

planning-boardsite-plansubdivisionspecial-use-permitwater-districtretailwinery
Wed Oct 25, 2023

Airport Council

Airport council reviews taxiway extension, grants, and equipment updates

The Yates County Airport Council met to discuss ongoing projects including the taxiway extension for runways 10/28, grant statuses, and equipment updates. They reviewed reports from C&S and Passero, covering construction timelines, grant releases, and maintenance issues. The meeting included routine approvals of minutes and financial reports, with the financial report not yet available.

airportconstructiongrantsmaintenanceinfrastructure
Tue Oct 10, 2023

Yates County Legislature

Yates County Legislature to vote on mortgage tax renewal and sheriff indemnification law

The Yates County Legislature is meeting to vote on a series of resolutions, including adopting a local law to renew an additional mortgage tax, setting a public hearing for a law providing defense and indemnification for the Sheriff's office, and authorizing the creation of a full-time Director of Community Services position. The agenda also includes several contract authorizations, budget transfers, and recognitions.

mortgage-taxsheriffcommunity-servicesgrantscontractsbudget
Tue Oct 10, 2023

Yates County Legislature

Public hearing on renewing Yates County mortgage recording tax

The Yates County Legislature will hold a public hearing on October 10, 2023, to consider Local Law 2-23, which renews an additional mortgage recording tax of $0.25 per $100 of principal on mortgages on real property in Yates County. The tax, first established in 2005, would take effect December 1, 2023, and expire December 1, 2026, with revenue going to the county general fund. The hearing will occur during the regularly scheduled legislative meeting at 417 Liberty St., Penn Yan, NY, with remote participation available via Zoom.

taxmortgagepublic-hearingcounty-legislatureyates-county
Tue Oct 3, 2023

Public Safety Committee

Yates County Public Safety Committee reviews 2024 budgets, DA investigator position

The Yates County Public Safety Committee is meeting to review 2024 budget summaries from the District Attorney, Probation, Emergency Services, and Sheriff's offices, and to consider resolutions including authorizing a new full-time or part-time District Attorney Investigator position. The committee will also hear updates on jail population, DWI arrests, and a homeland security grant, and will set a public hearing on a local law regarding defense and indemnification of the Sheriff's office.

budgetpublic-safetysheriffdistrict-attorneyprobationemergency-servicesjailgrants
Tue Oct 3, 2023

Finance Committee

Yates County Finance Committee reviews 2024 budgets, airport, broadband

The Yates County Finance Committee is meeting to review departmental reports and 2024 budget requests, including the Real Property, Planning, and Finance departments. They will also discuss the airport's fuel truck delay and FAA review, broadband construction progress, and consider resolutions for a software contract, budget transfers, and a local law on mortgage tax.

budgetairportbroadbandreal-propertyplanningfinancecontractslocal-law
Tue Oct 3, 2023

Yates County Legislature

County to vote on $165K for contaminated soil cleanup at new facility project

The Yates County Legislature is holding a special meeting to discuss and review Resolution 430-23, which would authorize up to $165,000 from the project contingency fund to cover costs of trucking, disposal, treatment, and maintenance related to additional contaminated soils and groundwater encountered during excavation at the new Highway, Office of Emergency Services, and Public Health Facility project. The resolution, if approved, would allow the Highway Superintendent to proceed with these additional costs.

contaminated-soilsenvironmental-cleanupfacility-projectbudgethighway
Mon Oct 2, 2023

Government Operations

Yates County committee reviews 2024 budgets, election system purchase

The Government Operations Committee is reviewing 2024 budget requests from multiple departments, including a significant increase for Elections to fund a new voting system and full-time deputies. The committee will also consider resolutions on a social services position reclassification, a collective bargaining agreement, and a proclamation. Department heads will provide updates on records, history, elections, soil and water, IT, clerk, and personnel matters.

budgetelectionssoil-and-waterrecords-managementpersonnel
Mon Oct 2, 2023

Human Services Committee

Yates County Human Services Committee reviews 2024 budgets, contracts

The Yates County Human Services Committee is meeting to review 2024 budget summaries for multiple departments, including Assigned Counsel, Public Defender, Social Services, Public Health, Veterans, and Community Services. They will consider resolutions authorizing contracts and grants, such as the Third Upstate Quality Improvement grant, a software support agreement, and contracts for domestic violence services and HEAP. The agenda also includes routine items like approving minutes, public comment, and department updates.

budgetcontractsgrantssocial-servicespublic-defenderdomestic-violenceheat-assistance
Mon Oct 2, 2023

Public Works Committee

Pre-emption Road Bridge project funding and design approved

The Yates County Public Works Committee is reviewing resolutions to authorize funding and design for the Pre-emption Road Bridge project, along with several change orders for the new Highway/OES/Public Health Facility. They will also discuss the 2024 budget summaries for highway, landfill, and road machinery funds.

highwaybudgetbridgesconstructionsnow-icelandfillpublic-works
Thu Sep 28, 2023

Planning Board

Planning Board to review short-term rental moratorium and 6 special use permits

The Yates County Planning Board will consider 11 GML 239 referrals, including a proposed six-month moratorium on short-term rental applications in Penn Yan and several special use permits for businesses and short-term rentals. The board will also review a proposed local law from the Town of Middlesex. The meeting includes approval of minutes from August 24th.

zoningshort-term-rentalsspecial-use-permitmoratoriumsignagelocal-law
Mon Sep 11, 2023

Yates County Legislature

Yates County Legislature to vote on 36 resolutions, including shared code officer and grants

The Yates County Legislature will consider 36 resolutions at its September 11, 2023 meeting, covering agreements, grants, budget adjustments, and personnel actions. Notable items include an intermunicipal agreement with Schuyler County to share a code enforcement officer, acceptance of state election grants, and a resolution to set a public hearing on a local law renewing an additional mortgage tax.

intermunicipal-agreementgrantselectionsbudgetpublic-hearingpersonnelairport
✓ Decided: Yates County Legislature approves court reporting contract renewal

The Legislature approved a renewal agreement for court reporting services and approved the August 2023 audit. The session included public comments regarding quarantine regulations, child protective services, and vaccine mandates.

Fri Sep 8, 2023

Airport Council

Airport Council discusses funding, power issues, expansion plans

The Yates County Airport Council held a special meeting with Steve Griffin of the Yates County Economic Development Center to discuss funding opportunities and current needs at Penn Yan Airport. Topics included a potential relocation of the Dansville Soaring Club, a stalled Beta Technologies charging station project, Penn Yan Aero's expansion concerns, and corporate hangar demand. The council agreed to develop an overall infrastructure plan and address ongoing NYSEG power supply issues.

airporteconomic-developmentinfrastructurefundingpower-supplyhangarssoaring-club
Wed Sep 6, 2023

Government Operations

County to vote on creating full-time deputy election commissioner positions

The Yates County Government Operations Committee is meeting to discuss and vote on several resolutions, most notably creating full-time deputy election commissioner positions to prepare for the 2024 presidential election year. The committee will also consider signing state grant contracts for election technology and absentee ballot postage, and ratifying a collective bargaining agreement with corrections employees. Reports from various county departments will be presented.

electionspersonnelgrantsbudgetlabor
✓ Decided: Government Operations Committee approves election grants and personnel agreements

The Committee approved two Board of Elections grant contracts and a collective bargaining agreement for Corrections and other employees. A request to create two full-time Deputy Election Commissioner positions was deferred until budget time.

Wed Sep 6, 2023

Finance Committee

County to vote on $419K broadband engineering increase, fiber rail crossings

The Yates County Finance Committee is meeting to discuss and vote on resolutions related to the county's broadband expansion project, including a $419,044 increase to the engineering contract and an agreement with Norfolk Southern Railroad for fiber crossings. The committee will also review departmental reports and consider several budget and tax-related resolutions.

broadbandbudgetcontractstaxespublic-hearing
✓ Decided: Finance Committee approves broadband agreements and budget appropriations

The Committee approved several budget transfers and additional aid appropriations for DSS and daycare. It also authorized agreements for fiber optic installation across railroad tracks and modified an engineering contract for the ReConnect broadband project.

Wed Sep 6, 2023

Public Works Committee

Committee to approve $1.22M NYSEG gas main payment and $10K NYSERDA grant

The Yates County Public Works Committee will consider two resolutions: authorizing a payment up to $1,220,001 to NYSEG for a new natural gas main along Havens Corners Road, and authorizing the Legislature Chair to sign a NYSERDA agreement accepting $10,000 for EV charging stations in Benton. The agenda also includes routine reports on highway, buildings, and grounds, plus a reclassification of a highway position.

highwaybudgetgrantsenergyconstructionpublic-works
✓ Decided: Public Works Committee approves personnel reclassification and grant agreement

The Committee approved the reclassification of a Motor Equipment Operator position and authorized payment to NYSEG for a new natural gas main. It also approved signing an agreement with NYSERDA to accept $10,000 in grant funds for charging stations in Benton.

Tue Sep 5, 2023

Public Safety Committee

Yates County committee to vote on shared code officer, STOP-DWI plan, new hires

The Yates County Public Safety Committee is meeting to discuss and vote on several resolutions, including an intermunicipal agreement with Schuyler County to share a code enforcement officer, the 2024 STOP-DWI plan, and creating a temporary correction officer position. The committee will also hear updates from the Sheriff, Probation, and Emergency Services departments, including a request to create a new account clerk typist position in Probation.

public-safetysheriffprobationemergency-servicesbudgetintermunicipal-agreementstop-dwi
✓ Decided: Public Safety Committee approves intermunicipal agreement and STOP-DWI plan

The Committee approved an agreement with Schuyler County to share a Code Enforcement Officer and authorized the 2024 STOP-DWI plan. A request to create a probation account clerk typist position was referred to the budget meeting for further discussion.

Tue Sep 5, 2023

Human Services Committee

Yates County Human Services Committee to vote on contracts and appointments

The Yates County Human Services Committee will meet to discuss and vote on several resolutions, including contracts for legal research, mental health services, and a workforce board appointment. They will also receive updates from various departments on programs like Code Blue, benefits scams, and youth employment.

contractsappointmentspublic-defendersocial-servicespublic-healthveteransmental-health
✓ Decided: Human Services Committee approves multiple service contracts and proclamations

The Committee approved several resolutions including a Lexis Nexis agreement for the Public Defender and contracts for mental hygiene research. They also approved the recognition of National Suicide Prevention Month and the US Air Force Birthday.

Wed Aug 30, 2023

Airport Council

Airport council discusses Dansville Soaring Club relocation, rejects deicing bids

The Yates County Airport Council discussed the potential relocation of the Dansville Soaring Club to the Penn Yan Airport, noting the club's training record and facility needs. They also reviewed project updates, including a rejected deicing project due to cost overruns, and discussed a fuel truck delivery timeline. The meeting included routine reports and no major decisions were made.

airportgrantsconstructionsoaring-clubfuel-truckdeicing
Mon Aug 28, 2023

Yates County Legislature

Yates County Legislature to vote on extending 1% sales tax to 2025

The Yates County Legislature is holding a special meeting to discuss and review Resolution No. 391-23, which would extend the county's additional 1% sales and use tax through November 30, 2025. The resolution amends the existing 1967 tax law and would take effect December 1, 2023. This is a decision on whether to continue the current tax rate.

sales-taxtaxescounty-legislaturebudget
✓ Decided: Yates County Legislature extends 1% sales and use tax through 2025

The Legislature approved a resolution to extend an additional one percent rate of sales and compensating use taxes. This tax also applies to hotel room occupancy and amusement charges. The enactment takes effect December 1, 2023, and ends November 30, 2025.

Thu Aug 24, 2023

Planning Board

Planning Board to review six referrals including zoning change and short-term rentals

The Yates County Planning Board will consider six General Municipal Law 239 referrals, including a zoning text amendment for recently annexed land in Dundee, special use permits for accessory living quarters and short-term rentals, and a site plan for a new business in Penn Yan. The board will also approve minutes from the July 27 meeting and note the appointment of a new member.

zoningspecial-use-permitshort-term-rentalsite-planplanning-board
✓ Decided: Planning Board approves six local development and zoning referrals

The Planning Board reviewed six GML 239 referrals, finding no significant countywide impact for five projects and a positive impact for one. Approved actions include short-term rental permits and a new athletics business site plan.

Mon Aug 14, 2023

Yates County Legislature

County Legislature to vote on 2024-2028 capital plan and local law on senior tax exemption

The Yates County Legislature is meeting to consider a range of resolutions, including adopting a local law that increases income limits for the senior tax exemption, approving the 2024-2028 Capital Improvement Plan, and ratifying a collective bargaining agreement with corrections employees. The agenda also includes several contract authorizations, budget transfers, and a resolution to expel the Town of Italy from the county's self-insured workers' compensation plan.

budgettax-exemptioncapital-planlaborpublic-safetyelectionscontracts
✓ Decided: Yates County Legislature approves July 2023 audit

The Legislature approved the July 2023 audit totaling $4,411,977.22. A public hearing was held regarding proposed Local Law 1-2023 to increase income limits for senior citizen tax exemptions.

Mon Aug 14, 2023

Yates County Legislature

County to vote on raising senior tax exemption income limit to $20,000

The Yates County Legislature is holding a public hearing on proposed Local Law 1-23, which would increase the income limit for the senior citizens' property tax exemption from its current level to $20,000. The law also updates the sliding scale for incomes above that threshold. If adopted, the new limits would apply to the 2024 assessment rolls.

tax-exemptionseniorsproperty-taxpublic-hearinglocal-law
Tue Aug 8, 2023

Public Safety Committee

Committee to vote on filling probation supervisor vacancy and jail contracts

The Yates County Public Safety Committee is meeting to consider several resolutions, including filling a probation supervisor position, renewing a jail barber agreement, and approving a jail addiction treatment plan. They will also receive updates from the Sheriff, Emergency Services, and Probation departments, including monthly statistics and reports.

public-safetyprobationsheriffjailcontractsbudgetemergency-services
✓ Decided: Public Safety Committee approves probation and sheriff's office authorizations

The Committee approved a resolution to fill a Probation Supervisor position and several authorizations for the Sheriff's Office. The meeting also included operational updates on emergency services and the county communications project.

Tue Aug 8, 2023

Finance Committee

Yates County Finance Committee to vote on senior tax exemption, broadband contracts

The Yates County Finance Committee is meeting to discuss and approve several resolutions, including adopting a local law to increase income limits for the senior tax exemption, authorizing contracts for broadband storage containers and airport improvements, and approving the Capital Improvement Plan for 2024-2028. The committee will also receive updates on broadband construction, finance reports, and tax collection.

tax-exemptionsenior-citizensbroadbandcapital-improvementairportbudgetfinance
✓ Decided: Finance Committee approves 2024-2028 Capital Improvement Plan

The Committee approved the five-year Capital Improvement Plan and a local law increasing income limits for tax exemptions for seniors. Members also authorized several contracts for airport infrastructure and broadband storage, and approved various budget transfers and state aid appropriations.

Mon Aug 7, 2023

Government Operations

✓ Decided: Government Operations Committee approves several resolutions and labor agreement

The Committee approved the expulsion of the Town of Italy from the county's self-insured workers' compensation plan and ratified a collective bargaining agreement for Corrections and other employees. Other approved actions included a grant application for Keuka Lake and a security software contract renewal. A proposal to create two full-time Deputy Election Commissioner positions was tabled until budget time.

Mon Aug 7, 2023

Human Services Committee

Yates Human Services Committee to vote on contracts, hiring, and opioid settlement

The Yates County Human Services Committee is meeting to discuss and vote on several resolutions, including renewing residential services contracts, authorizing the Commissioner of Social Services to reclassify and fill positions, and signing agreements for opioid settlement-funded housing services and transportation for preschool children with disabilities. The agenda also includes reports from the Public Defender, Office for the Aging, Social Services, Public Health, Veterans Services, and Community Services, along with a resolution proclaiming Purple Heart Day.

social-servicespublic-defenderagingpublic-healthveteransopioid-settlementcontractshiring
✓ Decided: Human Services Committee approves staffing changes and service contracts

The Committee approved several Social Services personnel reclassifications and the creation of four caseworker assistant positions. It also authorized contracts for residential services, preschool disability transportation, and opioid settlement housing services.

Mon Aug 7, 2023

Yates County Legislature

County to accept $3.2M USDA broadband grant amendment

The Yates County Legislature is holding a special meeting to discuss and vote on a resolution authorizing the Chair to sign an amended USDA ReConnect grant agreement. The amendment provides an additional $3,202,512 in no-match funding for the county's broadband project and extends the completion deadline to January 5, 2027.

broadbandusda-grantbudgetpublic-hearing
✓ Decided: Yates County accepts $3.2M in supplemental USDA broadband funding

The Legislature approved a resolution to accept $3,202,512 in no-match USDA ReConnect supplemental funding. The agreement extends the project completion date to January 5, 2027.

Mon Aug 7, 2023

Public Works Committee

Yates County Public Works Committee to review highway, building projects and contracts

The Public Works Committee is meeting to discuss highway department operations, including the new Highway/OES/Public Health facility project, and buildings and grounds items. They will consider two resolutions: authorizing a letter of support for a Genesee Transportation Council grant application and approving a $7,100 parking lot maintenance contract with Shuttleworth Enterprises. The agenda also includes routine items like approving minutes and public comment.

highwaybuildings-and-groundscontractsgrantsconstructionparking-lots
✓ Decided: Public Works Committee approves parking lot maintenance and grant support

The Committee approved a contract for parking lot maintenance and a letter of support for a transportation grant. Members received updates on highway projects, including the Pre-Emption Road Bridge award and the status of a new facility project.

Thu Jul 27, 2023

Planning Board

Planning Board to review use variance for commercial storage in Penn Yan

The Yates County Planning Board is meeting to consider a referral under GML 239 for a use variance in the Village of Penn Yan. The applicant proposes subdividing a lot where a barn will become the primary structure for commercial storage. The agenda includes approval of minutes from the May 25 meeting, with no other business listed.

planning-boarduse-variancesubdivisioncommercial-storagepenn-yan
✓ Decided: Planning Board finds negative countywide impact for Penn Yan use variance

The Planning Board reviewed a request for a use variance to subdivide a lot for commercial storage at 182 South Avenue in the Village of Penn Yan. The Board determined the application has a negative countywide impact due to the potential precedence of accepting use variances based on self-created hardships.

Wed Jul 26, 2023

Airport Council

Airport council moves construction projects to C&S, rejects high bid

The Yates County Airport Council discussed and approved moving construction projects to C&S, rejected a high bid for deicing area work, and reviewed grant balances. They also discussed the upcoming expiration of the Seneca/Yates County Airport Agreement and agreed to extend an FAA solar lighting study.

airportconstructiongrantscontractsfuel
Tue Jul 25, 2023

Yates County Legislature

County to approve fireworks contracts for Bicentennial celebration

The Yates County Legislature is holding a special meeting to discuss and review a resolution authorizing the County Chair to sign agreements for a fireworks exhibition. The fireworks display is part of the official Bicentennial Celebration in Penn Yan on August 12, 2023, and would be conducted by Young Explosives Corporation at a cost of $3,500. The resolution also covers a barge services agreement with Veley Enterprises, LLC.

fireworksbicentennialcontractsspecial-meeting
✓ Decided: Legislature authorizes contracts for Bicentennial fireworks display

The Legislature unanimously approved authorizing the Chair to sign agreements for a fireworks exhibition on August 12, 2023. The display will be launched from a barge on Keuka Lake, with costs covered by an anonymous donor.

Mon Jul 10, 2023

Yates County Legislature

Yates County to hold public hearing on $400K CDBG application for well/septic replacements

The Yates County Legislature will hold a public hearing on July 10, 2023, to hear comments on the county's community development needs and discuss a possible Community Development Block Grant (CDBG) application for the 2023 program year. The county is applying for $400,000 in CDBG funds to replace well and septic systems, including lateral connections, for low- and moderate-income persons. The hearing also allows for citizen participation and technical assistance for alternate proposals. After the hearing, the legislature will consider any other business that may come before it.

public-hearingcdbggrantshousinginfrastructuresepticwells
Mon Jul 10, 2023

Yates County Legislature

Yates County Legislature to vote on 35 resolutions including SRO agreement and public health hires

The Yates County Legislature is meeting on July 10, 2023, to consider a wide range of resolutions, including authorizing contracts, filling county positions, appointing an election commissioner, and requesting a veto of state environmental legislation. The agenda also includes a public hearing on a Community Development Block Grant application and several proclamations.

contractspublic-healthelectionsenvironmentschool-resource-officerbudgetpersonnel
✓ Decided: Legislature approves SRO contract and probation software renewal

The Yates County Legislature approved several administrative contracts, including a school resource officer agreement and software maintenance. The board also held a public hearing regarding a state grant application for septic and well repairs.

Mon Jul 10, 2023

Yates County Legislature

County sets standard work days for elected and appointed officials

The Yates County Legislature is considering Resolution No. 326-23, which establishes standard work days for elected and appointed officials and directs reporting to the New York State and Local Retirement System. The agenda is largely a procedural form, with one named official, Coroner Jon Van Dermark, listed with a standard work day of 7 hours and bi-weekly pay.

county-legislatureofficialsretirementresolutionprocedural
Wed Jul 5, 2023

Public Safety Committee

Committee to vote on $57,380 SRO agreement with Dundee schools

The Yates County Public Safety Committee is meeting to review monthly statistics from the District Attorney, Probation, Emergency Services, and Sheriff's offices, and to vote on two resolutions: one authorizing an EMS training contract with William DiFabio and another authorizing a School Resource Officer agreement with Dundee Central School District for $57,380.40. The agenda also includes updates on jail population, E911 staffing, and a public safety communications project.

public-safetysheriffschool-resource-officeremergency-servicesjaile911contracts
✓ Decided: Public Safety Committee approves SRO services and probation software renewal

The Committee approved several resolutions including a contract for School Resource Officer services and a software maintenance agreement for probation. Members also reviewed monthly statistics for the District Attorney, Probation, and Sheriff's office.

Wed Jul 5, 2023

Government Operations

Committee to consider appointing Sheila Burt as Republican election commissioner

The Yates County Government Operations Committee is meeting to hear reports from county departments and consider resolutions, including appointing a Republican election commissioner and adopting a standard workday policy. The agenda includes updates on elections, records management, soil and water conservation, and other county operations.

electionsappointmentspersonnelsoil-and-watergrantslegislation
✓ Decided: Government Operations Committee approves election commissioner appointment

The Committee approved the appointment of a Republican Election Commissioner and a Standard Workday Resolution. Members also requested resolutions opposing the Class C Stream Bill and Clean Slate Legislation.

Wed Jul 5, 2023

Human Services Committee

Human Services Committee to review contracts, grants, and program updates

The Yates County Human Services Committee is meeting to discuss and vote on multiple resolutions, including contract renewals and authorizations for social services, public health, and community services. They will also receive reports from the Public Defender, Office for the Aging, Social Services, Public Health, Veterans, and Community Services. The agenda includes a mix of routine administrative items and substantive funding decisions.

contractspublic-healthsocial-servicespublic-defenderveteransgrants
✓ Decided: Human Services Committee approves multiple agency contracts and staffing positions

The Committee approved several resolutions to renew service contracts, authorize new staffing positions for Public Health and Social Services, and sign agreements for opioid settlement funds. It also approved two proclamations for August 2023.

Wed Jul 5, 2023

Finance Committee

County to set public hearing on raising senior tax exemption income limit to $20,000

The Yates County Finance Committee will consider setting a public hearing for a proposed local law that would increase the income limit for the senior (AGED) property tax exemption to $20,000, and will also review resolutions on agricultural district review and budget transfers. The committee will hear updates on broadband construction, real property assessments, and finance reports. The agenda includes routine items like approving minutes and public comment.

tax-exemptionseniorsagriculturebroadbandbudgetreal-propertypublic-hearing
✓ Decided: Finance Committee approves budget transfers and auditing service extension

The Committee approved several financial resolutions, including budget transfers and a five-year contract extension for auditing services. It also authorized a public hearing for a tax exemption law and a review period for Agricultural District #1.

Wed Jul 5, 2023

Public Works Committee

Highway committee to fill two vacancies, declare surplus vehicle

The Yates County Public Works Committee will consider four resolutions: declaring a 2020 Chevy Equinox surplus for auction, authorizing the Highway Superintendent to fill Working Supervisor and Heavy Equipment Operator vacancies, and authorizing allowance allocations for the new Highway/OES/Public Health facility project. The committee will also receive updates on highway maintenance, capital projects, and building and grounds issues.

highwaybudgetpersonnelfacilitiesequipmentpublic-works
✓ Decided: Public Works Committee approves equipment surplus and new highway positions

The Committee approved resolutions to declare equipment surplus, fill two highway positions, and authorize allowance allocations for the Highway/OES/PH facility. The meeting also included status updates on county road paving and facility projects.

Wed Jun 28, 2023

Airport Council

Airport Council reviews taxiway extension, fuel truck, and FBO contract renewal

The Yates County Airport Council met to review ongoing projects, including the taxiway extension for runways 10/28, the upcoming fuel truck delivery, and the re-bidding of the deice application area. They also discussed the FBO contract that expires in November 2023 and plans for a replacement council member.

airportconstructioncontractsfuelgrantsinfrastructure
Fri Jun 23, 2023

Yates County Legislature

County to vote on $300K extra soil removal at new facility

The Yates County Legislature is holding a special meeting to discuss and vote on a resolution authorizing up to $300,000 in additional unsuitable soil removal and replacement at the new Highway, Office of Emergency Services, and Public Health Facility. The work would be done by DiFiore Construction on a time-and-materials basis at $70 per cubic yard, funded from the project contingency.

constructioncounty-facilitiespublic-worksbudgetcontracts
✓ Decided: Legislature approves $300,000 for unsuitable soil removal at county facility

The Legislature unanimously approved a contract amendment for DiFiore Construction, Inc. to remove and replace additional unsuitable soils. The funds will be drawn from the project contingency line item. The board also authorized the expenditure of up to $50,000 for potential contaminated soils at the Fuel Island project.

Thu Jun 22, 2023

Planning Board

Planning Board to review five referrals including 32-unit apartment complex

The Yates County Planning Board is meeting to consider five General Municipal Law 239 referrals, including a text amendment, a special use permit modification, two site plans, and a special use permit. The most substantial item is a proposal to build eight 4-unit apartment buildings on Hamilton Street in Penn Yan. The board will also hear communications about the Town of Gorham's comprehensive plan update and the Town of Jerusalem's lead agency role on a road project.

zoningspecial-use-permitsite-planapartmentsshort-term-rentalplanning-board
Mon Jun 12, 2023

Yates County Legislature

Yates County Legislature to vote on ambulance housing, jail purchases, and new staff position

The Yates County Legislature is meeting to vote on a series of resolutions covering emergency services, jail operations, personnel, and infrastructure. Key items include authorizing agreements to house ambulances in Branchport/Keuka Park and Dundee, purchasing a new jail washer, and creating a full-time Planner Assistant position. The agenda also includes routine approvals of minutes, audits, and budget transfers.

emergency-servicesjailpersonnelbudgetpublic-safety
✓ Decided: Legislature approves ambulance housing and jail equipment purchases

The Yates County Legislature authorized agreements to house ambulances in Branchport/Keuka Park and the Village of Dundee. The board also approved the purchase of a new commercial washer for the county jail and agreements to house inmates from Tompkins and Oswego counties.

Tue Jun 6, 2023

Public Safety Committee

Sheriff seeks approval for jail contracts, camera purchase, and equipment storage

The Yates County Public Safety Committee is meeting to hear updates from the District Attorney, Probation, Emergency Services, and the Sheriff, and to vote on several resolutions. The main items are authorizing contracts to house inmates from Tompkins and Oswego counties, purchasing a security camera, amending the jail telephone services agreement, and renting temporary storage for communications equipment. The committee will also review monthly statistics and reports from various departments.

sheriffjailpublic-safetycommunicationscontractsequipmentbudget
✓ Decided: Public Safety Committee approves jail equipment and communications tower disposal

The committee reached a consensus to purchase a new jail washer and approved several resolutions regarding jail contracts and security. They also approved the disposal of surplus legacy communications equipment following the commissioning of new radio systems.

Tue Jun 6, 2023

Finance Committee

Yates County Finance Committee to vote on broadband contract increase, new planner position

The Yates County Finance Committee is meeting to discuss and vote on several resolutions, including amending a broadband contract with LaBella Associates for an additional $75,000, authorizing the creation of a new full-time Planner Assistant position, and approving various budget transfers. The committee will also receive updates on the ReConnect broadband project, real property taxes, and the county's financial status.

broadbandbudgetplanningstaffingreal-propertyfinance
✓ Decided: Finance Committee approves budget transfers and new planner assistant position

The Committee approved several 2023 budget transfers and the creation of a Planner Assistant position. It also authorized agreements for the ReConnect broadband project and accepted consultant fees for airport terminal apron construction.

Mon Jun 5, 2023

Government Operations

County committee reviews union talks, Juneteenth closures, and election prep

The Yates County Government Operations Committee is meeting to hear reports from county departments including Elections, Soil & Water, Cornell Cooperative Extension, IT, Clerk, Personnel, and the County Administrator. Key items include updates on union negotiations, Juneteenth office closures, a possible state of emergency for asylum seekers, and election preparations for 2024.

electionsunion-negotiationsjuneteenthemergency-managementcounty-operations
✓ Decided: Government Operations Committee approves May meeting minutes

The committee approved the minutes from the May meeting. Members received departmental updates on elections, soil and water projects, and IT services, but tabled a decision on a Standard Workday Resolution pending further information.

Mon Jun 5, 2023

Human Services Committee

Yates County Human Services Committee to review contracts, grants, and program updates

The Yates County Human Services Committee is meeting to discuss and potentially approve several contracts and resolutions, including agreements with the Finger Lakes Workforce Investment Board, the Research Foundation for Mental Hygiene, and the Penn Yan Central School District for opioid settlement funds. The agenda also includes updates from various departments such as Public Defender, Office for the Aging, Social Services, Public Health, Veterans, and Community Services, covering topics like SNAP, homeless housing, and workforce development. The meeting will also review grant status reports and statistics.

contractsgrantssocial-servicespublic-healthyouth-programsopioid-settlement
✓ Decided: Human Services Committee approves workforce and public health contracts

The Committee approved three authorizations for contracts involving the Finger Lakes Workforce Investment Board, Health Research Inc., and the Penn Yan Central School District. Members also received statistical reports from the Office for the Aging, Social Services, Public Health, and Veterans services.

Mon Jun 5, 2023

Public Works Committee

Yates County Public Works to award landfill leachate hauling and guiderail contracts

The Public Works Committee is meeting to consider several resolutions, including awarding a leachate hauling contract for the county landfill and a guiderail installation contract for Chubb Hollow Road. They will also vote on amendments to contracts for the new Highway/OES/Public Health facility project, including increases for engineering and mechanical work and a decrease for general construction. The agenda includes updates on road paving, bridge projects, and building maintenance items.

public-workscontractshighwaylandfillfacilities
✓ Decided: Committee approves new natural gas line routing and several facility contracts

The Committee approved the routing of a new natural gas main from Preemption Road to Havens Corners. Members also approved several contract amendments for the Highway/OES/Public Health facility and authorized HVAC and automation system upgrades.

Wed May 31, 2023

Airport Council

Airport council reviews taxiway extension, grants, and equipment bids

The Yates County Airport Council met to review ongoing projects, including a taxiway extension for runways 10/28, grant applications, and equipment purchases. They discussed the status of a NYS DOT grant, CARES funding for security cameras, and approved proceeding with a rebid for deice fluid application. Several items were tabled for future meetings, including a review of the taxiway extension and a new airport agreement.

airportgrantsconstructionequipmenttaxiway
Thu May 25, 2023

Planning Board

✓ Decided: Planning Board approves six special use permit referrals

The Planning Board reviewed and approved six GML 239 referrals for various businesses and expansions in the Town of Starkey and Village of Penn Yan. These include a farm winery, two short-term rentals, a can redemption center, and facility expansions for a vineyard and disposal service.

Mon May 8, 2023

Yates County Legislature

Yates County Legislature to vote on contracts, budget transfers, and airport project bid

The Yates County Legislature is meeting to consider a wide range of resolutions, including authorizing contracts for emergency planning, insurance renewal, and various county services. They will also vote on budget transfers, appropriations, and a bid for the Penn Yan-Yates County Airport terminal apron construction. Several resolutions amend prior contracts for the Public Safety Communications Project, increasing their amounts.

contractsbudgetpublic-safetyairportinsuranceemergency-services
✓ Decided: Legislature approves $3.5M in April audits, 7 resolutions unanimously

The Yates County Legislature approved the April 2023 audit totaling $3,531,468.14 and passed seven resolutions unanimously, including authorizing a probation data-sharing agreement, a $135,000 emergency planning contract with Tetra Tech, and a security camera purchase for $6,598.47. Legislators also heard reports on state mandates increasing county costs by over $500,000 annually for Medicaid and $1.3 million in withheld eFMAP refunds.

Thu May 4, 2023

Yates County Legislature

County seeks to renew 1% sales tax and mortgage recording tax

The Yates County Legislature is meeting to consider two resolutions requesting home rule legislation to renew the county's 1% sales tax increase and an additional 0.25% mortgage recording tax, both set to expire in late 2023. The meeting also includes a session with state Senator O'Mara and Assemblyman Palmesano to discuss topics such as unpaid Medicaid reimbursements, a denied communications grant, energy grid capacity, state housing mandates, mental health resources, EMS challenges, utility billing errors, a bridge repair grant, a potential pool project, population/business exodus, and budget concerns.

sales-taxmortgage-recording-taxmedicaidgrantsmental-healthemsenergy
✓ Decided: Legislature unanimously requests renewal of 1% sales tax increase

The Yates County Legislature voted unanimously to request home rule legislation from the state to renew the 1% county sales tax increase (set to expire Nov. 30, 2023) through Nov. 30, 2026, and to renew the additional 0.25% county recording tax on mortgages (set to expire Dec. 1, 2023) through Dec. 1, 2025. The board also authorized the chairwoman and county attorney to execute a $60,000 permanent easement with Aaron and Linda Reiff for airport runway flight path restrictions, funded by the FAA. Public comment included youth speakers on Second Amendment rights and playground fundraising, as well as citizen concerns about state Medicaid funding and energy policy.

Tue May 2, 2023

Public Safety Committee

Yates County Public Safety Committee reviews resolutions, stats, and capital plans

The Yates County Public Safety Committee is meeting to review monthly statistics and updates from the District Attorney, Probation, Emergency Services, and Sheriff's offices. They will consider several resolutions, including authorizing the Probation Director to sign an agreement with the state, recognizing Peace Officers' Memorial Day, and approving an inter-municipal agreement with Schuyler County. The committee will also discuss capital improvement plans for emergency services vehicles and equipment.

public-safetyresolutionscapital-planemergency-servicessheriffprobation
✓ Decided: Public Safety Committee approves several agency agreements and security purchases

The Committee approved resolutions for the Probation Department, Emergency Services, and the Sheriff's Office. Decisions included authorizing a data agreement with the state, a contract with Tetra Tech, Inc., and the purchase of a security camera. Two resolutions regarding the communications project were also amended.

Tue May 2, 2023

Finance Committee

✓ Decided: Finance Committee approves ReConnect broadband contract and multiple resolutions

The Yates County Finance Committee approved several resolutions, including a Master Services Agreement for the ReConnect broadband project, an inter-municipal agreement for hazardous waste services, and various budget transfers and appropriations. The committee also accepted a bid for airport terminal apron construction and authorized an easement. No substantive decisions were denied or tabled.

Mon May 1, 2023

Government Operations

County weighs $246,280 voting system replacement, insurance renewal

The Government Operations Committee is reviewing department reports and resolutions, including authorizing the chair to request a .gov domain for the Sheriff's Office, amending the 2023 non-union salary schedule, and approving insurance renewals. The agenda also covers IT updates, election preparations, and a proposed $246,280 voting system replacement for the Board of Elections.

electionsinsuranceitresolutionssheriffbudget
✓ Decided: Committee approves insurance renewals and personnel salary updates

The Government Operations Committee approved resolutions for insurance renewals, a .GOV domain for the Sheriff's Office, and updates to the non-union exempt employee salary schedule and administrative guide. The committee also reached a consensus on specific insurance policy terms for the airport and workers' compensation.

Mon May 1, 2023

Human Services Committee

Human Services Committee to vote on contracts, grants, and proclamations

The Yates County Human Services Committee is meeting to discuss and vote on multiple resolutions, including authorizing contracts for social services, filling a vacant position, and proclaiming several observances. The agenda includes reports from the Public Defender, Office for the Aging, Social Services, Public Health, Community Services, and Veterans' Services, with several items requiring formal approval.

social-servicespublic-healthveteranscontractsproclamationsgrants
✓ Decided: Human Services Committee approves multiple social service and health contracts

The Committee approved several resolutions regarding social services, public health, and community service contracts. It also authorized the proclamation of four veteran-related commemorative days in May and June.

Mon May 1, 2023

Public Works Committee

Highway committee to review $13.1M paving plan, $259K garage fleet, and energy contract

The Yates County Public Works Committee is meeting to discuss highway and buildings/grounds operations, including a proposed 5-year capital paving plan totaling $13.1 million and a Central Garage vehicle replacement plan costing $259,548. The committee will also consider two resolutions: authorizing the Legislature Chairwoman to sign a three-year electricity supply agreement with Constellation New Energy, Inc., and declaring two surplus pickup trucks for sale. The agenda includes routine items like approving April minutes, public comment, and an executive session if needed.

highwaycapital-planequipmentenergy-contractsurplus-equipment
✓ Decided: Public Works Committee approves energy agreement and Rural Net contract

The Committee approved resolutions to sign an agreement with Constellation New Energy, Inc. and a contract with Rural Net for POP space rental. The meeting also included updates on road projects, vehicle deliveries, and facility maintenance.

Thu Apr 27, 2023

Planning Board

Planning Board reviews 16 referrals including concrete plant, bank, brewery, and 10 short-term rentals

The Yates County Planning Board is reviewing 16 General Municipal Law (GML) 239 referrals, including special use permits, site plans, a use variance, and a comprehensive plan update. Notable items include a concrete batch plant in Barrington, a new bank branch in Penn Yan, a craft brewery, and multiple short-term rental applications in Penn Yan. The board will also approve minutes from the March 23 meeting.

planning-boardspecial-use-permitsite-planshort-term-rentalcomprehensive-planzoning
✓ Decided: Planning Board approves several site plans and short-term rental permits

The Planning Board reviewed multiple GML 239 referrals, finding no significant countywide impact for several business and rental applications. The Board marked the Town of Barrington's Comprehensive Plan as incomplete. One application for a bakery and residence in Dresden was noted as having a positive countywide impact.

Wed Apr 26, 2023

Airport Council

Airport council reviews taxiway extension, bids, and safety concerns

The Yates County Airport Council discussed ongoing projects including the taxiway extension for runways 10/28, the status of grants, and bid results for the terminal apron and deice pad. They also addressed a safety concern about the new backup generator not powering fuel tanks or radios, and agreed to consider making emergency training an annual event.

airportinfrastructuregrantssafetyconstructionbids
Mon Apr 24, 2023

Airport Council

Yates County seeks bids for airport deicing fluid management improvements

The Yates County Airport Council is advertising for sealed bids for the Deicing Fluid Management Improvements project at Penn Yan-Yates County Airport. The base bid includes constructing a concrete pad of about 1,300 square yards, installing storm drain, holding tank, pump, and electrical work. Two alternates reduce the pad size. Bids are due April 24, 2023, and must include a 5% bid bond.

airportconstructionbidsdeicinginfrastructure
Mon Apr 17, 2023

Airport Council

Yates County seeks bids for terminal apron rehabilitation at Penn Yan airport

Yates County is accepting sealed bids for the Terminal Apron Rehabilitation project at Penn Yan–Yates County Airport. The work includes milling existing asphalt, placing 2 inches of new asphalt, and new pavement markings. Bids are due April 17, 2023, and will be publicly opened and read aloud. This is a procurement action, not a policy decision.

airportconstructionbidsinfrastructurepenn-yan
Mon Apr 10, 2023

Yates County Legislature

Yates County Legislature to vote on opioid settlements, road bids, and ReConnect contracts

The Yates County Legislature is meeting to vote on a wide range of resolutions, including authorizing opioid settlement agreements with major pharmacies, awarding road construction bids, and entering into contracts for the ReConnect broadband project. The agenda also includes several recognitions, proclamations, and routine administrative items such as budget transfers and personnel actions.

budgetcontractsroadsbroadbandopioid-settlementpublic-safetypersonnel
✓ Decided: Yates County approves multiple contracts for new Highway and Public Health facility

The Legislature approved several construction and site work contracts for a new Highway Department, Office of Emergency Services, and Public Health facility. It also authorized a natural gas main installation for the facility and the Town of Benton. Additionally, the board created a temporary County Administrator Assistant position.

Mon Apr 10, 2023

Yates County Legislature

County Legislature workshop to prioritize county projects

The Yates County Legislature is holding a workshop on April 10, 2023, to prioritize county projects. No formal action is expected; the meeting is for discussion only.

county-legislatureworkshopproject-prioritization
✓ Decided: Legislature reaches consensus to transfer $7.2M to Building Reserve Fund

The County Administrator presented a memo on prioritizing unassigned General Fund balances for various countywide projects. The Legislature reached a consensus for a resolution to be brought forward in May to fund the Building Reserve Fund.

Tue Apr 4, 2023

Public Safety Committee

Committee to authorize filling 911 dispatcher and food service vacancies

The Yates County Public Safety Committee will vote on resolutions to fill two vacant sheriff's office positions: an Emergency Services Dispatcher and a Food Service Helper. The committee will also approve a letter of intent with Finger Lakes Health for EMS services and recognize several public safety weeks and an Officer of the Year. Routine updates on jail population, probation statistics, and emergency response activities are also on the agenda.

public-safetysheriffemergency-servicespersonnelems
✓ Decided: Public Safety Committee approves staffing and equipment resolutions

The Committee approved several administrative actions, including the appointment of the Probation Director and the filling of Sheriff's Office positions. It also authorized the disposal of surplus equipment at two communications tower sites and the signing of a Letter of Intent for Finger Lakes Health.

Tue Apr 4, 2023

Finance Committee

✓ Decided: Finance Committee approves ReConnect project contracts and budget transfers

The Committee approved several contracts for the ReConnect broadband project and waste services. It also authorized 2023 budget transfers and the appropriation of additional state and federal aid for DSS and highways.

Mon Apr 3, 2023

Human Services Committee

Yates County Human Services Committee to review grants, contracts, and fill position

The Yates County Human Services Committee is meeting to discuss and vote on several resolutions, including authorizing 2023 Youth Bureau contracts, filling a Social Services Program Examiner position, and recognizing a youth award recipient. They will also receive reports from the Public Defender, Social Services, Public Health, Community Services, Veterans, and Office for the Aging, including grant status updates and program statistics.

youth-bureausocial-servicespublic-defendergrantspersonnelpublic-health
✓ Decided: Human Services Committee approves youth bureau contracts and medical director appointment

The Committee approved several resolutions regarding youth bureau contracts, a Social Services staffing position, and the appointment of Dr. Eleanor DeWitt as Medical Director. It also approved appointments to the Community Services Board and Mental Health Subcommittee. The meeting concluded with a unanimous vote to enter executive session to discuss an individual's employment history.

Mon Apr 3, 2023

Government Operations

County to consider Lake Friendly Living and Donate Life proclamations

The Yates County Government Operations Committee will hear reports from the Historian, Records Management, Soil & Water, Cornell Cooperative Extension, IT, County Clerk, Personnel, and the County Administrator. The committee will consider two resolutions: one to continue participating in Lake Friendly Living Awareness Month and another proclaiming April as Donate Life Month. The County Administrator will also discuss the Governor's proposed budget, which includes a change to DMV fee retention for counties.

✓ Decided: Committee approves forest land inventory and several county resolutions

The Government Operations Committee authorized the Forest Land Inventory Management Project to update county forest goals. The committee also approved resolutions regarding Lake Friendly Living Awareness Month, Donate Life Month, and a request for the Governor to dismiss utility rate hikes. Amendments to the employee handbook and administrative guide were approved.

Mon Apr 3, 2023

Public Works Committee

Yates County to award $18.7M in construction contracts for new Highway/OES/PH facility

The Public Works Committee will consider awarding multiple construction contracts totaling $18,676,669 for the new Highway, Office of Emergency Services, and Public Health facility, along with several road maintenance bids. They will also discuss routine highway operations, building projects, and other administrative items. The meeting includes public comment and an executive session if needed.

highwayconstructioncontractsbidsfacilityroads
✓ Decided: Public Works Committee advances multiple highway and building contracts

The committee approved several contracts for fire alarm services, courthouse maintenance, and brick restoration. A motion to bring 15 highway-related resolutions to the legislative meeting was passed following a tie-breaking vote by the Chairwoman.

Wed Mar 29, 2023

Airport Council

Yates County Airport Council discusses runway extension, grants, and equipment purchases

The Yates County Airport Council met to review ongoing projects, including a taxiway extension for runways 10/28, grant funding status, and equipment purchases. They discussed a fuel truck bid award, a deice truck, and a quote for restriping runway 10/28. The council also considered a Safety Management System and gate repairs.

airportinfrastructuregrantsequipmentsafety
Thu Mar 23, 2023

Planning Board

✓ Decided: Planning Board approves two solar farms and senior housing district

The Planning Board reviewed several GML 239 referrals, approving two 5MW community solar projects in the Town of Benton and a new senior citizen housing district in the Village of Penn Yan. The board also approved a zoning map update for the Village of Dundee and several special use permits. One area variance for a storage shed in the Town of Benton was found to have a negative countywide impact.

Thu Mar 16, 2023

Yates County Legislature

Special session to discuss appointment of a particular person

The Yates County Legislature will hold a special session on March 16, 2023, at 9:15 a.m. in the Legislative Chambers. The only anticipated action is a motion to convene an executive session to discuss matters leading to the appointment of a particular person. No other business is listed.

appointmentsexecutive-sessioncounty-legislature
✓ Decided: Legislature rejects labor agreement with Council 82 Corrections Unit

The legislature voted down a resolution to ratify a tentative labor agreement for the corrections bargaining unit. A motion to appoint Scott Schrader as County Administrator and Budget Officer was postponed.

Mon Mar 13, 2023

Yates County Legislature

✓ Decided: Yates County Legislature opposes state ban on fossil fuel heating

The Legislature unanimously passed a resolution opposing Governor Hochul's proposal to ban new fossil fuel heating equipment by 2030. The board also authorized the establishment of a county-run ambulance service and approved several public safety and infrastructure contracts.

Mon Mar 13, 2023

Public Safety Committee

Yates County Public Safety Committee to hear fleet management presentation

The Yates County Public Safety Committee is holding a special meeting on March 13, 2023, at 12:00 p.m. in the Legislative Chambers, 417 Liberty St., Penn Yan, NY. The sole agenda item is an Enterprise Fleet Management Presentation. No decisions or votes are listed; the meeting is informational only.

public-safetyfleet-managementmeeting
✓ Decided: Public Safety Committee discussed fleet management presentation

The committee heard a presentation from Connor Kimball of Enterprise Fleet Management. No substantive decisions were made, and the item was not brought to the full legislature.

Tue Mar 7, 2023

Finance Committee

Finance Committee reviews broadband project, budget transfers, and tax auction

The Yates County Finance Committee is meeting to review departmental reports and consider several resolutions, including amendments to planning authority and budget transfers. Key items include updates on the ReConnect broadband project, real property tax auction preparations, and various appropriations and budget adjustments.

budgetbroadbandplanningtaxgrantsairport
✓ Decided: Finance Committee approves budget transfers and planning board updates

The Committee approved several budget transfers for 2022 and 2023, as well as additional state aid for the Sheriff, Finance, and DSS. It also approved resolutions regarding the Planning Board and Natural and Recreational Resources grants. The meeting concluded with a unanimous vote to enter executive session for legal consultation.

Tue Mar 7, 2023

Public Safety Committee

Yates County to consider establishing municipal ambulance service

The Public Safety Committee will vote on resolutions to rescind a prior resolution and authorize the county to apply for a Municipal Certificate of Need to establish an ambulance service, along with a controlled substances agreement. They will also consider renewing contracts for microwave tower service and jail eye-scanning maintenance, and amending a temporary correction officer appointment. The agenda includes monthly statistics from the District Attorney, Probation, Emergency Services, and Sheriff, plus updates on jail operations and a domestic terrorism plan.

public-safetyambulanceemergency-servicessheriffjailcontractsresolutions
✓ Decided: Public Safety Committee approves emergency services and sheriff authorizations

The Committee approved several resolutions regarding emergency medical services, sheriff's office contracts, and the public safety communications project. Members also agreed to pursue the purchase of a narcotics detection machine for the jail.

Mon Mar 6, 2023

Government Operations

County committee to hear health insurance consortium presentation, consider resolutions

The Yates County Government Operations Committee will meet to hear department reports, including a health insurance consortium presentation, and consider resolutions on a leadership development contract and opposing a state gas stove ban. The agenda includes routine items like minutes approval and public comment, plus updates from Elections, Soil & Water, Cornell Cooperative Extension, IT, County Clerk, Personnel, and the County Administrator.

health-insuranceresolutionsauditelectionssoil-and-watercooperative-extensionpersonnel
✓ Decided: Committee approves leadership development contract and gas stove ban opposition

The Committee approved several resolutions, including a leadership development agreement with Savannah Consulting and a resolution opposing Governor Hochul's ban on gas stoves. They also authorized the use of the county parking lot and courthouse lawn for a June 16th event.

Mon Mar 6, 2023

Human Services Committee

Human Services Committee to vote on contracts, lifeguard funding, and appointments

The Yates County Human Services Committee is meeting to discuss and vote on several resolutions, including authorizing lifeguard funding for local municipalities, amending a contract for counseling services, and reappointing members to the Finger Lakes Workforce Investment Board. They will also hear reports from the Public Defender, Office for the Aging, Social Services, Public Health, Veterans, and Community Services departments, covering topics like caseloads, grant status, program updates, and community health initiatives.

human-servicescontractslifeguard-fundingworkforce-boardpublic-healthsocial-servicesveterans
✓ Decided: Human Services Committee approves burial rates and multiple service contracts

The Committee approved new burial and cremation rates and several service contracts. It also authorized the Chair to sign a Resource Allocation Plan and a Memorandum of Understanding for funding. An amendment to the agreement with Health Research Inc. was approved.

Mon Mar 6, 2023

Public Works Committee

✓ Decided: Public Works Committee approves equipment surplus and building staff hires

The Committee approved resolutions to declare surplus equipment, amend a contract with C&S Engineers, and authorize a service agreement with gWorks. It also approved filling two building maintenance positions and the installation of a pollinator garden in the courtyard.

Thu Mar 2, 2023

Yates County Legislature

Special session to discuss employment history of an individual

The Yates County Legislature is holding a special meeting on March 2, 2023, solely to enter executive session regarding the employment history of a particular individual. No other business is listed on the agenda.

executive-sessionemploymentcounty-legislature
✓ Decided: Legislature approves letters of support for community and tourism projects

The Yates County Legislature unanimously approved three resolutions authorizing the Chairwoman to sign letters of support for federal funding and operating permits. These actions support the Yates Community Center, the Finger Lakes Tourism Alliance, and Lakeside Trolley, LLC.

Thu Feb 23, 2023

Planning Board

✓ Decided: Planning Board approves cell tower and Village of Rushville comprehensive plan

The Planning Board reviewed several GML 239 referrals, finding positive countywide impact for a new wireless tower and the Village of Rushville's comprehensive plan. Other applications for business offices and a residential variance were found to have no significant countywide impact. Two solar farm applications were postponed.

Wed Feb 22, 2023

Airport Council

Airport Council reviews FAA mandates, grants, and equipment purchases

The Yates County Airport Council met to discuss airport operations, including FAA safety mandates, grant funding, and equipment purchases. They reviewed ongoing projects like taxiway extensions, a GPS approach, and terminal apron rehabilitation, and discussed the need for a new Airport Master Plan.

airportgrantsinfrastructuresafetyequipment
Wed Feb 22, 2023

Yates County Legislature

Legislature to hold special meeting regarding an individual's employment history

The Yates County Legislature will hold a special session on February 22, 2023. The meeting is scheduled to enter into an Executive Session to discuss the employment history of a particular individual.

personnelexecutive-sessiongovernment-operations
✓ Decided: Legislature approves $125,076 for broadband network equipment build-out

The Legislature authorized the Chairwoman to sign five contracts with Empire Access to procure materials and labor for the Reconnect 1 Broadband Project. The funding, sourced from a USDA grant, covers the build-out of four Points of Presence and one Uplink Node.

Mon Feb 13, 2023

Yates County Legislature

Yates County Legislature to vote on 100+ resolutions including EMS hiring and contracts

The Yates County Legislature is meeting to vote on a large agenda of resolutions, including creating and filling six full-time paramedic and six full-time EMT positions, approving contracts for EMS billing and radio maintenance, and accepting a FEMA hazard mitigation grant. The agenda also includes numerous routine items such as budget transfers, appointments, and bid awards.

emergency-servicesbudgetgrantsappointmentscontractspublic-safety
✓ Decided: Yates County Legislature approves expansion of county-wide ambulance services

The Legislature authorized the creation of 12 full-time and at least 6 part-time paramedic and EMT positions to establish county-wide ambulance services. Several infrastructure reserve funds were appropriated for public safety towers and broadband projects. The board also approved multiple highway material bids and airport rehabilitation grants.

Tue Feb 7, 2023

Public Safety Committee

Yates County Public Safety Committee to vote on hiring 12+ EMS staff and accepting FEMA grant

The Yates County Public Safety Committee is meeting to discuss and vote on several public safety matters, including filling probation and emergency services positions, accepting a FEMA hazard mitigation grant, and appointing advisory board members. The agenda includes monthly statistics from the District Attorney, Probation, Emergency Services, and Sheriff, as well as updates on jail operations and communications projects.

public-safetyemergency-servicesprobationgrantshiringambulance
✓ Decided: Public Safety Committee approves new EMS staffing and emergency service grants

The Committee approved several resolutions to create and fill paramedic and EMT positions. It also authorized the acceptance of a FEMA hazard mitigation grant and renewed inmate medical services. The December 29th meeting minutes were approved.

Tue Feb 7, 2023

Finance Committee

Finance Committee votes on budget transfers and broadband construction contracts

The Yates County Finance Committee met to review the January financial report and approve multiple budget transfers for 2022 and 2023. The committee discussed the progress of the ReConnect 1 broadband project, including the start of fiber construction and the authorization of a contract with Empire Access for equipment installation. Additionally, the body reviewed planning updates regarding agricultural district reviews and solid waste management.

budgetbroadbandtransportationplanningagriculture
✓ Decided: Finance Committee approves budget transfers and infrastructure agreements

The Committee approved numerous budget transfers for 2022 and 2023, as well as several administrative resolutions regarding agricultural districts and public employees' bonds. Key approvals included a broadband hut build-out agreement and a terminal apron rehabilitation consultant for the airport.

Mon Feb 6, 2023

Public Works Committee

Yates County Public Works Committee to award six highway material and service bids

The Yates County Public Works Committee is meeting to review highway department operations and vote on six bid awards for materials and services including abrasive sand, cold mix patch, gravel, crushed stone, vegetation control, and crane rental. The agenda also includes updates on building projects, bridge repairs, and equipment purchases. Public comment is scheduled.

highwaybidspublic-worksroadsbridgesequipmentbudget
✓ Decided: Public Works Committee approves multiple highway bids and facility repairs

The Committee approved bids for highway materials and services, including abrasive sand, gravel, and vegetation control. It also authorized contracts for security system updates and emergency freezer repairs. Additionally, the Committee approved applying for a $10,000 NYSERDA CEC grant for electric vehicle chargers.

Mon Feb 6, 2023

Government Operations

Yates County committee to weigh solar farmland resolutions, contracts

The Government Operations Committee will hear reports from county departments and vote on several resolutions, including supporting state sharing of agricultural mitigation fees for solar projects, encouraging landowners to use marginal lands for solar arrays, authorizing an IT contract with Layer 3 Technologies for $3,000, and appointing a Director of Public Health. The agenda also includes updates on elections, soil and water conservation, and other administrative items.

agriculturesolarit-contractpublic-healthrecords-managementelectionssoil-and-water
✓ Decided: Government Operations Committee approves personnel appointments and solar land resolutions

The committee approved several resolutions regarding agricultural land use, IT contracts, and personnel schedules. They also authorized the appointment of the Director of Public Health and the adoption of an electronic records retention schedule.

Mon Feb 6, 2023

Human Services Committee

Committee to consider mental health overhaul support and board appointments

The Yates County Human Services Committee is meeting to hear department reports and consider several resolutions, including supporting Governor Hochul's mental health care plan, reappointing Craig Sandberg, MD, to the Community Services Board and Mental Health Subcommittee, and appointing new members to subcommittees. The agenda also includes a presentation on SBIRT, a public defender grant status report, and a resolution to proclaim March 29, 2023, as Vietnam War Veterans Day.

mental-healthappointmentspublic-defenderveteranssocial-servicesgrants
✓ Decided: Human Services Committee approves board appointments and veterans day proclamation

The Committee approved several appointments to the Community Services Board and its subcommittees. It also approved a resolution to proclaim March 29, 2023, as Vietnam War Veterans Day in Yates County. Additional approvals included a request for Medicaid funding and a contract for an occupational therapist.

Wed Jan 25, 2023

Yates County Legislature

County Legislature to review revised budget for new Highway/OES/Public Health facility

The Yates County Legislature will hold a special session to review the updated/proposed budget for the new Highway/OES/Public Health facility and Fuel Island, as well as proposed values for Contingency & Allowance Authorizations procedures. The agenda includes specific budget revisions made on January 24, 2023, such as removing funds for the NYSDOT Storm Line and Salt barn sitework, and adding funds for metal siding and framing/fabric for the Salt Barn. This is a working session to discuss budget details, not a final vote.

budgetfacilitieshighwaypublic-healthcapital-project
✓ Decided: Yates County approves opioid settlement agreement with Teva

The Legislature unanimously approved a settlement agreement with Teva Pharmaceutical Industries Ltd. to resolve claims regarding the opioid epidemic. The county will receive a total collective sum of approximately $138,636.40 over several years. The board also reviewed a proposed budget for a new Highway/OES/Public Health facility.

Wed Jan 25, 2023

Airport Council

Yates County Airport Council approves conference fee, reviews taxiway extension and grants

The Yates County Airport Council met on January 25, 2023, to accept minutes and financial reports, and to discuss ongoing projects. They approved paying for Rich Leppert to attend the Hershey Conference, reviewed the taxiway extension project for runways 10/28, and received updates on grants, including a fuel truck purchase and a deicing pad. The council also discussed safety concerns raised by the Flying Club and agreed to form a committee to address them.

airportgrantsconstructionsafetyfuel-trucktaxiway
Mon Jan 9, 2023

Yates County Legislature

County Legislature to vote on contracts, software, and employee handbook changes

The Yates County Legislature will consider 25 resolutions, including contracts for software, equipment, and services, as well as amendments to the employee handbook and procurement policy. The meeting also includes a presentation on the Cupola Restoration Project and public comment.

contractssoftwarepublic-safetyemployee-handbookprocurement
✓ Decided: Yates County Legislature declares 2023 as the County Bicentennial Year

The legislature officially designated 2023 as the Yates County Bicentennial Year to commemorate the county's 200th anniversary. Several contracts for emergency services, IT, and airport design were approved, and the employee handbook was amended. A resolution regarding Assistant District Attorney compensation was postponed.

Wed Jan 4, 2023

Public Works Committee

Highway dept. reviews 2022 goals, sets 2023 plans including 12.02 miles of paving

The Yates County Public Works Committee is meeting to review highway and buildings & grounds reports, including the highway department's 2022 goal status and proposed 2023 goals. The committee will also hear public comment, approve December minutes, and may enter executive session. The agenda includes updates on the new highway facility project, bridge projects, and a weights & measures report.

highwaycapital-projectsbridgesfacility-constructiongoalsweights-and-measures
✓ Decided: Public Works Committee approves December meeting minutes

The committee approved the minutes from the December meeting. Members received status updates on highway projects, vehicle deliveries, and building and grounds goals. No other substantive actions were taken.

Wed Jan 4, 2023

Government Operations

County committee reviews elections, soil & water, and multiple resolutions

The Yates County Government Operations Committee is meeting to hear reports from various departments, including Elections, Soil & Water, Cornell Cooperative Extension, IT, County Clerk, Personnel, and the County Administrator. They will also consider several resolutions, including exceptions to the procurement policy, renewal of offsite data backup services, amendments to the employee handbook, and designation of newspapers. The agenda includes routine updates and administrative items, with no major public hearings or zoning changes.

electionssoil-and-waterprocurementemployee-handbookcounty-operations
✓ Decided: Government Operations Committee approves IT and personnel resolutions

The Committee approved resolutions regarding IT procurement, data backup services, and amendments to the employee handbook. It also authorized the designation of newspapers and a memorandum of understanding with Cornell Cooperative Extension.

Wed Jan 4, 2023

Finance Committee

Yates County Finance Committee to review broadband construction, tax bills, and investment policy

The Yates County Finance Committee is meeting to discuss and review departmental reports, including updates on the ReConnect 1 broadband project, real property tax services, and finance operations. They will also consider amending Resolution 302-22 (Investment Policy) and making an appointment to the Finger Lakes Economic Development Center Board. The agenda includes routine items like approving minutes and public comment, but also substantive updates on broadband construction and tax enforcement.

broadbandtaxfinanceinvestmentappointmentsreal-property
✓ Decided: Finance Committee approves investment policy amendment and board appointments

The Committee approved an amendment to the investment policy (Resolution 302-22) and appointments to three economic development boards. Members also reviewed 2022 goals and received updates on broadband projects, tax billing, and airport operations.

Tue Jan 3, 2023

Public Safety Committee

Yates County Public Safety Committee to vote on ADA pay, EMS contracts

The Yates County Public Safety Committee will consider resolutions to compensate Assistant District Attorneys for Centralized Arraignment Part coverage, approve contracts for EMS equipment and software, and authorize a probation software hosting agreement. The committee will also receive updates from the District Attorney, Probation, Emergency Services, Sheriff, and County Administrator, including monthly statistics and 2023 goals.

public-safetybudgetcontractsemergency-servicesprobationdistrict-attorneysheriff
✓ Decided: Public Safety Committee approves multiple emergency services and law enforcement contracts

The Committee approved several resolutions for the District Attorney, Probation, Emergency Services, and the Sheriff's Office. These actions include authorizing equipment contracts, software agreements, and personnel filling. The committee also received updates on the county's communications project and jail statistics.

Tue Jan 3, 2023

Human Services Committee

Committee to consider volunteer agreements for INSYGHT youth program

The Yates County Human Services Committee is meeting to hear reports from departments including Public Defender, Community Services, Office for the Aging, Social Services, Public Health, and Veterans. They will consider a resolution authorizing volunteer service agreements for the INSYGHT Family and Youth Program, and receive updates on grants, programs, and 2022 goals.

human-servicespublic-defendercommunity-servicessocial-servicespublic-healthveteransgrants
✓ Decided: Committee approves volunteer agreements for INSYGHT program

The Human Services Committee approved a resolution authorizing the Legislature to enter into Volunteer Services Agreements for the INSYGHT: Family and Youth Program. Members also approved the December meeting minutes. Department heads provided updates on budget adjustments, HEAP benefits, and veteran services.