The Boring PartsFederalLocal · USLocal · Canada
Waukesha, WI

Waukesha public meetings in 2025

220 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 22, 2025 · 6:00 PM

Plan Commission

Plan Commission reviews zoning code updates and site plan for 1351 E Main Street

The Waukesha Plan Commission will review the final site plan for 1351 E Main Street and discuss recommendations for the Zoning Code Update, including general provisions, decision-making procedures, and definitions.

zoningsite-plancode-updatepublic-hearingwaukeshacity-hall
✓ Decided: Plan Commission approves final site plan for 1351 E Main Street

The Waukesha Plan Commission held a special meeting on December 22, 2025, and approved the final site plan and architectural review for 1351 E Main Street (PC25-0198) as part of the consent agenda. The commission also discussed a zoning code update covering general provisions, review procedures, definitions, and non-conformities, but took no vote on that item. The meeting was otherwise procedural, with no other substantive decisions.

Council Chambers, City Hall
Thu Dec 18, 2025 · 5:30 PM

Board of Public Works

Board to review one-time sewer credit requests

The Board of Public Works will meet to discuss and potentially authorize one-time sewer credits for eight residents. The board will also review payments and approve minutes from the December 4, 2025 meeting.

sewerutilitiespublic-workscredits
✓ Decided: Board approves one-time sewer credits for eight homeowners

The Board of Public Works approved the minutes of the December 4, 2025 meeting and the payments list. It also approved one-time sewer credit requests from eight named property owners. No public comments were made, and the meeting adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02684 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02685 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02686 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Dec 18, 2025 · 6:00 PM

Waukesha Water Commission

Commission to discuss 2026 water fees and charges

The Waukesha Water Commission will consider approving November 2025 payments from the General and Improvement Funds, purchasing network hardware for the new Operations Center, and establishing 2026 blanket purchase orders. A discussion item covers proposed 2026 fees and charges, which directly affect resident water bills. The commission will also receive a utility performance report and November financials.

waterutilityfeesbudgetoperationsinfrastructurepurchases
✓ Decided: Water Commission approves November payments, network hardware, and 2026 purchase orders

The Waukesha Water Commission approved the November 2025 voucher list for payments from the General and Improvement Funds, the purchase of network hardware for the new Operations Center, and the 2026 blanket purchase orders. All three action items passed with 5-0 votes (two members absent). The commission also discussed the 2026 fees and charges, and received the utility performance and financial reports, but took no action on these items.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] ID#25-02698 Approval of Minutes Meeting Minutes 11-20-25Attachments: approved
4 yea · 2 absent
Joan Francoeur yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea · Jeff Fowle absent · Gerald Couri absent
[context] ID#25-02699 Approve Payments from the General Fund and the Improvement Fund November Voucher ListAttachments: approved
5 yea
Joan Francoeur yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
to Approve Network Components for the New Operations Center INV1959 For Commission memo Attachments: approved Page 1City of Waukesha December 18, 2025Waukesha Water Commission Meeting Minutes - Final
5 yea
Joan Francoeur yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
to Approve Network Components for the New Operations Center INV1959 For Commission memo Attachments: approved Page 1City of Waukesha December 18, 2025Waukesha Water Commission Meeting Minutes - Final…
5 yea
Joan Francoeur yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
ID#25-02698 — approved
4 yea · 2 absent · 1 abstain
Joan Francoeur yea · Jeff Fowle absent · Gerald Couri absent · Joe Piatt abstain · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
ID#25-02699 — approved
5 yea · 2 absent
Joan Francoeur yea · Jeff Fowle absent · Gerald Couri absent · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
ID#25-02700 — approved
5 yea · 2 absent
Joan Francoeur yea · Jeff Fowle absent · Gerald Couri absent · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
ID#25-02701 — approved
5 yea · 2 absent
Joan Francoeur yea · Jeff Fowle absent · Gerald Couri absent · Joe Piatt yea · Dale Matthews yea · Shawn Reilly yea · Peter Bartels yea
Wed Dec 17, 2025 · 6:00 PM

Plan Commission

✓ Decided: Plan Commission approves 76-unit mixed-use building on Silvernail Road

The Waukesha Plan Commission approved a conditional use permit for a 5-story building with commercial space and 76 residential units at 2417 Silvernail Road, subject to a parking agreement with a neighbor. It also approved a conditional use permit for a food pantry warehouse at 1705 S. Prairie Ave, with hours of operation limited to 12-2:30 on weekdays during the school year. Several other items were approved, including a rezoning for a duplex development and a final plat for a subdivision.

Council Chambers, City Hall
🗳️ How they voted (17 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Shawn Reilly, seconded by Ald. Jack Wells, that the Minutes be approved as amended. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Ald. Jack Wells, seconded by Member R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Mayor Shawn Reilly, seconded by Member R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
8 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Jack Wells, that this item be approved with conditions. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Jack Wells, that this item be recommended for approval. The motion carried by the following vote:
8 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be recommended for approval. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Jack Wells, that this item be recommended for approval. The motion carried by the following vote: Page 4City of Waukesha December 17…
4 yea
Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
ID#25-02438 — approved as amended
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0176 — recommended for approval
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0179 — recommended for approval
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0180 — recommended for approval
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0184 — recommended for approval
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0189 — approved with conditions
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0195 — approved with conditions
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0188 — approved with conditions
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0183 — recommended for approval
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
PC25-0175 — approved with conditions
4 yea · 3 absent
Joan Francoeur absent · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner absent · Heather Granger absent
Tue Dec 16, 2025 · 6:00 PM

City Council

City Council to consider side letter with firefighters union

The Waukesha City Council will meet to approve consent agenda items including IT agreements, transit service amendments, and parking changes. The meeting includes a closed session to discuss a side letter of agreement with the International Association of Firefighters, Local 407, AFL-CIO.

city-councilfirefighterstransitcontractspublic-safetyroadsparking
✓ Decided: Council approves 2026 CIP projects and firefighter side letter agreement

The Waukesha City Council approved the 2026 Capital Improvement Projects (CIP) for the Department of Public Works, the side letter agreement with the International Association of Firefighters Local 407, and several consent agenda items including contracts and ordinance changes. A motion to reduce the speed limit on Silvernail Road from 45 to 35 mph failed, but a separate motion to install a hidden driveway sign on westbound Silvernail was approved.

Council Chambers, City Hall
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Steve Van Trieste, seconded by Ald. Dale Matthews, to approve the reduction of the current speed of 45MPH, about 100 feet west of Sussex Lane, speed limit to 35MPH from…
7 nay · 3 yea
Joe Pieper yea · Steve Van Trieste yea · Dale Matthews yea · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Alicia Halvensleben nay · Dean D. Lemke nay · Rick R. Lemke nay · Rico Camacho nay
A motion was made by Ald. Chrisien, seconded by Ald. Camacho, to approve waiving the third reading. The motion carried by the following vote: Mike Chrisien, Eric Payne, Joe Pieper, Steve Van Trieste…
10 yea · 3 nay
Mike Chrisien yea · Eric Payne yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Paul Wuteska yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Alicia Halvensleben yea · Elizabeth Moltzan nay · Jack Wells nay · Mike Anderson nay
ID#25-02678 — approved
23 yea · 5 absent · 2 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson absent · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson absent · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02586 — Motion failed
8 nay · 4 yea · 3 absent
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson absent · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson absent · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke nay · Rico Camacho nay
The other 13 items passed by unanimous or near-unanimous consent.
Mon Dec 15, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to consider 2026 Janboree fireworks contract with Spielbauer Fireworks

The Parks, Recreation and Forestry Board will discuss and possibly recommend to the Common Council a contract with Spielbauer Fireworks Company, Inc. for the 2026 Janboree Fireworks event. The meeting also includes public comment, approval of prior minutes, and staff reports. A majority of Common Council members may be in attendance.

parksrecreationfireworkscontractspublic-safety
✓ Decided: Board recommends 2026 Janboree fireworks contract with Spielbauer

The Parks, Recreation and Forestry Board approved a motion to recommend the 2026 Janboree Fireworks Event Contract with Spielbauer Fireworks Company, Inc. to the Common Council. The vote was 6-0, with two members absent. The board also approved the minutes from the November 17, 2025 meeting.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Steve Johnson, seconded by Ald. Rico Camacho, that this Minutes be approved. The motion carried by the following vote:
6 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Erica Yoss yea
A motion was made by Eric Huemmer, seconded by Ald. Jack Wells, that this item be approved. The motion carried by the following vote:
6 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Erica Yoss yea
ID#25-02590 — approved
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner absent · Erica Yoss yea
ID#25-02711 — approved
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner absent · Erica Yoss yea
Thu Dec 11, 2025 · 4:45 PM

Library Board

Library Board to review 2026 goals and consulting agreement

The Waukesha Library Board will review the 2026 Library Director goals and a consulting agreement for cafe services. The board will also discuss holiday schedule changes and receive reports on library activities and legislative updates.

librarygoalsconsultingholidayspublic-commentclosed-session
✓ Decided: Library Board approves 3.5% salary increase for Library Director

The Waukesha Library Board approved the December bills ($66,736.61), the financial report, a cafe consulting services agreement, and holiday changes. The board also approved a 3.5% salary increase for the Library Director following a closed session. All votes were unanimous or 8-0 with three absent.

Library Board Room
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-02632 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach absent · Alicia Halvensleben yea
ID#25-02640 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach absent · Alicia Halvensleben yea
ID#25-02664 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach absent · Alicia Halvensleben yea
ID#25-02668 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach absent · Alicia Halvensleben yea
Tue Dec 9, 2025 · 2:00 PM

Deferred Compensation Board

Board to consider adding ROTH investment option to city plan

The Deferred Compensation Board will review a proposal to add a ROTH investment option to the City of Waukesha's Mass Mutual deferred compensation plan. The board may take action to approve or reject this addition.

financeretirementinvestmentwaukesha
Council Chambers
Mon Dec 8, 2025 · 5:30 PM

Cemetery Commission

Cemetery Commission to review 2026 pricing changes

The Waukesha Cemetery Commission will review proposed pricing changes for 2026 and approve minutes from a previous meeting. The body will also receive reports from the Cemetery Director and the Friends of Prairie Home Cemetery President.

cemeterypricingpublic-commentminutesreport
City Hall Training Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Adjournment — adjourned
6 yea · 1 absent
Amanda Roddy absent · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-02681 — approved
5 yea · 2 absent
Amanda Roddy absent · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho absent · Pat Grulke yea
ID#25-02680 — recommended for Council Consent
6 yea · 1 absent
Amanda Roddy absent · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
Mon Dec 8, 2025 · 6:00 PM

Ordinance & License Committee

Committee to discuss revisions to Amusement Arcade ordinance

The Ordinance & License Committee will meet to review license applications and discuss changes to the city's amusement arcade laws. The body will also consider the approval of previous meeting minutes.

ordinanceslicensingamusement-arcadesalcohol-licenses
✓ Decided: Committee approved revisions to the Amusement Arcade ordinance for City Council review

The Ordinance & License Committee approved the minutes from the November 24 meeting by unanimous consent. It approved bartender applications for James C. Galinsky and William F. Horstmeyer, and approved a private alarm application for Centec Security Systems along with a Class B beer and liquor combo for Kumi of Wisconsin, each by a 5‑0 vote. The committee also approved proposed revisions to Municipal Code 8.04 (Amusement Arcade Ordinance) to send to the City Council for a second reading, again by a 5‑0 vote. The bartender application for Terri L. Romano was deferred to the next meeting.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02675 — recommended for Council Consent
10 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02676 — recommended for Council Consent
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02678 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Fri Dec 5, 2025 · 10:30 AM

Board of Public Works

Board to tour Metro Badger Drive Facility

The Board of Public Works will hold a special gathering to tour the Metro Badger Drive Facility. No official action is scheduled for this meeting.

public-workstourfacilitymeeting
Metro Badger Drive Facility, 2311 Badger Drive, Waukesha, WI 53188
Thu Dec 4, 2025 · 5:30 PM

Board of Public Works

Board will authorize bids for 2026 public works capital improvement projects.

The Board of Public Works will approve the minutes from the November 20, 2025 meeting and approve pending payments. It will adopt a resolution to prepare plans, specifications, and advertise bids for the 2026 Capital Improvement Program projects. The board will also review and consider two contract change orders: one with Short Pour Delivery Services, LLC for the Drop‑Off Center Used Oil Collection Improvements, and another with Garland/DBS, Inc. for the Schuetze Building Roof Rehabilitation.

public-workscapital-improvementcontractsminutesbudget
✓ Decided: Board of Public Works unanimously recommends 2026 CIP projects and two contract changes

The Board approved the minutes from the November 20, 2025 meeting and approved pending payments. It recommended the City Council approve the 2026 Capital Improvement Program for Public Works and endorsed two contract change orders—one with Short Pour Delivery Services, LLC for the oil collection project and another with Garland/DBS, Inc. for the Schuetze Building roof rehabilitation. All motions passed with a 5‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ID#25-02597 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02598 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02603 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02599 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02600 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Dec 4, 2025 · 5:30 PM

Transit Commission Meeting

Transit Commission to review shop uniform bid and funding updates

The Waukesha Transit Commission will meet to approve minutes, review a bid for shop uniforms and towels, and discuss an amendment to a service agreement with Waukesha County. The body will also receive reports on service levels and ridership.

transitbudgetpublic-workswaukesha-countyservice-levelsridership
✓ Decided: Transit Commission recommended Amendment 1 to County Transit Agreement for council consent

The commission approved the minutes from the October 9, 2025 meeting. It recommended the Vestis shop uniform and towel bid for council consent. It also recommended Amendment 1 to the Intergovernmental Cooperation Agreement with Waukesha County Transit Administration Services for council consent. The meeting was adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02591 — approved
5 yea
Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02592 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02593 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Tue Dec 2, 2025 · 6:00 PM

City Council

City Council to consider 2026 sanitary sewer rate changes

The Waukesha City Council will review and possibly approve the proposed 2026 sanitary sewer rates and related public works items. New business includes a county overdose fatality review cooperative agreement. The council will also consider bids for water treatment chemicals and a change order for the Clean Water Plant Phase 3 project.

sanitary-sewerpublic-workswater-treatmentbidsoverdose-reviewcity-council
✓ Decided: Council approved $1 M transfer to special fund via RDA policy

At the December 2 meeting, the council approved several items. It adopted the Redevelopment Authority Real Estate Purchasing Policy, authorizing a $1 million transfer ($500,000 from ARPA earnings and $500,000 from stabilization earnings) to a special revenue fund (12‑3 vote). The council also approved the Overdose Fatality Review Cooperative Agreement, poll worker and special voting deputy appointments, updates to the Landmarks Commission Ordinance, and low‑bid contracts for water‑treatment chemicals and polymer. Additional approvals included an invited bartender license and board and committee appointments.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-02386 — approved
12 yea · 3 nay
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 10 items passed by unanimous or near-unanimous consent.
Tue Dec 2, 2025 · 5:00 PM

Public Art Committee

Committee to review 2026 Gallery Art Exhibit applications

The Public Art Committee will review applications for the 2026 Gallery Art Exhibit at City Hall. They will also receive an update on the Friedman Alley project and consider approving the September 9, 2025 meeting minutes. Public comments are limited to two minutes and will be taken under advisement.

public-artgalleryapplicationswaukeshacity-hallfriedman-alley
Training Room, First Floor City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Adjournment — adjourned
4 yea · 1 absent
Rose Lange absent · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
ID#25-02601 — approved
4 yea · 1 absent
Rose Lange absent · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
ID#25-02602 — approved
4 yea · 1 absent
Rose Lange absent · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
Tue Dec 2, 2025 · 7:30 AM

City Council

Council attends Celebrate Waukesha Breakfast, no business

This agenda is for a ceremonial Celebrate Waukesha Breakfast event. No formal business, votes, or discussions are scheduled. The notice indicates a possible quorum of council members may be present at the breakfast.

city-councilceremonialbreakfastwaukesha
Tuscan Hall 409 Delafield St. Waukesha, WI 53188
Mon Dec 1, 2025 · 5:30 PM

Building and Grounds

Installation of speed limit and pedestrian signs on Perkins Ave

The Building and Grounds Committee will review and possibly act on several traffic‑related items. These include installing speed limit and pedestrian crossing signs at Perkins Avenue and National Avenue, removing a "No Turn on Red" sign at E. Broadway and Hartwell Avenue, and adding a "Cross Traffic Does Not Stop" sign at Racine Avenue and E. Broadway. The committee will also consider a speed study on Silvernail Road, a 2‑hour parking restriction on Maple Avenue, and speed limit and Children at Play signs on Darlene Drive.

traffic-signsspeed-limitparkingroad-safetysignagetransportation
✓ Decided: Council approved several new traffic signs and a 2‑hour parking rule

The board approved the October 6, 2025 meeting minutes. It removed the "No Turn on Red" sign at E. Broadway and Hartwell and adopted new signs—including a "Cross Traffic Does Not Stop" sign at Racine and E. Broadway, a "caution hidden driveway" sign, and a 2‑hour parking limit on Maple Avenue. The board took no action on proposed signs for Perkins Avenue and Darlene Drive. All motions passed with recorded vote counts.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Ald. Mike Anderson, to install a sign that says, "caution hidden driveway". The motion carried by the following vote:
3 yea · 1 nay
Eric Payne yea · Dale Matthews yea · Mike Anderson yea · Rick R. Lemke nay
ID#25-02586 — recommended for approval
3 yea · 1 absent · 1 nay
Eric Payne yea · Dean D. Lemke absent · Rick Lemke nay · Dale Matthews yea · Mike Anderson yea
The other 8 items passed by unanimous or near-unanimous consent.
Mon Nov 24, 2025 · 6:00 PM

Ordinance & License Committee

Committee to review bartender and other license applications

The Ordinance & License Committee will hold a routine meeting to discuss and recommend action on invited bartender applications and other license applications. The agenda also includes approval of prior meeting minutes, public comment, and communications. No specific details on applicants or decisions are provided in the agenda.

licensesbartenderscommitteecity-of-waukeshameeting
✓ Decided: Committee approved Class B beer & liquor combo licenses for two businesses

The Ordinance & License Committee approved Class B Beer & Liquor Combo Licenses for Fluffy's Tall Boy's and PKK2 LLC by a 5‑aye vote. It also approved Invited Bartender applications for Gary Hurd (5‑aye) and William Pierce (4‑aye, 1 abstain). Applications for James Galinsky and a Change of Agent for Woodman's were held for later consideration.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Wuteska, to approve the Invited Bartender Application for William Pierce. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-02575 — approved
9 yea · 1 abstain
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke abstain
ID#25-02581 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Thu Nov 20, 2025 · 5:30 PM

Board of Public Works

BPW to discuss 2026 sanitary sewer rates and Clean Water Plant change order

The Waukesha Board of Public Works will review proposed 2026 sanitary sewer rates and a change order for the Clean Water Plant Phase 3 project. The body will also receive bids for phosphorus removal chemicals and polymer.

sanitary-sewerwater-treatmentbudgetbidspublic-workswaukesha
✓ Decided: Board of Public Works recommends 2026 sewer rates and awards water bids

The Board approved the minutes from the November 6, 2025 meeting and approved pending payments. It recommended the proposed 2026 sanitary sewer rates to the City Council. It also recommended awarding the low bid for ferric‑phosphorus chemicals to Kemira Water Solutions and the polymer bid to SNF Polydyne, and recommended Change Order No. 1 for the Clean Water Plant Phase 3. All motions carried unanimously.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-02531 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02532 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02536 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02533 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02535 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02534 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Nov 20, 2025 · 6:00 PM

Waukesha Water Commission

Water Commission to vote on 2026 operating and capital plans

The Waukesha Water Commission will consider approving the 2026 Operating Plan and Capital Improvement Plan, along with October payments and a change order for the 2024 Resurfacing Project. The meeting will also include a closed session to discuss legal strategy in the ongoing S.J. Louis Construction lawsuit, followed by possible open-session action. Commissioners will also review a utility performance report and October financials.

waterbudgetcapital-improvement-planinfrastructurelegaloperationsresurfacing
✓ Decided: Commission approved 2026 operating and capital improvement plan

The Waukesha Water Commission approved several actions, including moving to a closed session to discuss the S.J. Louis Construction lawsuit and then reconvening in open session. The commission also approved the meeting minutes, authorized payments from the General and Improvement Funds, approved a change order for the 2024 resurfacing project, and adopted the 2026 operating and capital improvement plan. All motions passed with unanimous votes of the members present.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
[context] Meeting Reconvened approved
4 yea
Joan Francoeur yea · Gerald Couri yea · Dale Matthews yea · Shawn Reilly yea
[context] ID#25-02549 Approval of Minutes Meeting Minutes 10-21-25Attachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Gerald Couri yea · Dale Matthews yea · Shawn Reilly yea
[context] ID#25-02550 Approve Payments from the General Fund and the Improvement Fund October Voucher ListAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Gerald Couri yea · Dale Matthews yea · Shawn Reilly yea
[context] ID#25-02551 Approve Change order for 2024 Resurfacing Project CO Memo 2024 ResurfacingAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Gerald Couri yea · Dale Matthews yea · Shawn Reilly yea
[context] ID#25-02552 Approve the 2026 Operating Plan and Capital Improvement Plan 2026 Budget PacketAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Gerald Couri yea · Dale Matthews yea · Shawn Reilly yea
ID#25-02549 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt absent · Dale Matthews yea · Shawn Reilly yea
ID#25-02550 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt absent · Dale Matthews yea · Shawn Reilly yea
ID#25-02551 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt absent · Dale Matthews yea · Shawn Reilly yea
ID#25-02552 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt absent · Dale Matthews yea · Shawn Reilly yea
ID#25-02547 — approved
7 present
Paul Ybarra present · Joan Francoeur present · Jeff Fowle present · Gerald Couri present · Joe Piatt present · Dale Matthews present · Shawn Reilly present
ID#25-02548 — approved
4 yea · 2 absent
Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt absent · Dale Matthews yea · Shawn Reilly yea
Wed Nov 19, 2025 · 6:00 PM

Plan Commission

Plan Commission to review draft zoning code standards

The Waukesha Plan Commission will consider several minor site plan and architectural review requests, including a Dunkin' drive-thru queue lane at 2110 E. Moreland Blvd and a playground fence at Momentum Early Learning. The main item is a review of draft Design, Development, Access, Landscape, and Sign Standards as part of the Zoning Code Update. The consent agenda includes approvals for balcony removal, siding replacement, and porch repairs.

zoningplan-commissionsite-plan-reviewarchitectural-reviewsign-standardsdevelopment-standardswaukesha
✓ Decided: Plan Commission approves Dunkin' drive‑thru parking lot changes with conditions

The commission approved three minor site plan requests: a fence for Momentum Early Learning at 3011 Saylesville Road, a drive‑thru lane for a Dunkin' location at 2110 E. Moreland Blvd, and a façade renovation at 375 W. Main Street. All three items were approved with conditions by a unanimous 6‑0 vote. The meeting also approved the minutes from October 22, 2025 and October 29, 2026 by unanimous consent.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Elizabeth Moltzan, seconded by Member R.G. Keller, that the Minutes be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Member R.G. Keller, that this item be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Ald. Jack Wells, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Member Joan Francoeur, seconded by Ald. Jack Wells, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Ald. Jack Wells, seconded by Member Jennifer Wallner, that this item be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-02238 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly absent · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0169 — approved with conditions
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly absent · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0173 — approved with conditions
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly absent · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0148 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly absent · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-02530 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly absent · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
Tue Nov 18, 2025 · 6:00 PM

City Council

Council to vote on rezoning 25.9 acres for senior housing and mixed-use development

The Waukesha City Council will consider a rezoning petition for about 25.94 acres west of Meadowbrook Road and north of Coldwater Creek Drive, changing the land from T‑1 to a mix of commercial, institutional and residential districts. The meeting also includes a resolution to amend a $7,080,000 industrial development revenue bond for Production Service Company, Inc., and a possible four‑year collective bargaining agreement with the Waukesha Professional Police Association. Additional items on the consent agenda cover IT contracts, traffic engineering services, and snow‑and‑ice removal contracts.

zoningbondslaborpublic-workscontractssenior-housing
✓ Decided: Council approved rezoning of 25.94 acres for Tukka senior housing project

The council voted to rezone approximately 25.94 acres of the Tukka Properties site west of Meadowbrook Road, changing it from T‑1 to a mix of B‑5, I‑1 and Rd‑2 districts. The motion passed 12‑1 with one member absent. The council also approved several contracts and agreements, including a police collective bargaining agreement and a land records management system amendment.

Council Chambers, City Hall
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. R. Lemke, seconded by Ald. Moltzan, that this Rezoning Pettition to approve the Rezoning Petition for Tukka Properties, West of Meadowbrook Road and north of Coldwater Creek…
12 yea · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Steve Van Trieste nay
A motion was made by Ald. Pieper, seconded by Ald. Payne, to approve the amended ordinance, keeping Districts 4 and 13 at the Northview Building, with the remaining locations as presented. The motion…
10 yea · 1 nay
Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rico Camacho yea · Rick R. Lemke nay
A motion was made by Ald. Manion, seconded by Ald. Wuteska, to approve Board and committee appointments. The motion carried by the following vote:
12 yea · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rico Camacho yea · Rick R. Lemke nay
ID#25-02539 — approved
12 yea · 1 absent · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea
PC25-0159 — approved
12 yea · 1 nay · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02501 — approved
26 yea · 2 absent · 2 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea
The other 11 items passed by unanimous or near-unanimous consent.
Mon Nov 17, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to vote on GuitarTown festival contract and 2026 recreation fees

The Parks, Recreation and Forestry Board will review and vote on a contract for the GuitarTown Music Festival and a proposed 2026 recreation fee schedule. The board will also consider a sponsorship agreement with DICK'S Sporting Goods and a contract for Independence Day entertainment at Lowell Park.

parksrecreationfestivalfeessponsorshipcontractmusiclowell-park
✓ Decided: Board approves contracts, fees and sponsorships for 2026

The Parks, Recreation and Forestry Board approved the meeting minutes and unanimously approved four discussion items. These items include a recommendation to the Common Council for a contract with Sound Check Entertainment for the GuitarTown Music Festival, the 2026 winter/spring recreation program fee schedule, a sponsorship agreement with DICK’S Sporting Goods, and a contract with Hudsonite Productions for a Lowell Park Independence Day event.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Eric Huemmer, seconded by Sarah Roth, that this item be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Johnson, seconded by Roth, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Ald. Wells, seconded by Ald. Camacho, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Wallner, seconded by Huemmer, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Wallner, seconded by Roth, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02555 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02559 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02558 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02557 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02556 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
Mon Nov 17, 2025 · 6:00 PM

Redevelopment Authority

RDA to consider grant for Revitalize Milwaukee home rehab and fund changes

The Redevelopment Authority will review and vote on a grant request from Revitalize Milwaukee for the Affordable Housing Rehab Program to assist home rehabilitation for the 2026 Block Build event. They will also consider proposed changes to the RDA Affordable Housing Development Fund program. An update on the RDA Loan Program will be presented, and minutes from the previous meeting will be approved.

redevelopmentaffordable-housinggrantsloan-programhousing-rehab
Training Room, First Floor City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02527 — approved
4 yea · 3 absent
Mike Duffek yea · Meena Granado absent · Paul Zinck absent · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle absent
ID#25-02528 — approved
5 yea · 2 absent
Mike Duffek yea · Meena Granado absent · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle absent
ID#25-02529 — approved
5 yea · 2 absent
Mike Duffek yea · Meena Granado absent · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle absent
Thu Nov 13, 2025 · 4:45 PM

Library Board

Board will review and possibly act on the 2026 City Budget.

The Library Board will consider several agreements and reports, including a possible action on the 2026 City Budget. Items include agreements for a café office space and resource library services, an addendum to the Bridges Library System, and the Director’s 2026 goals. A closed session will address the Library Director’s performance evaluation before reconvening in open session.

librarybudgetagreementsrenovationsstaffingreports
✓ Decided: Board approves $88,944.68 November bills and several 2026 library agreements

The Library Board approved the November bills totaling $88,944.68 and adopted the financial report. It also approved agreements for a children's renovation project, a café office space, resource library services, and the 2026 addendum to the Bridges Library System. The board convened a closed session and then reconvened in open session. All motions passed with the recorded vote counts.

Library Board Room
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Bills — approved
9 yea · 2 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
Financial Reports — approved
9 yea · 2 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
ID#25-02487 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
ID#25-02488 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
ID#25-02489 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
Thu Nov 13, 2025 · 4:15 PM

Library Human Resources Committee

Library HR Committee to discuss director's evaluation in closed session

The Library Human Resources Committee will consider approving minutes from October and then may convene in closed session under Wisconsin statute to discuss the Library Director's annual performance evaluation and 2025 Smart Goals. Public comment is limited to three minutes per speaker.

libraryhuman-resourcespersonnelclosed-sessionperformance-evaluationwaukesha
Library Board Room
Tue Nov 11, 2025 · 6:00 PM

Finance Committee

Committee will consider amending $7.08 million industrial development bonds

The Finance Committee will review and possibly act on three items: the Emergency Medical Services Director contract; a property‑damage claim filed by Rosbel Salinas; and a resolution to amend $7,080,000 of industrial development revenue bonds for Production Service Company, Inc. Each item is identified by its agenda ID. No decisions have been made prior to the meeting.

financebondscontractsclaimspublic-safety
✓ Decided: Finance Committee approves EMS contract, property claim, and bond amendment

The Finance Committee approved the minutes from the October 28, 2025 meeting. It also approved the Emergency Medical Services Director contract, a property‑damage claim by Rosbel Salinas, and a resolution to amend $7,080,000 of industrial development revenue bonds for Production Service Company, Inc. All approvals were unanimous, with four members voting aye and one member absent.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Lemke and seconded by Moltzan that this item be approved. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
A motion was made by Moltzan and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
A motion was made by Lemke and seconded by Wigderson that this item be approved. The motion carried by the following vote:
4 yea
Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02465 — approved
4 yea · 1 absent
Joe Pieper absent · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02437 — approved
4 yea · 1 absent
Joe Pieper absent · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02498 — approved
4 yea · 1 absent
Joe Pieper absent · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Mon Nov 10, 2025 · 4:00 PM

Board of Zoning Appeals

Board to consider duplex variance for 236 S West Avenue

The Board of Zoning Appeals will meet to review a request for a dimensional variance. The board will decide if a property owner can deviate from zoning code setback requirements to build a duplex.

zoninghousingvarianceresidential-development
Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-02365 — denied
2 nay · 2 yea · 1 absent
Christine D'Angelo nay · Kevin Reilly yea · Bryan Erickson absent · Timothy Retic nay · Eric Dunst yea
The other 2 items passed by unanimous or near-unanimous consent.
Mon Nov 10, 2025 · 6:00 PM

Ordinance & License Committee

Committee to vote on polling place locations for 2026

The Ordinance & License Committee will consider amendments to the Waukesha Municipal Code regarding polling place locations for 2026. The body will also review minutes from the previous meeting and other license applications.

municipal-codepolling-placeswaukeshacommittee-meetingmunicipal-code-amendments
✓ Decided: Committee approved amendments to polling place locations in the municipal code

The committee approved the October 27, 2025 Ordinance & License minutes by unanimous consent. It approved the Change of Agent application for Kwik Trip #968 with a 5‑0 vote. It also approved proposed amendments to Section 1.03 of the Waukesha Municipal Code regarding polling place locations with a 5‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-02497 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02501 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Thu Nov 6, 2025 · 5:30 PM

Board of Public Works

Board to vote on traffic engineering and snow removal contracts

The Board of Public Works will review and possibly take action on contracts for traffic engineering and project management services for 2025-2027, as well as snow and ice removal for select routes in the 2025-2026 season. The board will also approve minutes from October 23, 2025, and approve payments. Additionally, official notices for bids on chemicals for the Clean Water Plant are noted.

public-workscontractstraffic-engineeringsnow-removalpaymentsbids
✓ Decided: Board recommends traffic engineering and snow removal contracts to council

The Board approved the minutes from the October 23, 2025 meeting and approved pending payments. It then recommended the traffic engineering and project management services contract for 2025‑2027 and the snow and ice removal contract for the 2025‑2026 season to the City Council for consent. All motions carried unanimously with a 5‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-02443 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02445 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02446 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02457 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Wed Nov 5, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to allocate remaining paint and repair grant funds

The Landmarks Commission will discuss and take action on the allocation of remaining Paint and Repair Grant funds. The commission will also review updates and a specific grant for 122 S. East Avenue.

grantshistoric-preservationcity-maintenance
Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02205 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz absent · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-02449 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz absent · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-02451 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz absent · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
Wed Nov 5, 2025 · 6:00 PM

Information Technology Board

IT Board to vote on adding law records system, consulting contract

The Information Technology Board will review and act on two contracts: an amendment with CentralSquare Technologies to add the Law Records Management System (LRMS) and a scope of work with Winbourne Consulting for oversight of the CAD/RMS project. They will also discuss a proposed AI Acceptable Use Policy.

technologycontractspolicepublic-safetyai-policywaukesha
✓ Decided: IT Board approves Winbourne Consulting scope for CAD/RMS project

The Information Technology Board reviewed three agenda items. It approved the Oversight Project Management scope of work with Winbourne Consulting for the CAD/RMS project by a unanimous 6‑0 vote. No action was recorded for the CentralSquare Technologies amendment or the AI Acceptable Use Policy.

City Hall, Training Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02440 — approved
6 yea
Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-02441 — approved
6 yea
Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran yea · Daniel Manion yea · Steve Van Trieste yea
Adjournment — adjourned
6 yea
Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran yea · Daniel Manion yea · Steve Van Trieste yea
Tue Nov 4, 2025 · 6:00 PM

City Council

City Council will consider and vote on the 2026 Operating Budget

The council will hold a public hearing on the 2026 Operating Budget and then take action to adopt it, including the appropriation and tax levy ordinance. It will also review the Finance Committee's recommendation to adopt the budget and consider a side letter with the Waukesha Professional Police Association on health‑insurance changes. Several contract amendments and change orders for city services and infrastructure will be reviewed for approval.

budgetfinancecontractspublic-hearingpoliceinfrastructureparking
✓ Decided: Council adopts 2026 operating budget with $84.1M General Fund

The City Council approved the 2026 Operating Budget, allocating $84,127,448 to the General Fund (14-1). It also adopted the 2026 appropriation and tax levy ordinance for $79,645,364 (14-1). Additional actions included approving a police health‑insurance side letter, parking code changes, municipal court bond schedule updates, dog‑damage provisions, and denying two invited bartender applications.

Council Chambers, City Hall
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Moltzan, seconded by Ald. Matthews, to approve the denial of the Invited Bartender Application for Grace Davis. The motion carried by the following vote:
12 yea · 2 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Paul Wuteska nay · Alicia Halvensleben nay
A motion was made by Ald. Moltzan, seconded by Ald. Matthews, to approve the denial for the Invited Bartender Application for Casey Lewandowski. The motion carried by the following vote:
11 yea · 3 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Jack Wells nay · Paul Wuteska nay · Alicia Halvensleben nay
ID#25-02429 — approved
14 yea · 1 nay
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02425 — approved
23 yea · 5 nay · 2 abstain
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste abstain · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste abstain · Jack Wells nay · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02462 — approved
14 yea · 1 nay
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02363 — approved
12 yea · 3 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson nay · Joe Pieper yea · Steve Van Trieste nay · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 7 items passed by unanimous or near-unanimous consent.
Mon Nov 3, 2025 · 5:30 PM

Building and Grounds

Building and Grounds Committee meeting cancelled

The November 3, 2025, Building and Grounds Committee meeting has been cancelled. The next meeting is scheduled for December 1, 2025, at 5:30 PM.

meeting-cancelledbuilding-and-groundswaukesha
Council Chambers, City Hall
Wed Oct 29, 2025 · 6:00 PM

Plan Commission

Plan Commission reviews draft zoning code standards

The Plan Commission will hold a special meeting to review and discuss draft standards for the Zoning Code Update, including design, development, access, mobility, landscape, natural resources, and sign standards. The item is presented for input from commissioners, council members, and attendees; no formal decision is scheduled.

plan-commissionzoningdesign-standardslandscapesignsdevelopment-standards
✓ Decided: Plan Commission reviewed draft zoning code updates, no votes taken

The Plan Commission held a special meeting to review the draft design, development, access and mobility, landscape and natural resource, and sign standards for the proposed zoning code update. No vote was taken on any item. The discussion was for input from commissioners, council members, and the public.

Council Chambers, City Hall
Tue Oct 28, 2025 · 6:00 PM

Finance Committee

Finance Committee to recommend 2026 operating budget adoption

The Finance Committee will review and possibly recommend adopting the 2026 Operating Budget to the City Council. They will also consider accepting a $139,600 Community Policing Development Microgrant. The committee may also review any budget-related items not specifically listed.

financebudgetpolicinggrantoperating-budgetwaukesha
✓ Decided: Finance Committee adopts 2026 budget and approves $139.6K police grant

The committee approved the minutes from the October 16, 2025 meeting. It approved a $139,600 FY25 Community Policing Development microgrant. A proposal to lower the 2026 employee wage increase to 3.0% was rejected. The committee then recommended that the City Council adopt the 2026 operating budget with a total General Fund amount of $84,127,448.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Lemke and seconded by Pieper to amend the Operating Budget to reduce proposed employee wage increase from 3.5% to 3.0%. The motion failed by the following vote:
1 yea
Rick R. Lemke yea
ID#25-02429 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02430 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Mon Oct 27, 2025 · 6:00 PM

Ordinance & License Committee

Waukesha Ordinance & License Committee to review bartender applications

The committee will discuss and make recommendations regarding various bartender applications. The meeting also includes the approval of minutes from the October 13, 2025, meeting.

licensingalcohol-permitscity-government
✓ Decided: Committee approves bartender licenses and several business permits

The Ordinance & License Committee approved the minutes from the October 13 meeting by unanimous consent. The committee also approved bartender license applications for James Davis, Casey Lewandowski, and Grace Davis. In addition, it approved a Class B Beer & Liquor Combo license for Grewal Gas & Food Mart, a Successor/Change of Agent license for Kwik Trip #970, and a Secondhand Article Dealer license for Silverbot. All motions carried with a 3‑0 vote and two members absent.

Council Chambers, City Hall
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Van Trieste, seconded by Ald. Halvensleben, to approve the Bartender Application for James Davis. The motion carried by the following vote:
3 yea
Alicia Halvensleben yea · Steve Van Trieste yea · Dean D. Lemke yea
A motion was made by Ald. Van Trieste, seconded by Ald. Halvensleben, to approve the Bartender License Application for Casey Lewandowski. The motion carried by the following vote:
2 yea
Alicia Halvensleben yea · Steve Van Trieste yea
A motion was made by Ald. Van Trieste, seconded by Ald. D. Lemke, to approve the Bartenders License Application for Grace Davis. The motion carried by the following vote:
3 yea
Alicia Halvensleben yea · Steve Van Trieste yea · Dean D. Lemke yea
A motion was made by Ald. Halvensleben, seconded by Ald. Van Trieste, to approve the RESERVE "Class B" Beer & Liquor Combo License Application for Grewal Gas & Food Mart, the Successor/Change of…
3 yea
Alicia Halvensleben yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02425 — approved
6 yea · 4 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste yea · Dean D. Lemke yea · Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02426 — approved
3 yea · 2 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02432 — approved
3 yea · 2 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste yea · Dean D. Lemke yea
Thu Oct 23, 2025 · 5:30 PM

Board of Public Works

Board to decide on flood mitigation, parking ramp repair contracts

The Board of Public Works will discuss and possibly recommend to the City Council several contract amendments and agreements. Items include a contract amendment with Passport Labs for parking violation processing via Mobile Pay, a change order for the South Street Parking Ramp structural repair, a change order for the 2025 Area 7 Flood Mitigation project, a storm water management agreement with GE Medical Systems, a sidewalk easement with Wisconsin Gas, and a private road leaf-collection agreement with Park Place MHC.

public-workscontractsparkingflood-mitigationstorm-watereasementwaukesha
✓ Decided: Board unanimously recommends eight contracts and approves minutes, payments

The Board of Public Works approved the October 9, 2025 meeting minutes and the scheduled payments. It also recommended eight separate contracts and agreements for City Council consent, including a parking‑violation mobile‑pay amendment, a parking‑ramp repair change order, a flood‑mitigation change order, a storm‑water management agreement, a sidewalk easement, and a private‑road leaf‑collection agreement. All motions carried unanimously with a 5‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
ID#25-02387 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02389 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02388 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02390 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02391 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02404 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02405 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02423 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Wed Oct 22, 2025 · 6:00 PM

Plan Commission

Plan Commission to consider 119-unit senior housing project

The Plan Commission will review a rezoning petition and final site plans for a senior housing development west of Meadowbrook Road. The body will also hold a public hearing for a commercial adult day care center and consider updates to the Landmarks Commission Ordinance.

zoningsenior-housinghealthcareordinancesland-use
✓ Decided: Plan Commission recommends rezoning of 25.9 acres near Meadowbrook Road

The Waukesha Plan Commission approved a Conditional Use Permit for an adult day‑care center with conditions. It recommended approval of a rezoning petition for about 25.9445 acres west of Meadowbrook Road. It also recommended approval, with conditions, of a senior‑housing final site plan and related survey maps, and suggested council consent for an extra‑territorial survey map. Finally, it recommended adoption of changes to the Landmarks Commission Ordinance.

Council Chambers, City Hall
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that the Minutes be approved. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member Heather Granger, that this item be approved with conditions. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member Heather Granger, that this item be recommended for approval. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be recommended for approval with conditions. The motion carried by the following vote: Page 2City of…
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be recommended for approval with conditions. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Member Heather Granger, seconded by Ald. Elizabeth Moltzan, that this item be recommended for Council Consent. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea
A motion was made by Member Joan Francoeur, seconded by Ald. Elizabeth Moltzan, that this item be recommended for approval. The motion carried by the following vote:
4 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · Heather Granger yea · Jack Wells absent · R.G. Keller absent
PC25-0156 — recommended for Council Consent
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
ID#25-02202 — approved
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
PC25-0158 — recommended for approval
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
PC25-0160 — recommend approval with conditions
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
PC25-0159 — recommended for approval
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
PC25-0161 — approved with conditions
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
ID#25-02207 — recommended for approval
4 yea · 3 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller absent · Jennifer Wallner absent · Heather Granger yea
🏢 Building at this address: 2 floors
Tue Oct 21, 2025 · 6:00 PM

City Council

Council to consider final plat for 39-lot Winterberry Reserve subdivision

The City Council will vote on a consent agenda including transit service changes, a bus engine bid, and several pedestrian safety and parking sign modifications. Under new business, they will consider property damage reimbursement claims. The council will also review a final plat for Winterberry Reserve Phase 1, adding 39 single-family lots at 0 Summit Ave, and take up ordinances amending parking regulations, adopting vicious dog provisions, and resolutions setting compensation for the mayor, council, city attorney, and municipal judge.

zoningbudgethousingtransportationpublic-safetyparkingdogs
✓ Decided: Council approves Winterberry Reserve Phase 1 subdivision plat

The council approved the final subdivision plat for Phase 1 of Winterberry Reserve, adding 39 single‑family lots and 3 outlots in the Rs‑3 PUD, by a vote of 12‑2‑1. The council also disallowed property‑damage reimbursement claims from Sharon Grunfelder (12‑2‑1) and Amber Dobson (13‑1‑1). A motion to raise the mayor’s salary was rejected, while a motion to keep the mayor’s salary at the current $94,447 level passed 7‑6‑1‑1. The council kept council members’ salaries at $7,000 (13‑1‑1) and approved new compensation for the city attorney and municipal judge.

Council Chambers, City Hall
🗳️ How they voted — 16 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. R. Lemke, seconded by Ald. Halvensleben, to approve the disallowance for claim for property damage reimbursement from Sharon Grunfelder. The motion carried by the following…
12 yea · 2 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Rick R. Lemke yea · Rico Camacho yea · Steve Van Trieste nay · Dean D. Lemke nay
A motion was made by Ald. R. Lemke, seconded by Ald. Halvensleben, to approve the disallowance for claim for property damage reimbursement for Amber Dobson. The motion carried by the following vote:
13 yea · 1 nay
Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Mike Chrisien yea · Steve Van Trieste nay
A motion was made by Ald. R. Lemke, seconded by Ald. D. Lemke, to approve Final Subdivision Plat for Phase 1 of Winterberry Reserve to include the platting of the first 39 single family lots and 3…
12 yea · 2 nay
Mike Chrisien yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Eric Payne nay · Steve Van Trieste nay
A motion was made by Ald. Pieper, seconded by Ald. Camacho, to approve Resolution No. 2025-24 A Resolution Establishing the Compensation of the Mayor from April 21, 2026 through April 15, 2030 as…
11 nay · 2 yea · 1 absent
Joe Pieper yea · Mike Anderson yea · Mike Chrisien nay · Eric Payne nay · Doreen Wigderson nay · Steve Van Trieste nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Dale Matthews nay · Dean D. Lemke nay · Rick R. Lemke nay · Rico Camacho nay · Jack Wells absent
A motion was made by Ald. R. Lemke, seconded by Ald. D. Lemke, to approve an $85,000 salary with 2% increase per year for mayor. The motion failed by the following vote: Page 6 City of Waukesha…
7 nay · 6 yea · 1 absent
Mike Chrisien yea · Doreen Wigderson yea · Mike Anderson yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Eric Payne nay · Joe Pieper nay · Steve Van Trieste nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Rico Camacho nay · Jack Wells absent
A motion was made by Ald. Manion, seconded by Ald. Wigderson, to approve keeping the Mayor's salary at the current level of $94,447 with the benefits as previously offered, for the full four year…
7 yea · 6 nay · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Rico Camacho yea · Joe Pieper nay · Steve Van Trieste nay · Paul Wuteska nay · Dale Matthews nay · Dean D. Lemke nay · Rick R. Lemke nay · Jack Wells absent
A motion was made by Ald. Wigderson, seconded by Ald. Manion, to approve keeping the Common Council's annual salary at the current level of $7000.00, from April 21, 2026 through April 16, 2029. The…
13 yea · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Paul Wuteska nay
A motion was made by Ald. R. Lemke, seconded by Ald. Wigderson, to approve Resolution No. 2025-26, A Resolution Establishing the Compensation of the City Attorney from May 1, 2026 through April 30…
8 yea · 6 nay
Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Rick R. Lemke yea · Rico Camacho yea · Mike Chrisien nay · Eric Payne nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Dean D. Lemke nay
A motion was made by Ald. R. Lemke, seconded by Ald. Wigderson, to approve Resolution 2025-27, setting the Municipal Judge salary at $40,000 with 3% increases each year from May 1, 2026 to April 30…
10 yea · 4 nay
Mike Chrisien yea · Doreen Wigderson yea · Joe Pieper yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Eric Payne nay · Steve Van Trieste nay · Daniel Manion nay · Dale Matthews nay
PC25-0149 — approved
12 yea · 2 nay · 1 absent
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02369 — approved
24 nay · 15 yea · 3 absent · 3 abstain
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper nay · Steve Van Trieste nay · Jack Wells absent · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben abstain · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho nay · Mike Chrisien nay · Eric Payne nay · Doreen Wigderson nay · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben abstain · Dale Matthews nay · Dean D. Lemke nay · Rick Lemke nay · Rico Camacho nay · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper nay · Steve Van Trieste nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben abstain · Dale Matthews nay · Dean D. Lemke nay · Rick Lemke nay · Rico Camacho yea
ID#25-02370 — approved
13 yea · 1 absent · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02371 — approved
8 yea · 6 nay · 1 absent
Mike Chrisien nay · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke yea · Rico Camacho yea
ID#25-02372 — approved
10 yea · 4 nay · 1 absent
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion nay · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02414 — approved
12 yea · 2 nay · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke yea · Rico Camacho yea
ID#25-02410 — approved
13 yea · 1 nay · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 2 items passed by unanimous or near-unanimous consent.
Tue Oct 21, 2025 · 4:30 PM

Waukesha Water Commission

Commission to approve software contract and 2026 budget

The Waukesha Water Commission will approve payments, a software contract, and a 2026 operating budget. The body will also discuss a survey for a 2026 resurfacing project.

waterbudgetsoftwarecontractresurfacing
✓ Decided: Commission approved $695,416 cloud billing software contract

The Waukesha Water Commission approved its meeting minutes and several action items. It authorized payments from the General Fund and Improvement Fund, amended the SmithGroup professional services agreement, and approved a survey for the 2026 resurfacing project. The commission also approved Harris Computer's cloud‑based utility billing software proposal costing $695,416 with an annual cost of $98,441. All approvals were unanimous among the six members present.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
[context] ID#25-02394 Approval of Minutes Meeting Minutes 9-18-25Attachments: approved
6 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Shawn Reilly yea
[context] ID#25-02395 Approve Payments from the General Fund and the Improvement Fund September Voucher ListAttachments: approved
6 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Shawn Reilly yea
[context] SmithGroup PSA Amendment 1 memoAttachments: approved
6 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Shawn Reilly yea
[context] memo for resurfacing survey workAttachments: approved
6 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Shawn Reilly yea
[context] ERP Software Memo - Utility Billing FinalAttachments: approved
6 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Shawn Reilly yea
ID#25-02395 — approved
6 yea · 1 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-02397 — approved
6 yea · 1 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-02396 — approved
6 yea · 1 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-02394 — approved
6 yea · 1 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-02401 — approved
6 yea · 1 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
Mon Oct 20, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to consider 2026 operating budget and meeting schedule

The Parks, Recreation and Forestry Board will review and possibly act on the proposed 2026 Executive Operating Budget for the department. It will also consider the proposed 2026 board meeting schedule. Public comment is limited to three minutes per speaker until 6:00 pm.

budgetmeeting-scheduleparks-recreation-forestrypublic-comment
✓ Decided: Board approved 2026 budget recommendation and meeting schedule

The board approved the minutes from the September 8, 2025 meeting. It also approved the recommendation to the Finance Committee for the 2026 Executive Operating Budget for the Parks, Recreation & Forestry Department. Additionally, the board approved the proposed 2026 board meeting schedule. All motions passed unanimously with five votes in favor and three members absent.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Eric Huemmer, seconded by Steve Johnson, that this item be approved. The motion carried by the following vote:
5 yea
Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea
A motion was made by Johnson, seconded by Roth, that this Discussion and Recommendation be approved. The motion carried by the following vote:
5 yea
Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea
A motion was made by Huemmer, seconded by Schmitz, that this Discussion and Page 1City of Waukesha October 20, 2025Parks, Recreation and Forestry Board Meeting Minutes - Final Recommendation be…
5 yea
Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea
ID#25-02403 — approved
5 yea · 3 absent
Rico Camacho absent · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss absent
ID#25-02406 — approved
5 yea · 3 absent
Rico Camacho absent · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss absent
ID#25-02415 — approved
5 yea · 3 absent
Rico Camacho absent · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss absent
Mon Oct 20, 2025 · 6:00 PM

Redevelopment Authority

RDA considers loan for 36-unit housing development on Meadow Lane

The Redevelopment Authority will review a loan request for a residential project and discuss the authority's real estate purchasing policy. The body will also receive an update on its loan program.

affordable-housingloansreal-estateresidential-development
Training Room, First Floor City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02382 — approved
5 yea · 2 absent
Mike Duffek absent · Meena Granado yea · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri absent · Jeff Fowle yea
ID#25-02386 — approved
6 yea · 1 absent
Mike Duffek absent · Meena Granado yea · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-02385 — approved
5 yea · 1 absent · 1 abstain
Mike Duffek absent · Meena Granado abstain · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
Thu Oct 16, 2025 · 6:00 PM

Finance Committee

Finance Committee to review 2026 operating budget

The Finance Committee will review the 2026 Operating Budget for General Government, Cemetery, Planning/Building Inspection, Public Works, Parking, CWP, Transit, Non-Departmental, and Debt. The committee will also approve the minutes from the October 14, 2025 meeting.

budgetfinancepublic-worksplanningtransitcemeterymeeting
✓ Decided: Finance Committee approved October 14 minutes

The committee approved the October 14, 2025 Finance Committee minutes after hearing no objections. The 2026 operating budget review was discussed but no action was taken. The next meeting is scheduled for October 28, 2025.

Council Chambers, City Hall
Wed Oct 15, 2025 · 6:00 PM

Human Resources Committee

HR Committee to set mayor and council pay rates

The Human Resources Committee will discuss a new meeting start time and review policy revisions. The body will also consider resolutions establishing compensation for the mayor, council members, city attorney, and municipal judge.

hrpaycompensationpolicymayorcouncilwaukesha
✓ Decided: Human Resources Committee keeps all compensation levels unchanged

The committee approved the September 17 meeting minutes and the amendment to the HR Policy C1 Holidays. It voted to leave the salaries of the mayor, common council members, city attorney, and municipal judge unchanged for the next term. All compensation decisions passed by majority vote.

Council Chambers, City Hall
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
A motion was made by Ald Wigderson, seconded by Ald Anderson, to leave the salary as is with no increases for the next term for the City Attorney
3 yea · 2 nay
Doreen Wigderson yea · Mike Anderson yea · Paul Wuteska nay · Dale Matthews nay · Mike Chrisien yea
ID#25-02369 — approved
3 yea · 2 nay
Doreen Wigderson yea · Paul Wuteska nay · Mike Anderson yea · Dale Matthews yea · Mike Chrisien nay
ID#25-02371 — denied
6 nay · 4 yea
Doreen Wigderson yea · Paul Wuteska nay · Mike Anderson yea · Dale Matthews nay · Mike Chrisien nay · Doreen Wigderson nay · Paul Wuteska yea · Mike Anderson nay · Dale Matthews yea · Mike Chrisien nay
ID#25-02372 — approved
4 yea · 1 nay
Doreen Wigderson yea · Paul Wuteska nay · Mike Anderson yea · Dale Matthews yea · Mike Chrisien yea
ID#25-02370 — approved
4 yea · 1 nay
Doreen Wigderson yea · Paul Wuteska nay · Mike Anderson yea · Dale Matthews yea · Mike Chrisien yea
ID#25-02371 — approved
3 yea · 2 nay
Doreen Wigderson yea · Paul Wuteska nay · Mike Anderson yea · Dale Matthews nay · Mike Chrisien yea
The other 5 items passed by unanimous or near-unanimous consent.
Wed Oct 15, 2025 · 12:30 PM

Waukesha Intergovernmental Health Group Advisory Council

Council to discuss Healthstat/Marathon contract extension through 2026

The Advisory Council will discuss a mid-year utilization review for the clinic and a proposed extension of the Healthstat/Marathon contract through 2026. They will also consider approval of minutes from March 6, 2025.

healthcontractsclinicutilization-reviewwaukesha
✓ Decided: Council reviewed health utilization and contract extension; no decisions logged

The advisory council heard a mid‑year utilization review from CBIZ consultant Erin Eason. A discussion was held on extending the Healthstat/Marathon contract through 2026, with a motion to approve presented. No vote results or formal approvals were recorded in the minutes.

Administration Center (Room 355) | - 515 W Moreland Blvd Waukesha, WI 53188
Tue Oct 14, 2025 · 6:00 PM

Finance Committee

Finance Committee will review the 2026 operating budget for multiple city departments

The Finance Committee will approve the September 30, 2025 meeting minutes. It will then review the city’s 2026 operating budget covering the Police, Fire, Library, Park/Rec/Forestry, Internal Service Funds and applicable special revenue funds. The committee may also consider any other budget line items not listed on the agenda.

budgetpolicefirelibraryparksfinance
✓ Decided: Finance Committee approved September 30, 2025 meeting minutes

The Finance Committee approved the September 30, 2025 Finance Committee minutes with no objections. No other actions were taken; the 2026 operating budget review was discussed but not decided. The next Finance Committee meeting is scheduled for October 16, 2025 at 6:00 p.m.

Council Chambers, City Hall
Mon Oct 13, 2025 · 5:30 PM

Cemetery Commission

Cemetery Commission to review 2026 budgets

The Cemetery Commission will review and make recommendations on the proposed 2026 Capital Improvement Plan budget (2026-2030) and the 2026 Executive Operating Budget for the cemetery. They will also hear a Cemetery Director report on operations through September 2025 and a report from the Friends of Prairie Home Cemetery, including a Tombstone Trot flyer. The meeting includes public comment and approval of prior minutes.

cemeterybudgetcapital-improvement-planoperationswaukeshacommission
City Hall Training Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02373 — approved
5 yea · 2 absent
Amanda Roddy absent · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho absent · Pat Grulke yea
Adjournment — adjourned
6 yea · 1 absent
Amanda Roddy yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho absent · Pat Grulke yea
ID#25-02376 — approved
6 yea · 1 absent
Amanda Roddy yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea · Mike Chrisien yea · Rico Camacho absent · Pat Grulke yea
Mon Oct 13, 2025 · 6:00 PM

Ordinance & License Committee

Committee to discuss parking regulations and vicious dog provisions

The Ordinance & License Committee will review minutes from the September 22 meeting, consider invited bartender license applications, and discuss proposed amendments to Municipal Code Chapter 7 regarding parking regulations and forfeitures. The committee will also discuss the adoption of vicious dog provisions.

zoningpolicelicensingpublic-safetycouncilagenda
✓ Decided: Committee approved three bartender licenses and forwarded code changes on parking and dogs

The Ordinance & License Committee unanimously approved bartender applications for Zamiya Marie Rose Klosky, Jennifer Marcella Blooner, and Marian R. Farris. It also approved proposed amendments to Municipal Code Chapter 7 on parking regulations and forfeitures, recommending them for a second reading by City Council. Additionally, the committee approved the adoption of a vicious‑dog provision to the Municipal Code, also forwarding it for a second reading.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02229 — approved
15 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02362 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02363 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Thu Oct 9, 2025 · 5:30 PM

Transit Commission Meeting

Transit Commission to vote on proposed service changes and bus engine bid

The Waukesha Transit Commission will hold a public hearing on proposed service changes effective January 12, 2026, and vote on a bus engine bid from Cummins Sales and Service. The commission will also discuss a study of Waukesha Metro Transit.

transitservice-changespublic-hearingbudgetwaukeshacummins
✓ Decided: Commission recommends council approve 2026 service changes and Cummins bus engine bid

The Transit Commission approved the July 17, 2025 minutes. It unanimously recommended that the City Council consent to the proposed service changes effective January 12, 2026. It also unanimously recommended council consent to the bus engine bid from Cummins Sales and Service. No public comments were received on the service changes.

Council Chambers, City Hall
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Kevin Reilly, to open the public hearing at 5:41p.m.. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Eric Payne, seconded by Kevin Reilly, to close the public hearing at 5:51p.m.. The motion carried by the following vote
4 yea
Kevin Reilly yea · Eric Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of July 17, 2025, be approved. The motion carried by the following vote:
3 yea
Kevin Reilly yea · Eric Payne yea · Steve Kassens yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the Proposed Service Changes Effective January 12, 2026, be recommended for Council Consent. The motion carried by the…
4 yea
Kevin Reilly yea · Eric Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Bus Engine Bid from Cummins Sales and Service be recommended for Council Consent. The motion carried by the following…
4 yea
Kevin Reilly yea · Eric Payne yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02222 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-02223 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-02224 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
Public Hearing - Proposed Service Changes Effective January 12, 2026 — approved
8 yea · 2 absent
Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
Thu Oct 9, 2025 · 4:45 PM

Library Board

Library Board to review public art policy and director evaluation

The Library Board will discuss and possibly take action on a revised Public Art Policy (D-4) and the 2025 Library Director Evaluation. The board will also receive a budget update and review draft renovation plans for the administrative area. Other business includes approving the Veterans Day holiday and ratifying minutes from September.

librarypublic-artbudgetdirector-evaluationpoliciesholidaysrenovationwaukesha
✓ Decided: Library Board approved $45,256.56 October bills and multiple policies

The Board unanimously approved the September 11 minutes, the October bills totaling $45,256.56, and the financial report. It also approved the Public Art Policy, the 2025 Library Director evaluation, and a measure to give staff an extra personal holiday pending council approval. All motions carried with an 8‑0 vote.

Library Board Room
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-02279 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Austin Dutter absent · Megan Lach yea · Alicia Halvensleben yea
ID#25-02290 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Austin Dutter absent · Megan Lach yea · Alicia Halvensleben yea
Thu Oct 9, 2025 · 5:30 PM

Board of Public Works

Review change order for Sunset & Oakdale traffic signal project

The Board of Public Works will discuss and possibly act on Contract Change Order No. 1 with Zenith Tech, Inc. for the W. Sunset Drive and Oakdale Drive Traffic Signal Improvements Project. They will also consider approving payments and the minutes from the September 18, 2025 meeting.

public-workstraffic-signalcontractswaukeshainfrastructure
✓ Decided: Board recommends Zenith Tech contract change for traffic signal project

The Board approved the September 18, 2025 meeting minutes. It recommended that Council consent to Contract Change Order No. 1 with Zenith Tech, Inc. for the W. Sunset Drive and Oakdale Drive traffic signal improvements. The Board also approved the pending payments. No public comment was received.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of September 18, 2025, be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Contract Change Order No. 1 with Zenith Tech, Inc., for the W. Sunset Drive and Oakdale Drive Traffic Signal…
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Chairperson Steve Kassens, seconded by Member Kevin Reilly, that the Payments be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02164 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-02234 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-02165 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
Thu Oct 9, 2025 · 4:15 PM

Library Human Resources Committee

Library Human Resources Committee to review Library Director evaluation

The Library Human Resources Committee will meet to review and take possible action on the 2025 Library Director Evaluation. The committee will also review minutes from the August 14, 2025, meeting.

librarypersonnelevaluationcity-government
✓ Decided: Committee unanimously approved prior minutes and director evaluation

The Library Human Resources Committee met on October 9, 2025. The committee approved the August 14, 2025 meeting minutes unanimously. It also approved the 2025 Library Director Evaluation with changes, unanimously. The meeting adjourned at 4:21 p.m.

Library Board Room
Tue Oct 7, 2025 · 6:00 PM

City Council

Council to vote on new residential garbage and recycling fees

The City Council will consider a resolution creating and setting fees for residential garbage and recyclables collection services. The consent agenda includes several public works contracts and a federal RAISE grant for bike-pedestrian bridges. The council will also accept fire department grant awards and receive an update on the zoning code rewrite project.

feesgarbagerecyclinggrantsbridgespublic-worksfire-departmentzoning
✓ Decided: Council approved new residential garbage and recycling fees

The council approved the resolution creating and setting fees for residential garbage and recyclables collection services, passing 9‑5. The same meeting also approved the fire department’s acceptance of two grant awards, the amendment to the Disposition of Surplus Property Financial Policy, and awarded a $176,200 contract to Cy‑Con, Inc. for South Street Parking Ramp structural repairs. All votes were recorded in the minutes.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Pieper, seconded by Ald. Moltzan, to approve Resolution Creating and Setting Fees for Residential Garbage and Recyclables Collection Services. The motion carried by the…
9 yea · 5 nay
Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Rick R. Lemke yea · Rico Camacho yea · Mike Chrisien nay · Eric Payne nay · Daniel Manion nay · Dale Matthews nay · Dean D. Lemke nay
ID#25-02230 — approved
9 yea · 5 nay · 1 absent
Mike Chrisien nay · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion nay · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke nay · Rick Lemke yea · Rico Camacho yea
The other 8 items passed by unanimous or near-unanimous consent.
Mon Oct 6, 2025 · 5:30 PM

Building and Grounds

Building and Grounds to review pedestrian safety and parking changes

The committee will discuss and potentially act on multiple traffic safety improvements, including new signage and crosswalks. Members will also review parking restrictions at various city locations and a special event permit for the Scarecrow Stroll.

pedestrian-safetyparkingtraffic-signsroadspublic-events
✓ Decided: Council approved multiple traffic safety signs and a special event permit

The council approved a series of traffic‑safety measures, including new pedestrian signs, speed‑limit signs, a dead‑end sign, and safety improvements at several intersections. It also removed parking restrictions on several streets and granted a special‑event street‑closing permit for the Scarecrow Stroll on October 11, 2025. All motions passed with four votes in favor and one member absent.

Council Chambers, City Hall
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to approve the Minutes of June 30, 2025. The motion carried by the following vote:
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to install signage and pavement markings for pedestrian safety improvements at the intersection of Hartwell Avenue and Linden…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, that install one 25 mph sign and moving two speed limit signs on Pebble Valley Rd. near Pebble Valley Park. The motion carried by…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Dean D. Lemke, seconded by Ald. Mike Anderson, that install one DEAD END sign at the intersection of Parkton Dr. and Rickert Dr. The motion carried by the following vote:
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to remove the parking restrictions on Sunkist Ave., West End Rd., Cherrywood Dr., Page 2City of Waukesha October 6, 2025Building…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Eric Payne, seconded by Ald. Mike Anderson, that install pedestrian crossing signs and pedestrian crossing ahead signs on Manhattan Drive at Niagara Street. The motion…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, the Street Closing and Special Event Permit Application submitted by Waukesha Downtown Business Association for the Scarecrow…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to install the pedestrian safety improvements on the four corners around Buchner Park as presented. The motion carried by the…
3 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to install a No Parking Sign Here to Corner on Moreland Blvd. at Madison Street. The motion carried by the following vote:
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to revise the No Parking Signs along N. Hine Avenue near Butler Middle School to No Parking 8:30AM-3:00PM Sept 1-June 15 Except…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Mike Anderson, to install No Parking in Alley signs in Alley 71 (Porter Avenue, E. Broadway, Frederick Street). The motion carried by the…
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Eric Payne, to remove the parking restrictions on Palmer Street and Morey Lane. The motion carried by the following vote:
4 yea
Eric Payne yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Anderson yea
ID#25-01717 — approved
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-01712 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-01714 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-01715 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-01719 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-01795 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-02163 — approved
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
ID#25-02209 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke yea · Rick Lemke yea · Dale Matthews absent · Mike Anderson yea
Wed Oct 1, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to review ordinance changes and certificates of appropriateness for four properties

The Landmarks Commission will review proposed amendments to city ordinances governing definitions, composition, powers, and procedures. The commission will also consider certificates of appropriateness and paint/repair grants for properties in the McCall Street, College Avenue, and Five Points Downtown Historic Districts.

landmarkshistoric-preservationcertificates-of-appropriatenessgrantsordinanceswaukesha
Council Chambers, City Hall
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
ID#25-02196 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02199 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02198 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02197 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02200 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02206 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
ID#25-02208 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza absent · Andrea Dorantes yea
Tue Sep 30, 2025 · 6:00 PM

Finance Committee

City to consider new residential garbage and recycling collection fees

The Finance Committee will review several items, including a contract for the Artscape Placemaking Plan on the Riverwalk and Riverfront Street, a discussion of the 2025‑2029 financial projection, and a resolution to set fees for residential garbage and recyclables collection. The committee will also consider amendments to the Disposition of Surplus Property Financial Policy (F‑15) and a revised Purchasing and Bidding Policy (F‑6.0). Each item will be presented for possible action.

financewaste-feesartscapebudgetingpolicy
✓ Decided: Finance Committee approves garbage fee and two financial policy updates

The committee approved the September 9, 2025 meeting minutes without objection. It adopted Resolution 2025-17 to set residential garbage and recyclables collection fees. The committee also approved amendments to the Disposition of Surplus Property Financial Policy (F‑15) and the revised Purchasing and Bidding Policy (F‑6.0). The Artscape Placemaking Plan contract was placed on hold and the 2025‑2029 financial projection was discussed.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02013 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02014 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02230 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Wed Sep 24, 2025 · 6:00 PM

Plan Commission

Plan Commission to consider Winterberry Reserve Phase 1 plat with 39 lots

The Plan Commission will review several site plan and architectural requests including additions for car dealerships, a cold storage building, and a new subdivision. Decisions will be made on a 39-lot residential plat and expansions at International Porsche, Russ Darrow Kia, and Boucher Cadillac on E. Moreland Blvd. The consent agenda includes minor site plans for a pole building, a backup generator, and a patio expansion.

plan-commissionzoningsite-plansubdivisiondevelopmentcommercialresidential
✓ Decided: Plan Commission approved multiple site plans, including a new subdivision of 39 homes

The commission approved ten site‑plan and architectural requests, covering additions, renovations, and a subdivision. All motions passed unanimously with a 5‑0 vote, with two members absent. The Winterberry Reserve Phase 1 subdivision, creating 39 single‑family lots, was approved pending city department comments.

Council Chambers, City Hall
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Shawn Reilly, seconded by Member R.G. Keller, that the Minutes be approved. The motion carried by the following vote:
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Mayor Shawn Reilly, seconded by Member R.G. Keller, that this item be approved with staff comments and conditions. Employee parking is to be designated with a sign and marked…
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Mayor Shawn Reilly, seconded by Member Joan Francoeur, that this item be approved with staff comments and conditions and that employee parking is signed. Applicant must be…
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be approved with staff comments and conditions.The north location is acceptable. Improve sound barrier, run…
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Member Jennifer Wallner, that this item be approved. The motion carried by the following vote:
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Member Joan Francoeur, seconded by Member Jennifer Wallner, that this item be approved. The motion carried by the following vote:
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Member Jennifer Wallner, seconded by Mayor Shawn Reilly, that this item be approved with all City Department comments to be addressed. The motion carried by the following vote:
5 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Mayor Shawn Reilly, seconded by Member R.G. Keller, that this item be approved with City Department comments to be addressed. The motion carried by the following vote:
5 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Jack Wells absent
Approval of Minutes — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0143 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0144 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0146 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0147 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0148 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0149 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
PC25-0153 — approved
5 yea · 2 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger absent
Mon Sep 22, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews bartender and other license applications

The Ordinance & License Committee will consider approval of prior meeting minutes and review several license applications, including invited bartender, general bartender, invited other, and other applications. No ordinances or fee changes are on the agenda.

licensesbartenderapplicationscommitteecity-government
✓ Decided: Ordinance & License Committee approves six license applications

The committee approved six license applications, including three invited bartender permits, one regular bartender permit, an extension for Club 400, and a junk dealer permit. All motions passed by unanimous consent of the four present members, with Dean D. Lemke absent. No other actions were taken.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Invited Bartender License Application for Jeffrey Bernhardt. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Invited Bartender License Application for Isabella Strader. The motion carried by the following vote: Page 1City of…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wuteska, to approve the Invited Bartender License Application for Dallas Kinski. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wuteska, to approve the Bartender License Application for Meghan Mayer. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Invited Extension of Premises Application from Club 400. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Wuteska, seconded by Ald. Van Trieste, to approve the Junk Dealer License Application for Waukesha Iron & Metal. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-02127 — approved
12 yea · 3 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-02185 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-02186 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-02195 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Thu Sep 18, 2025 · 5:30 PM

Board of Public Works

Board to review contracts for water plant, pump station, and utility projects

The Waukesha Board of Public Works will approve minutes and payments, review bids for the South Street Parking Ramp, and discuss contracts for the Clean Water Plant, Ruben Drive Pump Station, and Gascoigne/Peters Drive improvements.

public-workscontractsinfrastructurewaterparkstransportation
✓ Decided: Board recommended council consent for a USDOT RAISE grant for bike and pedestrian bridges

The Board of Public Works unanimously approved the September 4 minutes and the pending payments. It recommended awarding the South Street Parking Ramp repair contract to Cy‑Con, Inc. for $176,200 and advised council consent on four consulting and contract change orders, including a USDOT RAISE grant for bike and pedestrian bridges over USH‑18/STH‑59 and USH‑18/STH‑59/STH‑164.

Council Chambers, City Hall
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
ID#25-02142 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02143 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02144 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02145 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02146 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02147 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02160 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Sep 18, 2025 · 6:00 PM

Waukesha Water Commission

Commission will approve payments from General and Improvement Funds

The Waukesha Water Commission will vote to approve payments from the General Fund and the Improvement Fund as detailed in the August voucher list. Commissioners will receive updates on the new water utility operations center and review the 2026 Capital Improvement Plan. A closed session will be held to discuss legal strategy for Circuit Court Case No. 2025-CV-971, Fabair, LLC et al v. Public Service Commission of Wisconsin. The meeting also includes public comment and approval of prior meeting minutes.

water-utilityfinancecapital-improvementlegalpublic-comment
✓ Decided: Commission unanimously approved signing of closed‑session agreement

The Waukesha Water Commission approved several actions, each with a 5‑0 vote. It authorized a closed‑session meeting to confer with legal counsel on a circuit‑court case, then reconvened in open session and approved signing the agreement discussed. The commission also approved the minutes from prior meetings and authorized payments from the General and Improvement Funds. No other decisions were made.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
[context] Meeting Reconvened approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
A motion was made by Commission President Piatt, seconded by Commissioner Couri, that the agreement discussed in Closed Session be signed by the utility staff. The motion carried by the following…
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
A motion was made by Commission President Piatt, seconded by Commissioner Couri, that the agreement discussed in Closed Session be signed by the utility staff. The motion carried by the following…
10 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] ID#25-02168 Approve Payments from the General Fund and the Improvement Fund August Voucher ListAttachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
ID#25-02167 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02173 — approved
7 present
Paul Ybarra present · Joan Francoeur present · Jeff Fowle present · Gerald Couri present · Joe Piatt present · Dale Matthews present · Shawn Reilly present
ID#25-02174 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02194 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02168 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02215 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
Wed Sep 17, 2025 · 6:00 PM

Human Resources Committee

HR Committee to conduct City Administrator performance review in closed session

The committee will consider updates to the deferred compensation plan, a new internal job transfer policy, and amendments to policies on fleet guidelines, corrective action, and holidays. They will then convene in closed session to review the City Administrator's performance and possibly take action.

human-resourcesperformance-reviewpoliciesdeferred-compensationcity-administratorclosed-sessionwaukesha
✓ Decided: HR Committee approves several policy updates and defers two items

The committee unanimously approved the June 18 meeting minutes. It also approved the revised Nationwide deferred compensation plan and amendments to the G3 Corrective and Disciplinary Action and C1 Holidays policies, each with a 4‑0 vote. The B15 Internal Job Transfers and E2 Fleet Guidelines policies were postponed to a future meeting.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald Chrisien, seconded by Ald Matthews, to approve revised deferred compensation plan document updates for Nationwide
4 yea
Doreen Wigderson yea · Paul Wuteska yea · Dale Matthews yea · Mike Chrisien yea
Motion by Ald Wuteska, seconded by Ald Matthews, to approve amendments to HR Policy G3 Corrective and Disciplinary Action as presented
4 yea
Doreen Wigderson yea · Paul Wuteska yea · Dale Matthews yea · Mike Chrisien yea
Motion by Ald Wuteska, seconded by Ald Matthews, to approve amendments to HR Policy C1 Holidays as presented
4 yea
Doreen Wigderson yea · Paul Wuteska yea · Dale Matthews yea · Mike Chrisien yea
ID#25-02178 — approved
4 yea · 1 absent
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
ID#25-02182 — approved
4 yea · 1 absent
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
ID#25-02183 — approved
4 yea · 1 absent
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
Tue Sep 16, 2025 · 6:00 PM

City Council

Waukesha City Council to consider 2026-2030 Capital Improvement Program

The City Council will discuss and act on the 2026-2030 CIP budget and the sale of city-owned property at 223 S. West Ave. The body will also consider a rezoning request for 3011 Saylesville Road and various public works contracts.

budgetzoningpublic-worksreal-estatetransit
✓ Decided: City Council approves $179.5M 2026‑2030 capital improvement plan

The council approved the 2026 CIP budget of $39,887,329 and the 2026‑2030 CIP budget of $179,471,597. It also approved a municipal exemption from the Waukesha County Library Tax, a $299,000 bus‑wash contract, rezoning of 3011 Saylesville Road, and the sale of city property at 223 S. West Ave. Several other motions were rejected or modified, including a $1.1M debt‑reduction request and a claim for property damage.

Council Chambers, City Hall
🗳️ How they voted — 9 divided votes
Named votes as recorded in the official record.
motion was made by Ald. Matthews, seconded by Ald. Payne, to reduce GO debt issuance for the Mindiola Project by $1,122,575 dollars. The motion failed by the following vote: Page 3City of Waukesha…
9 nay · 5 yea
Mike Chrisien yea · Eric Payne yea · Steve Van Trieste yea · Dale Matthews yea · Dean D. Lemke yea · Doreen Wigderson nay · Joe Pieper nay · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Alicia Halvensleben nay · Rick R. Lemke nay · Rico Camacho nay
A motion was made by Ald. Pieper, seconded by Ald. Halvensleben, to approve the 2026 CIP Budget of $39,887,329 and the 2026-2030 CIP budget of $179,471,597. The motion carried by the following vote:
12 yea · 2 nay
Mike Chrisien yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Eric Payne nay · Dale Matthews nay
A motion was made by Ald. Van Trieste, seconded by Ald. D. Lemke, to approve Claim for Property Damage for Al and Nancy Roberts. The motion failed by the following vote:
11 nay · 3 yea
Steve Van Trieste yea · Dean D. Lemke yea · Rico Camacho yea · Mike Chrisien nay · Eric Payne nay · Doreen Wigderson nay · Joe Pieper nay · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Alicia Halvensleben nay · Dale Matthews nay · Rick R. Lemke nay
A motion was made by Ald. Moltzan, seconded by Ald. Halvensleben, to approve disallowance for Claim for Property Damage for Al and Nancy Roberts. The motion carried by the following vote: Page 4City…
11 yea · 3 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Dale Matthews yea · Rick R. Lemke yea · Steve Van Trieste nay · Dean D. Lemke nay · Rico Camacho nay
A motion was made by Ald. Halvensleben, seconded by Ald. Camacho, to approve City Attorney and Community Development to finalize offer as discussed in closed session for the sale of the property…
12 yea · 1 nay · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Dale Matthews yea · Rico Camacho yea · Rick R. Lemke nay · Mike Anderson absent
ID#25-02136 — approved as amended
9 nay · 5 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson nay · Joe Pieper nay · Steve Van Trieste yea · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson absent · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho nay
ID#25-02082 — approved
12 yea · 1 absent · 1 abstain · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke abstain · Rick Lemke nay · Rico Camacho yea
ID#25-02166 — approved
14 nay · 14 yea · 2 absent
Mike Chrisien nay · Eric Payne nay · Doreen Wigderson nay · Joe Pieper nay · Steve Van Trieste yea · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson absent · Alicia Halvensleben nay · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke yea · Rico Camacho nay
ID#25-02136 — approved
12 yea · 2 nay · 1 absent
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 10 items passed by unanimous or near-unanimous consent.
Mon Sep 15, 2025 · 6:00 PM

Library Public Art Committee

Library committee reviews public art policy and updates

The Library Public Art Committee will review and possibly act on the Public Art Policy and specific art projects. The group will also receive reports on a library tour program and the 20th anniversary celebration.

librarypublic-artpolicycommitteetour
Library Board Room
Thu Sep 11, 2025 · 4:45 PM

Library Board

Board to review 2026 Library Budget and Public Services Manager job description

The Library Board will review and possibly act on the proposed 2026 Library Budget, a Public Services Manager job description, and an update on Waukesha Reads 2025. They will also hear reports from committees, the director, and the Friends of the Library.

librarybudgetpersonnelprogrammingendowmentboard-meetingwaukesha
✓ Decided: Library Board approves September bills, financial report and Waukesha Reads program

The board adopted the minutes from the August 14, 2025 meeting. It approved September bills totaling $67,575.67 and the September financial report. The board also approved the Waukesha Reads 2025 education initiative and the Public Services Manager job description. The meeting adjourned at 5:36 p.m.

Library Board Room
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-02106 — approved
7 yea · 4 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman absent · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach yea · Alicia Halvensleben yea
ID#25-02115 — approved
7 yea · 4 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman absent · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter absent · Megan Lach yea · Alicia Halvensleben yea
Tue Sep 9, 2025 · 6:00 PM

Finance Committee

Finance Committee to review 2026-2030 Capital Improvement Program

The Finance Committee will discuss and act on the 2026-2030 Capital Improvement Program (CIP). The body will also review contracts for police department cameras and the purchase of city buses.

budgetpublic-safetytransportationcapital-improvements
✓ Decided: Finance Committee approves safety cameras, buses and 2026‑2030 CIP budget

The committee approved the August 26, 2025 minutes without objection. It approved the Flock Safety contract for three additional cameras. It approved the purchase of three Gillig fixed‑route buses. It recommended the 2026‑2030 Capital Improvement Program budget to the Council.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02092 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02136 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02138 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Tue Sep 9, 2025 · 5:00 PM

Public Art Committee

Public Art Committee reviews mural proposals for Friedman Alley

The Public Art Committee will review proposals for a mural project in Friedman Alley. The meeting includes approval of previous minutes and a public comment session.

public-artmuralswaukeshacity-hallcommunity-developmentarts
✓ Decided: Public Art Committee approved mural contracts for three sites

The committee approved the minutes from the August 26, 2025 meeting. They approved working with Nate Page for the Site 3 mural location. They approved working with Hannah Tews for mural locations 1 and 2. The next meeting was scheduled for October 7, 2025 at 5 p.m.

Training Room, First Floor City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-02068 — approved
5 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
ID#25-02064 — approved
10 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea · Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
Mon Sep 8, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to review drone light show contract for 2026 Winter JanBoree

The Parks, Recreation and Forestry Board will meet to discuss a proposed contract with Laser Fusion. The board may take action to recommend this contract to the Common Council.

parks-and-recreationcontractswinter-janboreeevents
✓ Decided: Board approved minutes and recommended Laser Fusion contract for JanBoree

The Parks, Recreation and Forestry Board approved the meeting minutes from August 25, 2025. The board also approved its discussion and recommendation to the Common Council for a contract with Laser Fusion to provide a laser light show at the 2026 Winter JanBoree. Both motions passed unanimously.

Training Room at City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Johnson, seconded by Huemmer, that this Minutes be approved. The motion carried by the following vote:
5 yea
Eric Huemmer yea · Steve Johnson yea · John Schmitz yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Wallner, seconded by Schmitz, that this Discussion and Recommendation be approved. The motion carried by the following vote:
5 yea
Eric Huemmer yea · Steve Johnson yea · John Schmitz yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02140 — approved
5 yea · 3 absent
Rico Camacho absent · Eric Huemmer yea · Steve Johnson yea · Sarah Roth absent · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
ID#25-02139 — approved
5 yea · 3 absent
Rico Camacho absent · Eric Huemmer yea · Steve Johnson yea · Sarah Roth absent · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
Mon Sep 8, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider Wauk-tober beer/wine walk temporary license

The Ordinance & License Committee will review several license applications, including temporary beer/wine sales for the Wauk-tober event and a mobile home park license. The agenda also includes approval of prior meeting minutes and public comment.

licensesalcoholmobile-home-parkpublic-eventwaukesha
✓ Decided: Ordinance & License Committee approved three license applications

The committee approved the minutes from the August 25, 2025 meeting by unanimous consent. It also approved the bartender license for Meagan Bloxdorf, the temporary Class "B" license for the Wauk‑tober Beer & Wine Walk, and the mobile home park license for Park Place MHC, LLC, each with a 5‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-02128 — recommended for Council Consent
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02129 — recommended for Council Consent
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
ID#25-02130 — recommended for Council Consent
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Mon Sep 8, 2025 · 5:00 PM

Waukesha Water Commission

Commission will review General Manager employment and compensation data in closed session

The Waukesha Water Commission will open the meeting, then move to a closed session under Wis. Stat. 19.85(1)(c). In that session, commissioners will consider employment, promotion, compensation, and performance‑evaluation information for the General Manager position. Afterward, they may reconvene in open session to act on any matters discussed.

personnelemploymentgovernancewater-commission
✓ Decided: Commission approved closed‑session meeting on General Manager personnel matters

The Waukesha Water Commission voted to convene a closed session to consider employment, promotion, compensation, and performance‑evaluation data for the General Manager. The motion passed unanimously (4‑0). The commission then approved reconvening in open session after the closed session, also unanimously (4‑0). No other substantive actions were taken.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] Meeting went into recess approved
4 yea · 2 absent
Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea · Dale Matthews yea · Paul Ybarra absent · Gerald Couri absent
ID#25-02133 — approved
7 yea · 5 absent
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Dale Matthews yea · Shawn Reilly absent · Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02134 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
Thu Sep 4, 2025 · 5:30 PM

Board of Public Works

Board to review and possibly act on Jacobs Engineering contract for Clean Water Plant

The Board of Public Works will approve the minutes from the August 21, 2025 meeting and approve pending payments. It will consider a rebid for the Badger Drive bus wash replacement and several contract items, including the on‑call engineering and operations support contract with Jacobs Engineering for the Clean Water Plant, a roof‑repair contract with OMNIA Partners, and a change order with Zenith Tech for traffic‑signal improvements. The agenda also notes upcoming bid closures for the South Street Parking Ramp structural repairs.

contractsinfrastructurewatertransportationpublic-worksbids
✓ Decided: Board approves $299,000 bus wash replacement and recommends several contracts

The Board of Public Works approved the August 21, 2025 minutes and the scheduled payments. It recommended awarding the $299,000 Badger Drive Bus Wash Replacement bid to Ross and White Company. The Board also recommended three contracts—Jacobs Engineering for the Clean Water Plant, OMNIA Partners for municipal garage roof repair, and Zenith Tech change order for traffic signal improvements—for Council consent. The meeting was adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-02065 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02066 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01679 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02067 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02072 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-02073 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Wed Sep 3, 2025 · 6:00 PM

Landmarks Commission

Waukesha Landmarks Commission reviews historic home exterior changes

The Waukesha Landmarks Commission will review two requests for Certificates of Appropriateness regarding historic home exterior repairs in the College Avenue and Caples Park Historic Districts. The agenda also includes the approval of previous meeting minutes and a discussion of Paint and Repair Grant funds.

landmarkshistoric-districtsexterior-repairswaukeshazoningpublic-hearingscommunity-development
✓ Decided: Landmarks Commission approved a $1,500 paint grant and two historic certificates

The commission unanimously approved the minutes from the August 6, 2025 meeting. It also approved a Certificate of Appropriateness for 202 W. College Ave. and a $1,500 Paint and Repair Grant for the same property. Additionally, a Certificate of Appropriateness for 325 E. Newhall Ave. was approved.

Council Chambers, Floor City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-02071 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-00953 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01579 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-02084 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
Wed Sep 3, 2025 · 6:00 PM

Information Technology Board

IT Board to decide on FireWorks vendor agreement, review 2026 tech projects

The Information Technology Board will consider and act on a service agreement with EPR FireWorks. They will also review and discuss proposed 2026 Capital Improvement Plan items including software, fiber relocation, AV equipment, infrastructure, and workstation replacements. The board will approve June meeting minutes and may enter closed session.

it-boardcontractscapital-improvementpublic-safetytechnologywaukesha
✓ Decided: Board approved agreement with EPR FireWorks (6‑0 vote)

The Information Technology Board approved the June meeting minutes. It also approved the agreement between the City and EPR FireWorks with a unanimous 6‑0 vote. The board reviewed and discussed the 2026 Capital Improvement Program items but took no formal action. The meeting was then adjourned.

City Hall, Training Room
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] Public Comment Paul Fabian, Bob Bruders, Shawn Hansen, Brandon Kostolni, Daniel Manion and Steve Van Trieste Present: 6 - Ryan Corcoran
6 yea · 1 absent
Paul Fabian yea · Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Daniel Manion yea · Steve Van Trieste yea · the City absent
[context] Adjournment
6 yea
Paul Fabian yea · Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-02090 — approved
6 yea · 1 absent
Paul Fabian yea · Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran absent · Daniel Manion yea · Steve Van Trieste yea
ID#25-02137 — approved
6 yea · 1 absent
Paul Fabian yea · Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran absent · Daniel Manion yea · Steve Van Trieste yea
Adjournment — adjourned
6 yea · 1 absent
Paul Fabian yea · Bob Bruders yea · Shawn Hansen yea · Brandon Kostolni yea · Ryan Corcoran absent · Daniel Manion yea · Steve Van Trieste yea
Tue Sep 2, 2025 · 6:00 PM

City Council

Council to vote on sale of 223 S. West Ave. property and multiple land‑use changes

The council will discuss and possibly approve the sale of city‑owned property at 223 S. West Ave. It will also consider land‑use plan amendments and rezoning requests for 1300 & 1240 S. Grand Ave. (Bridge Church) and for 3011 Saylesville Rd. (Momentum Early Learning). Additional items include a resolution to apply for a Wisconsin Economic Development Corporation small‑business grant and reviews of a four‑year cardiac monitor maintenance agreement with Stryker and a fire department training center contract.

property-saleland-userezoninggrantcontracts
✓ Decided: Council approved land use amendment and rezoning for Bridge Church properties

The council approved the minutes from the August 19 meeting and authorized staff to apply for a Wisconsin Economic Development Corporation small‑business grant. It also adopted a land‑use plan amendment and rezoning that changes 1300 and 1240 S. Grand Avenue from commercial to civic/institutional use. Additional actions included returning the revised purchasing policy to committee, approving a comprehensive plan amendment for 3011 Saylesville Road, and voting 8‑7 to stop considering the proposal to make the city attorney an appointed position.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
ID#25-01808 — approved
8 yea · 7 nay
Mike Chrisien nay · Eric Payne yea · Doreen Wigderson yea · Joe Pieper nay · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben nay · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke nay · Rico Camacho yea
ID#25-00799 — approved
12 yea · 3 nay
Mike Chrisien nay · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 9 items passed by unanimous or near-unanimous consent.
🏢 Building at this address: 7 m tall
Wed Aug 27, 2025 · 6:00 PM

Plan Commission

Plan Commission will vote on Bridge Church's 23,720‑sq‑ft addition at 1314 S. Grand Ave

The Waukesha Plan Commission meeting will consider several site plan and conditional use applications. Items include a minor site plan for an electric car charging station at Kwik Trip (2001 Golf Road), a conditional use permit for James Guenther Cigars at 3725 Stillwater Court, and a conditional use permit for a storage container at Café de Arts (830 W. St. Paul Ave). The commission will also review final site plans for Bridge Church (1314 S. Grand Ave) and Carroll University’s Randall Health Science buildout (114 S. Charles St). Decisions will be recorded in the meeting minutes.

zoningdevelopmentarchitecturepermitsplanningcommunity
✓ Decided: Plan Commission approves multiple site plans and permits with conditions

The commission approved the meeting minutes. It approved a conditional use permit for James Guenther Cigars at 3725 Stillwater Court, a storage container permit for Café de Arts at 830 W. St. Paul Avenue, and several site‑plan and architectural reviews—including projects at 830 W. St. Paul Avenue, 1314 S. Grand Avenue, and 114 S. Charles Street—each with conditions. All approvals passed with unanimous votes of the seven members.

Council Chambers, City Hall
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Shawn Reilly, seconded by Member Joan Francoeur, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
ID#25-01701 — approved
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0137 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0138 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0140 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0136 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0141 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
🏢 Building at this address: 6 m tall
Wed Aug 27, 2025 · 1:00 PM

Waukesha Intergovernmental Health Group Advisory Council

Health group to review clinic mid-year utilization data

The Waukesha Intergovernmental Health Group Advisory Council will approve minutes from March 2025 and conduct a mid-year utilization review of the clinic. The meeting is mostly procedural with one substantive business item.

healthclinicutilizationadvisory-councilwaukeshaintergovernmental
Waukesha County Courthouse Training Room | 515 W Moreland Blvd Waukesha, WI 53188
Tue Aug 26, 2025 · 6:00 PM

Finance Committee

Finance Committee to review cardiac monitor maintenance and 2026-2030 budget

The Finance Committee will review a four-year cardiac monitor maintenance agreement with Stryker and the 2026-2030 Community Investment Program. The committee will also consider a Fire Department Training Center contract and an amendment to the Surplus Property Financial Policy.

financebudgethealthcarefire-departmentpolicyfleet
✓ Decided: Finance Committee approves cardiac monitor and fire training contracts

The committee approved the minutes from the August 12 meeting with no objections. It approved a four‑year cardiac monitor maintenance agreement with Stryker and a fire department training center contract, each by a 4‑0 vote. The amendment to the Disposition of Surplus Property Financial Policy was placed on hold for the next meeting, and the 2026‑2030 Community Investment Program budget was presented and discussed.

Waukesha City Garage, 300 Sentry Drive
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Wigderson and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
8 yea
Joe Pieper yea · Elizabeth Moltzan yea · Alicia Halvensleben yea · Doreen Wigderson yea · Joe Pieper yea · Elizabeth Moltzan yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02053 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke absent · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02054 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke absent · Alicia Halvensleben yea · Doreen Wigderson yea
Tue Aug 26, 2025 · 5:00 PM

Public Art Committee

Committee reviews Friedman Alley mural proposals

The Public Art Committee will review proposals for a mural in Friedman Alley, with multiple artist submissions attached for consideration. The committee will also receive an update on the Artscape Placemaking Plan for the Riverwalk and review the 2025-2026 Gallery Art Application.

public-artmuralsarts-commissionplacemakinggallerywaukesha
Training Room, First Floor City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ID#25-02052 — approved
5 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
Mon Aug 25, 2025 · 6:00 PM

Ordinance & License Committee

Committee considers making City Attorney an appointed position

The Ordinance & License Committee will discuss a proposal to change the City Attorney from an elected to an appointed position. The body will also review two liquor license applications.

city-governmentliquor-licensesordinancesappointments
✓ Decided: Committee approved appointing City Attorney and two Class B liquor licenses

The committee approved the August 11, 2025 Ordinance & License minutes by unanimous consent. It approved a Class B beer and liquor license amendment for Compass Groups USA, Inc., and a temporary Class B license for the Corpus Christi Celebration Festival, each with a 4‑0 vote. The committee also approved a proposal to change the City Attorney position from elected to appointed, passing 3‑1. One member was absent for each vote.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Wuteska, seconded by Ald. D. Lemke, to approve the Amendment of Premises Application for Compass Groups USA, Inc "Class B" Beer & Liquor License. The motion carried by the…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Dean D. Lemke yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Temporary Class "B" License Application for Corpus Christi Celebration Page 1City of Waukesha August 25, 2025Ordinance…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Dean D. Lemke yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wuteska, to approve the proposal to make City Attorney an appointed rather than elected position, make recommendation to Common Council. The…
2 yea
Alicia Halvenslaben yea · Dean D. Lemke yea
ID#25-01965 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste absent · Dean D. Lemke yea
ID#25-02048 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste absent · Dean D. Lemke yea
Mon Aug 25, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to review proposed 2026-2030 Parks CIP budget

The Parks, Recreation and Forestry Board will discuss and possibly act on the proposed 2026-2030 Executive Community Investment Program (CIP) Budget for the department. The board will also approve minutes from a previous meeting and hear reports from the President and Director.

parksbudgetciprecreationforestryplanning
✓ Decided: Board approves 2026‑2030 PRF CIP budget recommendation

The Parks, Recreation and Forestry Board approved the July 21, 2025 meeting minutes. The board also approved the discussion and recommendation to the Finance Committee for the 2026‑2030 Executive Community Investment Program budget for the department. Both motions passed unanimously with all seven members voting aye. No other actions were taken.

Training Room, First Floor City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Huemmer, seconded by Yoss, that this Minutes be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Wallner, seconded by Huemmer, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02061 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-02062 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
Thu Aug 21, 2025 · 5:30 PM

Board of Public Works

Board reviews consulting contract for Saratoga Lake Study

The Board of Public Works will approve the minutes from its August 7, 2025 meeting and approve pending payments. It will also discuss and make a recommendation to the City Council on a consulting contract for the Saratoga Lake dredging study. No other substantive actions are listed.

public-worksbudgetcontractswaterenvironment
✓ Decided: Board recommends approving Saratoga Lake study contract with Ayres Associates

The Board of Public Works approved the minutes from the August 7, 2025 meeting and approved pending payments. It voted to recommend the consulting contract with Ayres Associates, Inc. for the Saratoga Lake dredging study. The meeting was then adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-00799 — recommended for approval
4 yea · 1 nay
Kevin Reilly yea · Eric E. Payne nay · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
The other 3 items passed by unanimous or near-unanimous consent.
Thu Aug 21, 2025 · 6:00 PM

Waukesha Water Commission

Emergency declared for water main relocation on Perkins Avenue

The Waukesha Water Commission will vote on declaring an emergency for a water main relocation on Perkins Avenue between Anoka and Arcadian Avenues, authorizing up to $568,000 in costs. They will also approve a developer's agreement with Waukesha Airport Holding for 2781 Aviation Drive and write off $5,248.27 in bankruptcy charges. Additionally, payments from the General and Improvement Funds and a payment for wireless access points at the new Operations Center are on the agenda.

waterutilitiesemergencycontractsfinancedevelopmentoperations
✓ Decided: Commission approved emergency water main contract on Perkins Ave

The Water Commission approved an emergency contract to relocate water services to the 12‑inch main on Perkins Avenue, authorizing up to $23,000 for the work and up to $545,000 for related road reconstruction. The commission also approved routine items including the July voucher payments, a purchase of wireless access points for the new Operations Center, a $5,248.27 bankruptcy write‑off, and a developer agreement for 2781 Aviation Drive. All actions were approved unanimously by the five members present.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
[context] Roll Call approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] ID#25-02027 Approve Minutes from July 17th, 2025 Meeting Meeting Minutes 7-17-25Attachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] ID#25-02028 Approve Payments from the General Fund and the Improvement Fund July Voucher ListAttachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
to Approve Payment of the TDI Vertical InvoiceAttachments: approved
4 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea
to Approve Payment of the TDI Vertical InvoiceAttachments: approved Aye: Joan Francoeur, Jeff Fowle, Gerald Couri, Joe Piatt and Dale Matthews5 - Page 1City of Waukesha August 21, 2025Waukesha Water…
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
to Approve DAAttachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] Memo for Perkins Avenue Water Main EmergencyAttachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
Roll Call — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02027 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02028 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02030 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02031 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02041 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-02051 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
Tue Aug 19, 2025 · 6:00 PM

City Council

Council to vote on rezoning 735 Pleasant St. and approve $350k HVAC contract

The Waukesha City Council will consider several consent agenda items, including a We Energies easement in Merrill Crest Park and renewal applications for three secondhand dealers. New business includes the 2025 budget for the Waukesha Parade Memorial, a contract with Waukesha County for fire and police training use of UW‑Waukesha buildings, and a $350,000 HVAC replacement contract for the municipal garage. A public hearing and subsequent action will address the rezoning of 735 Pleasant St., converting about 5.14 acres from mixed commercial and residential uses to an Institutional district.

zoningutilitiescontractsbudgetpublic-hearinginfrastructure
✓ Decided: Council approves major rezoning and multiple contracts, passes parade budget

The council unanimously approved the 2025 budget for the Waukesha Parade Memorial and a contract with Waukesha County for fire and police training at UW‑Waukesha buildings. It also approved the rezoning of 735 Pleasant St. to an Institutional District and a certified survey map consolidating 13 parcels there. A $350,000 HVAC replacement contract for the municipal garage was approved, while a waiver request for the Von Briesen law firm was rejected. Two bartender/operator license actions were taken, one approval and one denial.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
ID#25-01703 — approved
27 yea · 3 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper nay · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke nay · Rick Lemke nay · Rico Camacho yea · Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-02025 — approved
8 nay · 7 yea
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska nay · Mike Anderson yea · Alicia Halvensleben nay · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho nay
The other 8 items passed by unanimous or near-unanimous consent.
🏢 Building at this address: 1 floors
Mon Aug 18, 2025 · 6:00 PM

Redevelopment Authority

RDA to review affordable housing loans and flood repair eligibility

The Redevelopment Authority will consider loan agreements for two affordable housing projects. The body will also review a temporary change to the Central City Storefront Activation Loan Program to assist with flood-related repairs.

affordable-housingloansflood-recoveryresidential-developmenteconomic-development
✓ Decided: Approved Habitat for Humanity construction loans for Domenica Park subdivision

The Redevelopment Authority approved the minutes from the July 21, 2025 meeting. It approved Habitat for Humanity’s request to receive up to four construction loans for the remaining lots in the Domenica Park subdivision, with the loans staff‑approved. It approved a loan to Duffek Construction/Rise Development for a proposed 36‑unit residential project on the vacant parcel on Meadow Lane (Tax Key No. WAKC0974906) with a 5‑2 vote (two abstentions). It also approved a temporary change to the property eligibility rules of the Central City Storefront Activation Loan Program to support flood‑related repairs.

Training Room, First Floor City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Paul Zinck, seconded by Member Gerald Couri, to approve the loan request by Duffek Construction/Rise Development as proposed. The motion carried by the following vote:
5 yea
Paul Zinck yea · Rick R. Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-02022 — approved
7 yea
Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-02023 — approved
7 yea
Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-02024 — approved with conditions
5 yea · 2 abstain
Mike Duffek abstain · Meena Granado abstain · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-02040 — approved
7 yea
Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
Fri Aug 15, 2025 · 9:00 AM

Administrative Review Appeals Board

Board to review appeal of revoked street‑closing permit for Guitartown event

The Administrative Review Appeals Board will consider an appeal submitted by Norman and Eve Bruce. The appeal challenges the revocation of Street Closing Permit 2025‑5 for the Waukesha Guitartown & Martha Merrell Books Music Special Event, which the Street Uses Panel issued on June 27, 2025. The board may hold a closed session to deliberate the matter before reconvening in open session for any action.

permitsappealseventsclosed-sessioncity-government
Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Adjournment — approved
3 yea · 1 absent
Richard Hanson yea · Charlie Betker absent · Sarah Bondar yea · Megan Lach yea
Reconvene in Open Session — approved
6 yea · 2 absent
Richard Hanson yea · Charlie Betker absent · Sarah Bondar yea · Megan Lach yea · Richard Hanson yea · Charlie Betker absent · Sarah Bondar yea · Megan Lach yea
Closed Session — approved
3 yea · 1 absent
Richard Hanson yea · Charlie Betker absent · Sarah Bondar yea · Megan Lach yea
Thu Aug 14, 2025 · 4:45 PM

Library Board

Board will consider the 2026 Operating Budget for the Waukesha Public Library

The Library Board will review and possibly approve the Community Improvement Plan, the 2026 Operating Budget, and several staff job descriptions and reclassifications. Public comment is limited to three minutes per speaker. The meeting includes reports from the Director, Bridges Library System trustee, and Friends of the Library.

budgetstaffingplanningcommunity-improvementpublic-comment
✓ Decided: Library Board approves 2026 Operating Budget proposal in concept

The board unanimously approved the July and August library bills totaling $147,741.46, the financial report, the Community Improvement Plan, and the 2026 Operating Budget proposal in concept. It also unanimously adopted new service standards and approved a series of staffing and job‑description items, including the Security Guard position and several manager and coordinator roles.

Library Board Room
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-01904 — approved
8 yea · 3 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben absent
ID#25-01912 — approved
8 yea · 3 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben absent
ID#25-01891 — approved
8 yea · 3 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben absent
ID#25-01929 — approved
8 yea · 3 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben absent
Thu Aug 14, 2025 · 4:00 PM

Library Human Resources Committee

Library HR Committee to review multiple job descriptions and staffing positions

The Library Human Resources Committee will review and take possible action on several staff job descriptions and position changes. The meeting includes discussions on a security guard position and a public services library associate regrade.

libraryhuman-resourcesstaffingjob-descriptions
✓ Decided: Committee unanimously approved multiple library staff positions and job descriptions

The Library Human Resources Committee approved the February 13, 2025 meeting minutes and an extended absence request. It also approved the Summer Intern position, the Security Guard position, a regrade for the Public Services Library Associate, and several new job descriptions. All motions passed unanimously.

Library Board Room
Tue Aug 12, 2025 · 6:00 PM

Finance Committee

Finance Committee will vote on revised Purchasing and Bidding policy

The Finance Committee will consider two revised financial policies: the Disposition of Surplus Property policy (F-15.0) and the Purchasing and Bidding policy (F-6.0). Both items are presented for review and action. The committee will decide whether to adopt the proposed changes to each policy.

financepolicypurchasingsurplus-property
✓ Decided: Finance Committee approves revised purchasing policy and minutes

The committee approved the May 27, 2025 Finance Committee minutes with no objections. It approved the revised Financial Policy F‑6.0 Purchasing and Bidding by a unanimous 4‑0 vote. The amendment to the Disposition of Surplus Property Financial Policy was placed on hold for discussion at the next meeting. The next Finance Committee meeting is set for August 26, 2025 at 6:00 pm.

Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Pieper and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
4 yea
Joe Pieper yea · Rick R. Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-02014 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan absent · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Mon Aug 11, 2025 · 4:00 PM

Board of Zoning Appeals

Board of Zoning Appeals to review variance requests for fences and sheds

The Board of Zoning Appeals will consider two dimensional variance appeals regarding property improvements. The board will decide if residents may deviate from zoning codes to install a fence and a shed in restricted yard areas.

zoningvariancesresidential-property
✓ Decided: Board approves two dimensional variances and minutes

The Board of Zoning Appeals approved the July 14, 2025 meeting minutes. It granted Kayla Schneider a dimensional variance to build a solid fence at 1040 W Cumberland Drive. It also granted Lynne Robinson a dimensional variance to build a shed at 606 Rawlins Drive.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Christine D'Angelo, seconded by Bryan Erickson, that this item be approved. The motion carried by the following vote:
7 yea · 1 nay
Christine D'Angelo yea · Bryan Erickson yea · Eric Dunst yea · Kevin Reilly nay · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Eric Dunst yea
ID#25-01727 — approved
3 yea · 1 nay · 1 absent
Christine D'Angelo yea · Kevin Reilly nay · Bryan Erickson yea · Timothy Retic absent · Eric Dunst yea
The other 3 items passed by unanimous or near-unanimous consent.
Mon Aug 11, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews secondhand dealer licenses for three businesses

The Ordinance & License Committee will review and take possible action on several license applications, including secondhand dealer renewals for EcoATM, LLC and Costa's Fine Jewelry & Coins, and a new secondhand dealer application from Watchcircle, LLC. Also on the agenda are approval of previous meeting minutes and invited applications.

licensessecondhand-dealersordinance-and-license-committeewaukesha
✓ Decided: Committee approved three secondhand dealer renewals and two bartender licenses

The Ordinance & License Committee approved the minutes from July 28, 2025 by unanimous consent. It approved a bartender/operator license for Carter Bell (3‑1 vote) and denied a bartender/operator license for Gregory Kasprzak (3‑1 vote). The committee also approved renewal applications for EcoATM, LLC; Costa's Fine Jewelry & Coins; and Watchcircle, LLC, each by a 4‑0 vote.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Van Trieste, to approve the Bartender/Operatore License for Carter Bell. The motion carried by the following vote:
3 yea · 1 nay
Paul Wuteska yea · Alicia Halvensleben yea · Steve Van Trieste yea · Dean D. Lemke nay
ID#25-01703 — recommended for Council Agenda
6 yea · 2 absent · 2 nay
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste yea · Dean D. Lemke nay · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion absent · Steve Van Trieste nay · Dean D. Lemke yea
The other 7 items passed by unanimous or near-unanimous consent.
Thu Aug 7, 2025 · 5:30 PM

Board of Public Works

Board reviews bids for municipal garage HVAC replacement project

The Board of Public Works will approve the July 17, 2025 meeting minutes and recent payments. It will consider the bids received on August 1 for replacing the HVAC system in the municipal garage. The board will also discuss a recommendation to the City Council on purchasing sewer castings for various projects.

public-workshvacsewerbudgetinfrastructure
✓ Decided: Board recommends $350,000 HVAC contract and sewer castings purchase

The Board of Public Works approved the July 17, 2025 meeting minutes and the pending payments. It recommended awarding the municipal garage HVAC replacement contract to Sure‑Fire, Inc. for $350,000 and approved the Ferguson Waterworks quote for sewer castings, both to be sent to Council for consent. The meeting was adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of July 17, 2025, be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Payments be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the low bid from Sure-Fire, Inc., for the Municipal Garage HVAC Replacement project be recommended for approval. The motion…
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, to approve the quote from Ferguson Waterworks for the purchase of sewer castings for manholes and inlets for the various sewer…
4 yea
Kevin Reilly yea · Eric E. Payne yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01677 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-01676 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-01813 — recommended for approval
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
ID#25-01814 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent · Steve Kassens yea · Chad O'Donnell yea
Wed Aug 6, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to review historic district repair grants and certificates

The Landmarks Commission will consider several requests for Certificates of Appropriateness and paint and repair grants for properties in historic districts. The body will also hold an election for a new Chair and Vice Chair.

historic-preservationgrantssolar-panelszoningwaukesha
Council Chambers, Floor City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
ID#25-01720 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01721 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01722 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01723 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01724 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01725 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-00981 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01815 — approved
6 yea · 1 absent
Matt Retzak yea · Mike Chrisien absent · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
Tue Aug 5, 2025 · 6:00 PM

City Council

City Council to approve WisDOT transit operating aid agreements

The Waukesha City Council will review and act on several consent‑agenda items, including Mass Transit and Paratransit operating aid agreements with the Wisconsin Department of Transportation. It will also consider a recreation services contract for the 2025‑26 “Foxtale” 4K program, a city‑wide bike‑pedestrian wayfinding signage contract, and a $92,450 bid for resilient surface installation at Minaka Park. Additional agenda items include public comments, reports from various boards, and a closed‑session segment.

transittransportationcontractspublic-worksparksrecreation
✓ Decided: Council approved water utility easement resolution and park resurfacing contract

The council approved the draft minutes from the July 15 meeting and the consent agenda unanimously. It also approved a resolution to proceed with eminent domain for the Arrowhead Trail water utility easement. Additionally, the council approved a $92,450 low‑bid contract for the Minaka Park resilient surface installation.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Payne, seconded by Ald. R. Lemke, to approve the draft minutes from the July 15th, 2025 Council Meeting. The motion carried by the following vote:
11 yea
Eric Payne yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wigderson, to approve the "Resolution Determining Necessity and Adopting Relocation Order for the Water Utility Easement Eminent Domain…
11 yea
Eric Payne yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
A motion was made by Ald. Payne, seconded by Ald. Halvensleben, to approve the low bid of $92,450.00 from Bluemel's for the 2 color alternate Minaka Park Resilient Surface Installation. The motion…
11 yea
Eric Payne yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
ID#25-01810 — approved
11 yea · 4 absent
Mike Chrisien absent · Eric Payne yea · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan absent · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01692 — approved
11 yea · 4 absent
Mike Chrisien absent · Eric Payne yea · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan absent · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01672 — approved
11 yea · 4 absent
Mike Chrisien absent · Eric Payne yea · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan absent · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews absent · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
Mon Aug 4, 2025 · 5:30 PM

Building and Grounds

Waukesha Building and Grounds to review intersection safety and parking changes

The committee will discuss and potentially take action on several traffic safety improvements and signage updates. The meeting also includes a review of parking restrictions near UW Waukesha and a report on the current budget.

traffic-safetyparkingroadspedestrian-safetysignage
✓ Decided: Building and Grounds meeting canceled due to lack of quorum

The August 4, 2025 Building and Grounds meeting was canceled at 5:50 p.m. because a quorum was not present. No agenda items were voted on or acted upon. The next meeting is scheduled for Monday, October 6, 2025 at 5:30 p.m.

Council Chambers, City Hall
Tue Jul 29, 2025 · 9:00 AM

Board of Review

Board of Review hears 8 property tax objections on July 29

The Waukesha Board of Review will consider objections to property assessments from eight property owners during its July 29 meeting. The board will also approve minutes from its July 11 and July 22 meetings. Hearings are scheduled from 9:00 AM to 1:00 PM and include properties on East Moreland Road, MacArthur, Wisconsin Avenue, and other locations.

property-taxboard-of-reviewassessmentswaukeshacity-council
Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ID#25-01751 — approved
3 yea · 2 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller absent · Sarah Wilke absent · Eric Dunst yea
ID#25-01757 — approved
3 yea · 2 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller absent · Sarah Wilke absent · Eric Dunst yea
ID#25-01793 — approved
3 yea · 2 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller absent · Sarah Wilke absent · Eric Dunst yea
ID#25-01799 — approved
3 yea · 2 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller absent · Sarah Wilke absent · Eric Dunst yea
ID#25-01807 — approved
3 yea · 2 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller absent · Sarah Wilke absent · Eric Dunst yea
Mon Jul 28, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider making city attorney an appointed position

The Ordinance & License Committee will review and act on license applications and discuss a proposal to change the city attorney from an elected to an appointed position. The committee will also approve minutes from the July 14 meeting and hear public comment. The recommendation on the city attorney change will go to the Common Council.

appointmentscity-attorneyelectionslicensesordinancewaukesha
✓ Decided: Committee approved licenses for Metropolitan Antiques, Peter's Pub and Mia's Café

The committee approved the Secondhand Dealer Application for Metropolitan Antiques & Gifts and a Class B beer and liquor license for Peter's Pub LLC, with a unanimous 4‑0 vote. It also approved Mia's Sidewalk Café’s license, conditional on the applicant adding the city as an additional insurer on its liability policy, also by a 4‑0 vote. The applications for invited bartenders Carter Bell and Gregory Kasprzak were not decided; Bell’s application was held for the August 11 meeting and Kasprzak’s was noted as absent and will be re‑invited for the same date. The minutes from the July 14, 2025 meeting were adopted by unanimous consent.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Secondhand Dealer Application for Metropolitan Antiques & Gifts and the "Class B" Beer & Liquor License for Peter's Pub…
3 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve Mia's Sidewalk Cafe contingent upon the applicant providing updated insurance to include the City as an additional insurer…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-01704 — approved
8 yea · 2 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Wed Jul 23, 2025 · 6:00 PM

Plan Commission

Decision on Conditional Use Permit for Maxx Auto Care Plus at 461 W. Sunset Dr.

The Waukesha Plan Commission will hold a public hearing and vote on a Conditional Use Permit for Maxx Auto Care Plus to operate a gas station, convenience store and auto repair shop at 461 W. Sunset Drive in the B-3 General Business District. The commission will also consider several land‑use amendments and rezoning requests, including proposals from Bridge Church and La Casa de Esperanza, as well as final site‑plan reviews for industrial and commercial expansions. Additional items include minor site‑plan approvals and consultation requests for future development projects.

zoningland-usedevelopmentpermitsrezoningpublic-hearing
✓ Decided: Plan Commission approved multiple site plans, rezoning and land‑use changes (all 6‑0)

The Waukesha Plan Commission unanimously approved the meeting minutes and a series of consent‑agenda items. It also approved a conditional use permit for Maxx Auto Care Plus, land‑use plan amendments and rezoning for Bridge Church properties, and several final site plans and rezoning requests for various developers. All votes were 6‑0 with one member absent.

Council Chambers, City Hall
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Reilly, seconded by Member Granger, that the Minutes be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member R.G. Keller, that this item be approved. The motion carried by the following vote:
18 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member Heather Granger, that this item be approved. The motion carried by the following vote:
18 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Member Joan Francoeur, seconded by Member Heather Granger, that this item be approved. The motion carried by the following vote:
18 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member Jennifer Wallner, that this item be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
A motion was made by Mayor Shawn Reilly, seconded by Member Joan Francoeur, that this item be approved. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-01374 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0118 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0119 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0120 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0121 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0122 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0125 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0127 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0128 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0129 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0130 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0131 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0116 — approved
6 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
🏢 Building at this address: 4 m tall
Tue Jul 22, 2025 · 9:00 AM

Board of Review

Board of Review to hear property tax objections

The Waukesha Board of Review will meet to hear objections to property assessments. The meeting is scheduled to begin at 9:00 AM on July 22, 2025, at City Hall.

board-of-reviewproperty-taxwaukeshacity-hallassessment-objections
✓ Decided: Board set new assessment of $972,000 for 1917 Madera St

The Board of Review upheld the assessor’s valuation for ten properties and withdrew one objection. It set a new assessment of $972,000 for 1917 Madera St after finding the owner’s evidence sufficient. All votes were unanimous (4‑0) with one member absent. No motion was recorded for several later objections.

Council Chambers, City Hall
🗳️ How they voted (17 roll-call votes)
Named votes as recorded in the official record.
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 400 S. West Ave. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 2314 N Grandview Blvd. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 2312 N Grandview Blvd. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the property owner’s valuation is reasonable in light of the relevant evidence; and hereby sets the new assessment for the property located at 1917 Madera at: Land: $134,900 Improvements…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 501 Randall St. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 1800 Shepherd Ct. The motion…
8 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea · Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the properties located at 1805 Shepherd Ct, 1804 & 1806…
3 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea
[context] Adjournment
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
Adjournment — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01421 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01422 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01423 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01428 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01512 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01520 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01529 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01537 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
Mon Jul 21, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to vote on city-wide bike-pedestrian wayfinding plan contract

The Parks, Recreation and Forestry Board will discuss and take possible action on several items, including a proposed contract with Damon Farber Landscape Architects for a city-wide bicycle-pedestrian wayfinding/signage plan. Also up for decision are a recreation services contract for the 2025-26 'Foxtale' 4K program with the School District of Waukesha, proposed fall 2025 recreation program fees, revisions to athletic facilities policies, and a stump grinder purchase. Public comment is limited to city residents and taxpayers.

parksrecreationforestrycontractsfeeswayfindingbicyclingpedestrians
✓ Decided: Board approved 2025‑26 Foxtale 4K recreation contract with School District

The Parks, Recreation and Forestry Board approved five items, each with a unanimous 7‑0 vote. The items include a 2025‑26 Foxtale 4K program contract with the School District of Waukesha, a city‑wide bicycle‑pedestrian wayfinding signage contract, the Fall 2025 recreation program fee schedule, revisions to the Athletic Facilities Policies & Procedures handbook, and the purchase of a stump grinder for the fleet. All motions were seconded and carried without opposition.

Council Chambers, City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Johnson, seconded by Huemmer, that this Minutes be approved. The motion carried by the following vote:
6 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Wallner, seconded by Roth, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea · Recreation yea
A motion was made by Johnson, seconded by Huemmer, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Roth, seconded by Schmitz, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Roth, seconded by Ald. Camacho, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Ald. Camacho, seconded by Wallner, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jennifer Wallner yea · Recreation yea
ID#25-01711 — approved
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
ID#25-01710 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
ID#25-01707 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
ID#25-01709 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
PC25-0135 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
ID#25-01708 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells absent · Jennifer Wallner yea · Erica Yoss yea
Mon Jul 21, 2025 · 6:00 PM

Redevelopment Authority

RDA to discuss policy for purchasing property for redevelopment

The Redevelopment Authority will receive an update on its loan programs and discuss guidelines for creating a policy to purchase property for development or redevelopment. No votes on specific projects or contracts are scheduled. The meeting also includes approval of previous minutes and public comment.

redevelopment-authorityloan-programsproperty-purchasepolicy-discussionwaukesha
✓ Decided: Redevelopment Authority approved April 28 minutes unanimously

The Authority approved the minutes from the April 28, 2025 meeting. The motion was made by Gerald Couri, seconded by Alderman Rick R. Lemke, and all five members present voted aye. No other agenda items resulted in a formal decision.

Training Room, First Floor City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Gerald Couri, seconded by Ald. Rick R. Lemke, that the Minutes be approved. The motion carried by the following vote:
5 yea
Meena Granado yea · Rick R. Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
ID#25-01705 — approved
5 yea · 2 absent
Mike Duffek absent · Meena Granado yea · Paul Zinck absent · Rick Lemke yea · Daniel Manion yea · Gerald Couri yea · Jeff Fowle yea
Thu Jul 17, 2025 · 5:30 PM

Board of Public Works

Board to review contract change orders and approve payments

The Waukesha Board of Public Works will review three contract change orders for traffic signal and pump station projects and approve payments for the current period. The agenda also includes bids for a bus wash replacement and municipal garage HVAC work.

public-workscontractsparksinfrastructuretransportationpump-stationsparking-ramp
✓ Decided: Board of Public Works approves multiple contract changes and rejects several project bids

The board approved the June 19, 2025 meeting minutes and rejected bids for the Les Paul Performance Center rebid and South Street Parking Ramp repairs. It recommended awarding the low bid for Minaka Park resurfacing and endorsed three contract change orders for traffic signals, a force main upgrade, and pump station improvements. The board also approved pending payments.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made that the Minutes of June 19, 2025, be approved. The motion was approved by the following vote:
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Joe Pieper, seconded by Ald. Eric Payne, to approve rejecting the bids for the Les Paul Performance Center Improvements - Rebid project. The motion carried by the following…
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01670 — approved
4 yea · 1 absent
Kevin Reilly absent · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01671 — approved
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00894 — approved
4 yea · 1 absent
Kevin Reilly absent · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01672 — recommended for approval
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01673 — approved
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01678 — recommended for Council Consent
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01680 — recommended for Council Consent
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01681 — recommended for Council Consent
4 yea
Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Jul 17, 2025 · 6:00 PM

Waukesha Water Commission

Water Commission considers eminent domain for Arrowhead Trail project

The Waukesha Water Commission will meet to discuss the filling of the vacant Water Utility Manager position. The body is deciding on a relocation order for eminent domain proceedings and a professional services agreement.

water-utilityeminent-domaininfrastructurepersonnelcontracts
✓ Decided: Commission approved eminent‑domain relocation order for Arrowhead Trail project

The Water Commission approved the June voucher payments from the General and Improvement Funds. It adopted a resolution to proceed with an eminent‑domain relocation order for the Arrowhead Trail water‑utility easement and recommended it to the Common Council. The commission also approved a professional services agreement with SmithGroup for diversion implementation and reporting. All actions were approved unanimously.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
[context] ID#25-01690 Approve Minutes from June 19th, 2025 Meeting Meeting Minutes 6-19-25Attachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] ID#25-01691 Approve Payments from the General Fund and the Improvement Fund June Voucher ListAttachments: approved
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
Resolution Determining Necessity and Adopting Relocation Order for the Water Utility Easement Eminent Domain Proceedings" for the Arrowhead Trail project and recommend its passage by the Common…
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
Resolution Determining Necessity and Adopting Relocation Order for the Water Utility Easement Eminent Domain Proceedings" for the Arrowhead Trail project and recommend its passage by the Common…
5 yea
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea
[context] approved
10 yea · 1 absent
Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Paul Ybarra absent
ID#25-01690 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01691 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01692 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01697 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01698 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01693 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
Thu Jul 17, 2025 · 5:30 PM

Transit Commission Meeting

Transit Commission to review 2025 WisDOT operating aid agreements

The Transit Commission will review and act on operating aid agreements with the Wisconsin Department of Transportation for 2025. The body will also consider proposed changes to bus stops.

transitwisdotgrantsparatransitbus-stops
✓ Decided: Transit Commission recommends WisDOT aid agreements and bus stop changes

The commission approved the June 19, 2025 meeting minutes. It recommended the 2025 Mass Transit Operating Aid Agreement with the Wisconsin Department of Transportation for Council consent. It also recommended the 2025 Paratransit Operating Aid Agreement with WisDOT and the proposed bus stop changes, each for Council consent. All motions passed unanimously.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Ald. Joe Pieper, that the Minutes of June 19, 2025, be approved. The motion carried by the following vote:
4 yea
Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Joe Pieper, seconded by Ald. Eric Payne, that the Mass Transit Operating Aid Agreement with Wisconsin Department of Transportation (WisDOT) for 2025 be recommended for…
4 yea
Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Joe Pieper, seconded by Ald. Eric Payne, that the Paratransit Operating Aid Agreement with Wisconsin Department of Transportation (WisDOT) for 2025 be recommended for…
4 yea
Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
A motion was made by Ald. Joe Pieper, seconded by Ald. Eric Payne, that the proposed bus stop changes be recommended for Council Consent. The motion carried by the following vote:
4 yea
Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01674 — approved
4 yea · 1 absent
Kevin Reilly absent · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01213 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly absent · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01214 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly absent · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01675 — recommended for Council Consent
4 yea · 1 absent
Kevin Reilly absent · Eric Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Tue Jul 15, 2025 · 6:00 PM

City Council

Council to consider safety improvements at Sunset Dr and Guthrie Dr

The City Council will vote on consent agenda items including safety improvements at the Sunset Dr and Guthrie Dr intersection, installation of a 'Caution Autistic Child Area' sign at 1531 Magnolia Dr, parking changes on S. Prairie Ave, and a bus-only turn sign at Summit and Grandview. Additionally, the council will consider revisions to the rooming house licensing code (Section 17.10) from the Plan Commission. Reports from various boards and commissions will also be presented.

traffic-safetysignageparkinglicensinghousingplan-commissionconsent-agenda
✓ Decided: Council approved safety improvements at Sunset and Guthrie intersection.

The City Council approved the minutes from the July 1, 2025 meeting. It also approved safety improvements at the Sunset and Guthrie intersection, including the installation of flags. The council adopted revisions to ordinance 17.10 governing rooming‑house licensing. Additionally, the council approved an operator’s license for Stephanie Miller and approved several other establishment applications.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Moltzan, seconded by Ald. Halvensleben, to approve the Minutes from the July 1st, 2025 meeting. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
A motion was made by Ald. Moltzan, seconded by Ald. Wigderson, to approve revisions to 17.10, rooming house licensing. The motion carried by the following vote: Page 2City of Waukesha July 15…
13 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wigderson, to approve Operators License for Stephanie Miller. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
A motion was made by Ald. Halvensleben, seconded by Ald. Wigderson, to approve the applications of various establishments as attached. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea
ID#25-01687 — approved
13 yea · 2 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01550 — approved
13 yea · 2 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01551 — approved
13 yea · 2 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01182 — approved
13 yea · 2 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
Mon Jul 14, 2025 · 4:00 PM

Board of Zoning Appeals

Zoning board to decide on 29-foot setback variance for Skyline Court addition

The Board of Zoning Appeals will hold a public hearing and decide on an appeal from Brian Morrison for a dimensional variance to allow a rear yard setback of 16 feet (required 45 feet) for a house addition at 2910 Skyline Court. The meeting also includes routine items: call to order, roll call, public comment, and approval of prior minutes.

zoningvariancepublic-hearingsetbackwaukesha
✓ Decided: Board approves minutes and grants variance for Skyline Court addition

The Board unanimously approved the April 14, 2025 meeting minutes (ID#25-00999). It also approved Brian Morrison’s appeal for a dimensional variance (ID#25-01000) allowing a rear yard setback of 16 feet for an addition at 2910 Skyline Court, despite the code requirement of 45 feet. Both motions passed with a 5‑0 vote.

Training Room, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Timothy Retic, seconded by Christine D'Angelo, that this item be approved. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
ID#25-00999 — approved
5 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea · Eric Dunst yea
ID#25-01000 — approved
5 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea · Eric Dunst yea
Mon Jul 14, 2025 · 6:00 PM

Ordinance & License Committee

Committee will review and act on invited and other license applications

The Ordinance & License Committee will consider several pending license applications. Items include the invited applications (ID#25-01550) and other applications (ID#25-01551). The committee may approve, deny, or request changes to these applications.

licensingpermitscity-government
✓ Decided: Ordinance & License Committee approved multiple new licenses and minutes

The committee approved the June 23, 2025 meeting minutes. It approved a bartender license for Stephanie Miller. It also approved several other licenses, including a sidewalk café for Crush Wine Bar and various temporary Class B and Class A retail and beverage licenses. All three present members voted aye, while two members were absent.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Van Trieste, seconded by Ald. Manion, to approve the June 23, 2025 Minutes. The motion carried by the following vote:
3 yea
Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Van Trieste, to approve the bartender license application for Stephanie Miller. The motion carried by the following vote:
3 yea
Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Manion, seconded by Ald. Van Trieste, to approve the following licenses: Crush Wine Bar- Sidewalk Café, Latin American Fiesta- Temporary Class “B”/ “Class B” Retailer’s…
3 yea
Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-01549 — approved
3 yea · 2 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-01550 — approved
3 yea · 2 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-01551 — approved
3 yea · 2 absent
Paul Wuteska absent · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Fri Jul 11, 2025 · 8:30 AM

Board of Review

Board of Review considers waivers and hearings for multiple property tax appeals

The Waukesha Board of Review will evaluate waivers of the required 48‑hour notice and waivers allowing owners to bypass the board hearing and appeal directly to the circuit court. It will also consider requests for telephone testimony or written statements. The board will hear objections on several development projects and property tax appeals scheduled throughout the day.

property-taxboard-of-reviewwaivershearingstestimony
✓ Decided: Board approved multiple property waivers and set new assessments for two sites

The Board approved the draft minutes from June 17 and June 24 unanimously. It denied the Abplanalp objection and approved telephone testimony requests for Highlands South and Locklard, each with a 4‑0 vote. The Board approved waivers for several apartment properties, including Sunset, Stone Creek, Riverwalk, 177 Kensington, and LCM Funds, all by a 4‑0 vote. It changed the assessed value of Waukesha Hospitality at 2810 Golf Rd to $11,826,800 total and of Highlands South at 1505 Big Bend Rd to $4,800,000 total, both by a 4‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (47 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Miller, seconded by Dunst, to approve the Board of Review Draft Minutes from 06.17.25. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Miller, seconded by Dunst, to approve the Board of Review Draft Minutes from 06.24.25. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by D'Angelo, seconded by Miller, to approve the denial the Abplanalp Objection submitted on 06.25.25. The motion carried by the following vote:
3 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea
A motion was made by Miller, seconded by Roth, to approve Highlands South LTD request to testify by telephone or sworn written statement. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Miller, seconded by Roth, to approve Locklard Waukesha Holdings request to testify by telephone or sworn written statement. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by D'Angelo, seconded by Miller, to approve the request for waiver for Sunset Apartments, 1512 Big Bend Rd, 1350.989.003. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by D'Angelo, seconded by Miller, to approve the request for waiver for Stone Creek Apartments, 2610 Fielding Ln, 0977.046. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by Miller, to approve the request for waiver for Riverwalk Apartments, 802 Riverwalk Dr, 1307.018.000. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Miller, seconded by Roth, to approve the request for waiver for Riverwalk Apartments, 800 Riverwalk Dr, 1307.018.001. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by Miller, to approve the request for waiver for Riverwalk Apartments, 0 N. Prairie Ave, 1307.018.002. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by Miller, to approve the request for waiver for 177 Kensington, 1800 Kensington Dr, 1329.015. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by Miller, to approve the request for waiver for LCM Funds, 220 W. Main St, 1305.174.001. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 1230 The Strand. The motion…
3 yea
Sarah Roth yea · Leonard Miller yea · Christine D'Angelo yea
A motion was made by Roth, seconded by Dunst, Exercising its judgment and discretion, pursuant to Sec. 70.47(9)(a) of Wis. Statutes, the Board of Review, by majority and roll call vote hereby…
3 yea
Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by Miller, exercising its judgment and discretion, pursuant to Sec. 70.47(9)(a) of Wis. Statutes, the Board of Review, by majority and roll call vote hereby…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 2402 E. Moreland Blvd. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 120 E. Sunset. The motion carried…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
that the Assessor's valuation is reasonable in light of all the relevant evidence; and sustains the same valuation as set by the Assessor for the property located at 720 E. St. Paul. The motion…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
A motion was made by Roth, seconded by D'Angelo, 12:30pm - Willow Park LLP - 1001 Delafield St Exercising its judgment and discretion, pursuant to Sec. 70.47(9)(a) of Wis. Statutes, the Board of…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
Wed Jul 9, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to review paint, repair, and siding grants

The Landmarks Commission is meeting to review grant requests and certificates of appropriateness for properties in historic districts. The body will discuss exterior repairs including painting, roofing, and siding replacements.

historic-preservationgrantshousingwaukesha
✓ Decided: Landmarks Commission approves $2,925 grant and Windsor Dr. roof certificate

The commission approved the meeting minutes with a 4‑aye, 3‑abstain vote. It approved a $2,925 paint and repair grant for 517 Madison St. with unanimous support. It also approved a Certificate of Appropriateness for 406 Windsor Dr., noting future roof‑material review, again unanimously. Other items were held or postponed.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Mike Chrisien, seconded by Member Marty Larson, to approve the minutes as amended. The motion carried by the following vote:
3 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea
ID#25-00978 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01580 — approved
7 yea
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux yea · Tony Lanza yea · Andrea Dorantes yea
ID#25-01581 — approved
4 yea · 3 abstain
Matt Retzak yea · Mike Chrisien yea · Marty Larson yea · Carmen De La Paz yea · Linda Gourdoux abstain · Tony Lanza abstain · Andrea Dorantes abstain
Tue Jul 8, 2025 · 12:00 PM

City Council

City Council holds a workshop meeting with possible quorum present

The City of Waukesha City Council is holding a workshop meeting at City Hall. A possible quorum of Council Members may be in attendance for this session.

city-councilworkshopquorum
Training Room, City Hall
Thu Jul 3, 2025 · 5:30 PM

Board of Public Works

July 3, 2025 Board of Public Works meeting cancelled

The Board of Public Works meeting scheduled for July 3, 2025, has been cancelled. The next meeting is scheduled for Thursday, July 17, 2025.

public-worksscheduling
Council Chambers, City Hall
Tue Jul 1, 2025 · 6:00 PM

City Council

Council to consider sale of city property and firefighter contract

The City Council will meet to decide on several items, including a closed session to discuss the sale of city-owned property at 223 S. West Ave. and a four-year collective bargaining agreement with the firefighter union. Public items include awarding contracts for library HVAC improvements ($394,621) and Horeb Springs retaining wall ($488,906), as well as final action on creating Designated Outdoor Refreshment Areas (DORAs) and increasing penalties for code violations. A certified survey map for Woodman's Food Markets at 1610 E. Main Street is on the consent agenda.

budgetcontractspublic-safetyzoningeconomic-developmenthousinglicensing
✓ Decided: City Council approves fire union contract and major property actions

The council approved several items, including a four‑year collective bargaining agreement with the International Association of Firefighters Local 407, and authorized the sale of the city‑owned property at 223 S. West Ave. It also approved amendments to the real‑property purchase agreement for 4.92 acres on Delafield St, declared that same property surplus, and adopted revisions to municipal codes on outdoor refreshment areas and penalty increases. Additionally, the council accepted low‑bid contracts for library HVAC improvements ($394,621) and the Horeb Springs retaining wall ($488,906).

Council Chambers, City Hall
🗳️ How they voted — 10 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. R. Lemke, seconded by Ald. Halvensleben, to approve the amendment to the real property purchase agreement for 4.92 acres of City owned land on Delafield St. formerly listed…
11 yea · 2 absent · 1 nay
Mike Chrisien yea · Doreen Wigderson yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Dale Matthews nay · Eric Payne absent · Joe Pieper absent
A motion was made by Ald. Halvensleben, seconded by Ald. Wigderson, to approve revisions to Mun Code 11.27 regarding the creation of Designated Outdoor Refreshment Areas, or DORAs. The motion carried…
12 yea · 1 nay
Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Mike Chrisien nay
A motion was made by Ald. Halvensleben, seconded by Ald. Moltzan, to approve the low base bid of $488,906.00 from All-Ways Contractors, Inc. for Horeb Springs Retaining Wall Improvements. The motion…
12 yea · 1 nay
Mike Chrisien yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Rico Camacho yea · Dale Matthews nay
A motion was made by Ald. Halvensleben, seconded by Ald. Wigderson, to approve the sale of city owned property at 223 S. West Ave, and put it out for bids for 30 days, with submitted bids including…
12 yea · 1 nay
Mike Chrisien yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea · Rick R. Lemke nay
A motion was made by Ald. Wigderson, seconded by Ald. Matthews, to approve Four-Year (2025-2028) Collective Bargaining Agreement between the City of Waukesha and the International Association of…
12 yea · 1 nay
Mike Chrisien yea · Doreen Wigderson yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea · Rick R. Lemke nay
ID#25-01538 — approved
11 yea · 2 absent · 1 abstain · 1 nay
Mike Chrisien yea · Eric Payne absent · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste abstain · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01241 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne absent · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea
ID#25-01230 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne absent · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01548 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne absent · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea
ID#25-01025 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien nay · Eric Payne absent · Doreen Wigderson yea · Joe Pieper absent · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
The other 14 items passed by unanimous or near-unanimous consent.
Mon Jun 30, 2025 · 5:30 PM

Building and Grounds

Committee to consider safety improvements at Sunset Dr and Guthrie Dr

The Building and Grounds Committee will discuss and possibly take action on several traffic and safety items, including a safety study for the intersection of Sunset Dr and Guthrie Dr, installation of 'Caution Autistic Child Area' signs at 1531 Magnolia Dr, parking changes on S. Prairie Ave, a bus sign at Summit Ave and Grandview Ave, and an extension of premises for Crush Wine Bar. A speed study on Tenny Avenue and the current budget will also be reviewed.

safetytrafficparkingsignageautismwine-barspeed-studybudget
Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-01380 — approved
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-00897 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-01381 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-01382 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-01383 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-01582 — approved
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
Fri Jun 27, 2025 · 1:00 PM

Street Uses Panel

Hearing on alleged non-compliance with April Street Uses Panel decision

The Street Uses Panel will hold a hearing regarding Norman and Eve Bruce's alleged non-compliance with the Panel's decision of April 25, 2025. The agenda includes a closed session to deliberate the hearing, followed by possible action in open session. The meeting also includes roll call and announcements.

street-uses-panelhearingnon-complianceclosed-sessionwaukeshapublic-hearing
Council Chambers, City Hall
Wed Jun 25, 2025 · 6:00 PM

Plan Commission

GE Health Care seeks approval for 20,000 sq ft addition

The Plan Commission will conduct public hearings on conditional use permits for a bicycle repair home business and a tattoo studio. They will also vote on a major GE Health Care site plan for a 20,000 sq ft addition and 10,000 sq ft renovation, discuss revisions to rooming house licensing, and review a zoning code update on district and use standards.

zoningconditional-use-permitssite-plan-revieweconomic-developmenthousingbusiness-districtspublic-hearing
✓ Decided: Plan Commission approved GE Health Care’s 20,000‑sq ft addition at 3000 N. Grandview Blvd

The commission approved the minutes from the May 28 meeting and passed the consent agenda by unanimous consent. It approved conditional use permits for a bike‑repair shop, a tattoo studio, a trailer‑rental operation, and a neighborhood sign, all with conditions. The final site plan and architectural review for GE Health Care’s 20,000‑sq ft addition and 10,000‑sq ft interior renovation was approved with conditions. The commission also recommended declaring 223 S. West Ave. surplus property.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member R.G. Keller, seconded by Ald. Elizabeth Moltzan, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be recommended for approval. The motion carried by the following vote:
6 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
ID#25-00886 — approved
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-00893 — approved
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0058 — approved with conditions
6 yea · 1 abstain
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger abstain
PC25-0057 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0061 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
PC25-0043 — approved with conditions
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-01182 — recommended for approval
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
ID#25-01386 — recommended for approval
7 yea
Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea · Heather Granger yea
🏢 Building at this address: 4 m tall
Tue Jun 24, 2025 · 9:00 AM

Board of Review

Board of Review hears 14 property assessment objections

The City of Waukesha Board of Review will convene to hear 14 scheduled property tax assessment objections from property owners. The objections cover residential and commercial properties at addresses including White Rock Ave, River Hill Ct, Grandview Blvd, Kilps Dr, and others.

board-of-reviewproperty-taxassessmentsobjectionswaukeshawisconsin
✓ Decided: Board of Review approved ten property tax objections, each 4‑1 vote

The Waukesha Board of Review met on June 24, 2025 with four members present and one absent. The board approved ten property‑tax objections, each with a vote of four in favor and one absent. Several other objections were withdrawn during the meeting. The meeting adjourned at 3:10 p.m.

Council Chambers, City Hall
🗳️ How they voted (21 roll-call votes)
Named votes as recorded in the official record.
[context] Proceed to hear objections, if any and if proper notice / waivers given unless scheduled for another date Roll Call Christine D'Angelo, Sarah Roth, Leonard Miller, and Eric DunstPresent 4 -…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] Proceed to hear objections, if any and if proper notice / waivers given unless scheduled for another date Roll Call Christine D'Angelo, Sarah Roth, Leonard Miller, and Eric DunstPresent 4 -…
8 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea · Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] ID#25-01331 Mattox Objection - 113 Kilps Ct WestAttachments: approved
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] ID#25-01331 Mattox Objection - 113 Kilps Ct WestAttachments: approved Aye: Christine D'Angelo, Sarah Roth, Leonard Miller and Eric Dunst4 - Absent: Sarah Wilke1 - ID#25-01335 Johnson…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] ID#25-01331 Mattox Objection - 113 Kilps Ct WestAttachments: approved Aye: Christine D'Angelo, Sarah Roth, Leonard Miller and Eric Dunst4 - Absent: Sarah Wilke1 - ID#25-01335 Johnson…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] Meeting went into Recess Meeting Reconvened ID#25-01359 Landmark TrustAttachments: Meeting went into Recess Meeting Reconvened Page 2City of Waukesha June 24, 2025Board of Review Meeting…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] Meeting went into Recess Meeting Reconvened ID#25-01359 Landmark TrustAttachments: Meeting went into Recess Meeting Reconvened Page 2City of Waukesha June 24, 2025Board of Review Meeting…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] Meeting went into Recess Meeting Reconvened ID#25-01363 ADH Properties Objection AgendaAttachments: approved
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] Meeting went into Recess Meeting Reconvened ID#25-01363 ADH Properties Objection AgendaAttachments: approved Aye: Christine D'Angelo, Sarah Roth, Leonard Miller and Eric Dunst4 - Absent…
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
[context] approved
4 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Eric Dunst yea
Adjournment — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01309 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01315 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01331 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01335 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01343 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01359 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01360 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01363 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
ID#25-01364 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke absent · Eric Dunst yea
Mon Jun 23, 2025 · 6:00 PM

Ordinance & License Committee

Ordinance & License Committee to review license applications

The committee will meet to review and potentially take action on license applications for various individuals and establishments. The meeting also includes the approval of minutes from June 9, 2025.

licensescity-governmentwaukesha
✓ Decided: Ordinance & License Committee approved eight new or extended licenses

The committee approved the June 9, 2025 minutes by unanimous consent. It then approved eight license applications, including extensions for the Waukesha Eagles Club and The Destination, an adult‑oriented establishment license for City News & Video, taxicab driver and company licenses for Jon Beutler‑Woo and Best Cab, Class B beer & liquor licenses for Quickstop Restaurant and Sal's Pizza, a Class A beer & cider license for Quickstop Gas & Convenience, and a Class B beer, liquor and jukebox combo for Restaurante Casa Noble. The motion carried with five ayes and no nays.

Council Chambers, City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ID#25-01233 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke yea
Thu Jun 19, 2025 · 5:30 PM

Board of Public Works

Board of Public Works to review bids for library and retaining wall projects

The Board of Public Works will review bids for HVAC improvements at the library and retaining wall improvements at Horeb Springs. The board will also consider re-bid submissions for the Les Paul Performance Center. Additionally, the board will note the upcoming bid closing for Minaka Park surface installation.

public-worksinfrastructurebidshvacparks
✓ Decided: Board recommends awarding Library HVAC contract to Lee Mechanical for $394,621

The Board of Public Works approved the June 5, 2025 meeting minutes and the pending payments unanimously. It voted to hold a rebid for the Les Paul Performance Center Improvements. The Board recommended awarding the Library HVAC Improvements low bid to Lee Mechanical Inc. for $394,621 and the Horeb Springs Retaining Wall Improvements low bid to All-Ways Contractors, Inc. for $488,906. It also set a bid closing date of June 27, 2025 for the Minaka Park Resilient Surface Installation project.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ID#25-01227 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01228 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00894 — held
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01229 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-01230 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Thu Jun 19, 2025 · 6:00 PM

Waukesha Water Commission

Waukesha Water Commission to vote on water rate increase application

The Commission will decide on several action items, including an application for a water rate increase per PSC order in docket 6240-WR-111. Other decisions include approving payments, staking and inspection services for two road projects (Fox River Parkway at $30,000 and Greenmeadow at $32,000), fiber relocation for $98,225.25, a professional services contract with Foth for $50,000, insurance renewal, and a cross-connection program. The Commission will also discuss the 2024 draft audited financial statements.

water-ratesinfrastructurecontractspublic-worksutility-improvementsfinancial-audit
✓ Decided: Commission approved multiple contracts totaling over $250,000, including fiber relocation and insurance renewal.

The commission approved the meeting minutes from May 15, 2025. It voted to move forward with an application to request a water‑rate increase as directed by the PSC. The board also approved several contracts: staking and inspection services for Fox River Parkway ($30,000) and Greenmeadow ($32,000), fiber relocation ($98,225.25), a $50,000 professional services contract with Foth Infrastructure, and business insurance coverage for the 2025 policy year.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
Approval of Minutes — adjourned
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01368 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01369 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01370 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01371 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01372 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01373 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01375 — approved
9 absent · 5 yea
Paul Ybarra absent · Joan Francoeur absent · Jeff Fowle absent · Gerald Couri absent · Joe Piatt absent · Dale Matthews absent · Shawn Reilly absent · Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01365 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-01367 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle absent · Gerald Couri yea · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
Thu Jun 19, 2025 · 5:30 PM

Transit Commission Meeting

Commission to vote on 2025 WisDOT operating aid agreements

The Transit Commission will discuss and vote on two operating aid agreements with the Wisconsin Department of Transportation for 2025: one for mass transit and one for paratransit. They will also review the 2024 financial audit presentation. The meeting includes approval of the May 8, 2025 minutes.

transitbudgetwisdotparatransitfinancial-auditoperating-aid
✓ Decided: Transit Commission approved May 8 minutes and held two WisDOT aid agreements

The commission unanimously approved the May 8, 2025 meeting minutes. Both the Mass Transit and Paratransit Operating Aid Agreements with the Wisconsin Department of Transportation for 2025 were held for further action. The meeting was adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ID#25-01212 — approved
5 yea
Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Chad O'Donnell yea · Steve Kassens yea
Thu Jun 19, 2025 · 1:30 PM

Joint Review Board

Waukesha Joint Review Board to review annual TID report

The Joint Review Board will approve minutes from a previous meeting and review the 2024 City of Waukesha Annual TID Report. The meeting is scheduled for June 19, 2025, at City Hall.

governmenttidsfinancewaukesha
Council Chambers, City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ID#25-01237 — approved
3 yea · 2 absent
Dan Budde absent · Darren Clark absent · Kristine Golz yea · Andrew Thelke yea · Shawn Reilly yea
Wed Jun 18, 2025 · 6:00 PM

Human Resources Committee

Consider four-year collective bargaining agreement with Firefighters Local 407

The Human Resources Committee will review and act on proposed position adjustments for the Fleet Services Reorganization in Parks, Recreation and Forestry, and on adding security guard staff at the South Street Ramp. A closed‑session meeting will discuss the 2025‑2028 collective bargaining agreement between the City of Waukesha and International Association of Firefighters Local 407. After the closed session, the committee may take further action on those matters.

human-resourcescollective-bargainingfirefighterslaborsecurity
✓ Decided: HR Committee approved fleet position adjustments and added South St. Ramp security

The committee approved the minutes from the May 21, 2025 meeting by unanimous consent. It approved proposed position adjustments for the Fleet Services Reorganization in Parks, Recreation and Forestry. It also approved adding security guard staff at the South Street Ramp. A motion to move the meeting into a closed session was approved.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Motion by Ald Chrisien, second by Ald Matthews, to approve proposed position adjustments related to the Fleet Services Reorganization in Parks, Recreation and Forestry
3 yea
Doreen Wigderson yea · Dale Matthews yea · Mike Chrisien yea
Motion by Ald Matthews, second by Ald Chrisien, to approve the Addition of Security Guard Staff at the South Street Ramp
3 yea · 1 absent
Doreen Wigderson yea · Dale Matthews yea · Mike Chrisien yea · Paul Wuteska absent
ID#25-01239 — approved
3 yea · 2 absent
Doreen Wigderson yea · Paul Wuteska absent · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
ID#25-01240 — approved
3 yea · 2 absent
Doreen Wigderson yea · Paul Wuteska absent · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
Closed Session — approved
3 yea · 2 absent
Doreen Wigderson yea · Paul Wuteska absent · Mike Anderson absent · Dale Matthews yea · Mike Chrisien yea
Tue Jun 17, 2025 · 6:00 PM

City Council

Council to consider purchase of new police dispatch system and multiple public works contracts

Council will vote on a consent agenda item for a contract with Central Square to purchase an Enterprise CAD System for police dispatch. Other major items include awarding bids for pavement crackfilling ($236,500), used oil collection improvements ($50,180), generator switches ($121,758), and traffic signal improvements ($368,001). The council will also consider code amendments increasing penalties for violations and creating Designated Outdoor Refreshment Areas (DORAs).

policepublic-safetycontractspublic-workstrafficcode-enforcementalcohol
✓ Decided: Council approved key contracts, a 4‑way stop, and updated municipal court fines

The council unanimously approved the amended Municipal Court Bond Schedule and increased the dog‑in‑park fine to $10. It also approved contracts with Brookfield, North Shore Inspections, and Central Square for inspection services and a CAD system, and voted 12‑1 to convert Westowne Ave. and Brad St. to a 4‑way stop. Several public‑works bids were accepted, and board and committee appointments were confirmed.

Council Chambers, City Hall
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Chrisien, to approve contract for trades inspection services with North Shore Inspections, LLC with allowance for the City Attorney's office…
11 yea · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick R. Lemke nay
ID#25-00896 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho yea
ID#25-01235 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke nay · Rico Camacho yea
The other 19 items passed by unanimous or near-unanimous consent.
Tue Jun 17, 2025 · 9:00 AM

Board of Review

Board of Review to consider waiver requests for Walmart, SBV Fox River properties

The Board of Review will consider waiver requests from Walmart and SBV Fox River LLC to bypass the board and appeal property assessments directly to Circuit Court. The board will also hear a series of property tax objections from individual homeowners at scheduled times throughout the day.

board-of-reviewproperty-taxappealswaiverscommercial-propertiesobjectionswaukesha
✓ Decided: Board approved Walmart waiver and multiple property objections

The Board of Review approved the meeting minutes and granted a waiver allowing a Walmart property owner to appeal directly to the Circuit Court. It also approved a separate SBV waiver request and voted to accept a series of property objections, with most votes unanimous and one objection passing with an abstention. The meeting was then adjourned.

Council Chambers, City Hall
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
[context] Approval of Minutes ID#25-01263 BOR Minutes Draft 6.6.2025Attachments: approved
4 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
[context] Request for waiver of the Board of Review hearing allowing the property owner an appeal directly to the Circuit Court ID#25-01243 Walmart WaiverAttachments: approved
4 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
[context] Request for waiver of the Board of Review hearing allowing the property owner an appeal directly to the Circuit Court ID#25-01243 Walmart WaiverAttachments: approved Aye: Christine…
4 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
[context] ric Dunst5 - ID#25-01284 Gitzlaff ObjectionAttachments: Meeting went into Recess Meeting Reconvened approved Aye: Christine D'Angelo, Sarah Roth, Leonard Miller, Sarah Wilke and Eric Dunst5…
3 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea
[context] oved Aye: Christine D'Angelo, Sarah Roth, Leonard Miller, Sarah Wilke and Eric Dunst5 - ID#25-01286 Perez-Amado ObjectionAttachments: Meeting went into Recess Meeting Reconvened approved…
3 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea
[context] e: 4 - Aye: Christine D'Angelo, Leonard Miller, Sarah Wilke and Eric Dunst4 - Sarah RothAbstain: 1 - Abstain: Sarah Roth1 - ID#25-01289 Walker ObjectionAttachments: approved Aye: Christine…
4 yea
Christine D'Angelo yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
Adjournment — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01243 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth absent · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
PC25-0104 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth absent · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01263 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth absent · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01267 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01271 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01275 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01283 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01284 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01285 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01286 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01287 — approved
4 yea · 1 absent
Christine D'Angelo yea · Sarah Roth absent · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01289 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
ID#25-01290 — approved
5 yea
Christine D'Angelo yea · Sarah Roth yea · Leonard Miller yea · Sarah Wilke yea · Eric Dunst yea
Mon Jun 16, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board will consider Minaka Park playground design and extended park hours

The Parks, Recreation and Forestry Board will review a proposed playground design and equipment purchase for Minaka (Woodfield) Park, identified in the 2025 Capital Improvement Program. The board will also discuss a staff request to extend park closing time beyond 11:00 PM for the 2025 Independence Day Celebration and Waukesha Oktoberfest. Minutes from the June 5 meeting will be approved.

parksrecreationplaygroundpark-hourscommunity-events
Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-01216 — approved
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss absent
ID#25-01251 — approved as amended
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss absent
ID#25-01252 — approved
6 yea · 2 absent
Rico Camacho yea · Eric Huemmer yea · Steve Johnson yea · Sarah Roth yea · John Schmitz absent · Jack Wells yea · Jennifer Wallner yea · Erica Yoss absent
Thu Jun 12, 2025 · 4:45 PM

Library Board

Board will review and possibly act on the 2026 Capital Improvement Plan

The Waukesha Library Board meeting will consider several reports and policy reviews, including a discussion of the proposed 2026 Capital Improvement Plan. Board members will also review Library Policy A-5 (Use of Teen Zone) and Policy C-4 (Interlibrary Loan) for possible action. Additional items include updates on the Summer Reading Program, Discovery Layer, and library orientation video.

librarypolicycapital-improvementprogramsreports
✓ Decided: Library Board approved the 2026 Capital Improvement Plan

The board approved the June bills totaling $119,108.84 and the financial report, both with unanimous support. Library Policy A-5 (Use of Teen Zone) and Policy C-4 (Interlibrary Loan) were each approved unanimously. The 2026 Capital Improvement Plan was also approved with all members voting aye.

Library Board Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-01057 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd absent · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben yea
ID#25-01060 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd absent · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben yea
ID#25-01131 — approved
8 yea · 3 absent
Melissa Baxter absent · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd absent · James Sebert yea · Austin Dutter yea · Megan Lach absent · Alicia Halvensleben yea
Mon Jun 9, 2025 · 5:30 PM

Cemetery Commission

Commission to consider a veteran monument and solar‑lit flagpoles at Prairie Home Cemetery

The Waukesha Cemetery Commission will meet on June 9, 2025. The agenda includes approval of the April 7 meeting minutes, a public hearing to review placement of a monument and solar‑lit flagpoles in the veteran section of Prairie Home Cemetery, and the election of a commission president and vice‑president. The commission will also receive reports from the Cemetery Director and other stakeholders and set the next meeting for August 11, 2025.

cemeteryveteransmonumentselectionsreportsmeetings
City Hall Training Room
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
ID#25-00998 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01026 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01028 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01029 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01030 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01032 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
ID#25-01178 — approved
5 yea · 2 absent
Amanda Roddy yea · Don Paul Browne absent · Terry Timm yea · Ed Raether absent · Mike Chrisien yea · Rico Camacho yea · Pat Grulke yea
Mon Jun 9, 2025 · 6:00 PM

Ordinance & License Committee

Ordinance & License Committee to consider code penalty increases and DORA revisions

The committee will review and possibly act on license applications, including invited and renewal requests. It will discuss amendments to Municipal Code sections 11.01 and 25.05 that would increase penalties for certain violations. It will consider revisions to Municipal Code 11.27 to create Designated Outdoor Refreshment Areas. The committee will also review a Full Service Retail Permit application for Steelhead Aleworks LLC.

licensingmunicipal-codepenaltiesoutdoor-refreshmentsretail-permit
✓ Decided: Ordinance & License Committee approved multiple code amendments and permits

The committee approved the May 12 and May 20 meeting minutes by unanimous consent. It approved new license applications, renewal applications, amendments to municipal code penalties, revisions creating Designated Outdoor Refreshment Areas, and a full‑service retail permit for Steelhead Aleworks LLC. All approvals were recorded with vote tallies.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Code sections 11.01 and 25.05, increasing penalties for certain code violations Memo-Amendments to 11.01(10)a and 25.05 Mun Code 11.01(10)(a) Revision Redline Mun Code 25.05 - 2025 Revision…
3 yea · 1 nay
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste nay
ID#25-00873 — approved
3 yea · 1 nay · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste nay · Dean D. Lemke absent
The other 8 items passed by unanimous or near-unanimous consent.
Fri Jun 6, 2025 · 9:00 AM

Board of Review

Waukesha Board of Review to certify assessment roll and hear property objections

The Waukesha Board of Review will meet to certify the annual assessment roll, adopt policies for sworn testimony and hearing waivers, and hear objections from property owners regarding their property assessments.

board-of-reviewassessmentproperty-taxpolicypublic-hearingwaukesha
✓ Decided: Board elected chair, adopted testimony policies, and approved assessment roll

The Board of Review elected Christine D'Angelo as chairperson and Sarah Roth as vice chairperson. It adopted two new policies: one governing sworn telephone or written testimony (PC25‑0066) and another governing waivers of hearing requests (ID#25‑0114). The Board also approved the annual assessment roll with corrections and granted multiple 48‑hour notice waivers and requests to testify by telephone or written statement.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by D'Angelo, seconded by Miller, to approve assessor's value for Kelly Hazard, 1420 Gabriel Drive, Unit 3 (Tax Key: 0998.081). The motion carried by the following vote:
3 yea · 1 nay
Christine D'Angelo yea · Leonard Miller yea · Eric Dunst yea · Sarah Roth nay
ID#25-01160 — approved
3 yea · 1 nay · 1 abstain
Christine D'Angelo yea · Sarah Roth nay · Leonard Miller yea · Sarah Wilke abstain · Eric Dunst yea
The other 25 items passed by unanimous or near-unanimous consent.
Thu Jun 5, 2025 · 5:30 PM

Board of Public Works

Board of Public Works to review bids for city infrastructure and facility improvements

The Board of Public Works will review bids for several city projects and discuss recommendations for the City Council. Key items include infrastructure maintenance and professional service contracts. The board will also consider a sanitary sewer easement agreement.

infrastructurebidsroadssewerspublic-works
✓ Decided: Board recommended awarding six public‑works contracts and adopted 2024 CMAR

The Board approved the May 22 minutes and the pending payments with unanimous votes. It recommended awarding contracts for pavement crackfilling, oil‑collection improvements, fire‑station generator switches, and traffic‑signal upgrades. The Board also recommended the City Council adopt the 2024 WDNR Compliance Maintenance Annual Report and approve an architectural design services contract for the 2025‑2026 CIP.

Council Chambers, City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of May 22, 2025, be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea
A motion was made by Ald. Joe Pieper, seconded by Chairperson Steve Kassens, that the Payments be approved. The motion carried by the following vote:
4 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea
A motion was made by Ald. Eric Payne, seconded by Ald. Joe Pieper, that the low bid from Thunder Road, LLC, for the 2025 Pavement Crackfilling project be recommended for approval. The motion carried…
4 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea
ID#25-00958 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell absent
ID#25-00959 — approved
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell absent
ID#25-00965 — recommended for approval
4 yea · 1 absent
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell absent
ID#25-00967 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00968 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00960 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00961 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00962 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00966 — recommended for approval
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Wed Jun 4, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to review historic property repairs and grant requests

The Landmarks Commission will review several Certificates of Appropriateness for exterior repairs in historic districts. The body will also consider multiple applications for Paint and Repair Grants to fund these restoration projects.

historic-preservationgrantszoninghousing
Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
ID#25-00805 — approved
5 yea · 2 nay
Matt Retzak yea · Aaron Spencer nay · Mike Chrisien nay · Marty Larson yea · Jennifer Wall yea · Julie Scarpace yea · Carmen De La Paz yea
ID#25-00953 — held
6 yea · 1 nay
Matt Retzak yea · Aaron Spencer yea · Mike Chrisien yea · Marty Larson yea · Jennifer Wall yea · Julie Scarpace nay · Carmen De La Paz yea
The other 10 items passed by unanimous or near-unanimous consent.
Tue Jun 3, 2025 · 6:00 PM

City Council

Council will decide 2025 and 2026 Community Development Block Grant allocations

The Common Council will review and vote on the recommended reallocation of the 2025 Community Development Block Grant and adopt the final 2026 CDBG allocation. Several contracts and agreements previously approved by committees—including banner sponsorship with the Wisconsin Army Reserve National Guard, Oktoberfest vendor agreements, and multiple storm‑water management contracts—will be presented for council action. The meeting also includes routine reports from city departments and boards.

budgethousinggrantscontractspublic-worksdevelopment
✓ Decided: Council approved 2026 CDBG allocation and other key measures

The council approved the 2025 Community Development Block Grant (CDBG) reallocation and the 2026 CDBG allocation recommendation, with a 12‑1 vote on the latter. It also approved a waiver of conflict of interest for the Von Briesen law firm, the board and commission appointments, the May 20 meeting minutes, and the consent agenda items. All approvals were by recorded vote.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Moltzan, seconded by Ald. Halvensleben, to approve 2026 CDBG Allocation Recommendation to Common Council. The motion carried by the following vote:
12 yea · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Rick R. Lemke yea · Rico Camacho yea · Steve Van Trieste nay
ID#25-00903 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke absent · Rick Lemke yea · Rico Camacho yea
The other 8 items passed by unanimous or near-unanimous consent.
Tue Jun 3, 2025 · 5:00 PM

Public Art Committee

Committee to review RFPs for Friedman Alley Murals and Riverfront Artscape Plan

The Public Art Committee will consider draft Requests for Proposals for two public art projects: murals in Friedman Alley and a placemaking plan along Riverfront Street. The meeting includes public comment, approval of previous minutes, and setting the next meeting date.

public-artmuralsplacemakingriverwalkrfiwaukesha
Training Room, First Floor City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Adjournment — adjourned
4 yea · 1 absent
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper absent · Elizabeth Moltzan yea
ID#25-00986 — approved
4 yea · 1 absent
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper absent · Elizabeth Moltzan yea
ID#25-00987 — approved
4 yea · 1 absent
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper absent · Elizabeth Moltzan yea
ID#25-00988 — approved
4 yea · 1 absent
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper absent · Elizabeth Moltzan yea
Mon Jun 2, 2025 · 5:30 PM

Building and Grounds

Board to consider converting Westowne & Brad to 4-way stop

The Building and Grounds Committee will discuss and possibly act on several traffic safety measures: converting the intersection of Westowne Avenue and Brad Street to a 4-way stop, safety improvements at Sunset Drive and Guthrie Drive, removal of solar-powered crosswalk signs on Delafield Street, removal of school zone speed limit signs around the old Blair School, and a street closing permit for the Wormburner Golf Outing benefiting Waukesha K9 on June 28. The committee will also approve minutes from the May 5 meeting and review the current budget.

traffic-safetyintersectionscrosswalksschool-zonesstreet-closingsspecial-events
✓ Decided: Council approved a street closing for Wormburner Golf Outing on June 28

The Building and Grounds Committee approved the May 5, 2025 meeting minutes unanimously. It also approved a special‑event permit to close part of Municipal Lot 3 for the Wormburner Golf Outing on June 28 from 2:00 pm to 9:30 pm, with a 5‑0 vote. The committee recommended converting Westowne Ave and Brad St to a four‑way stop (4‑1) and approved removal of solar‑powered crosswalk signs on Delafield St and school‑zone speed limit signs around the old Blair School, each by a 5‑0 vote. The Sunset Dr and Guthrie Dr safety study was held with no action taken.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-00896 — recommended for approval
4 yea · 1 nay
Eric Payne yea · Dean D. Lemke nay · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
The other 5 items passed by unanimous or near-unanimous consent.
Wed May 28, 2025 · 6:00 PM

Plan Commission

Plan Commission to consider 14,000 sq ft roof addition at Waukesha Memorial Hospital

The Plan Commission will hold a public hearing on a conditional use permit for a trailer rental business at 400 S West Avenue. Under consent agenda, they will consider a new aircraft hangar at the airport and a lot consolidation. Business items include final site plan approvals for a hospital roof addition, a second drive-thru at Culver's, restaurant improvements, and a ground-mounted solar array.

plan-commissionpublic-hearingconditional-use-permitsite-planairporthospitalculverssolar-array
✓ Decided: Commission approves hospital roof addition and multiple site plans

The Plan Commission approved the minutes from the April 23 and May 14 meetings unanimously. It approved several final site plans and a certified survey map through a consent agenda, and it tabled a conditional use permit for a trailer rental business. The commission also approved a hospital roof addition, a Culver's drive‑thru expansion, and a solar‑array project.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Mayor Shawn Reilly, seconded by Ald. Elizabeth Moltzan, that this item be approved. The motion carried by the following vote:
6 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea
ID#25-00679 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
PC25-0042 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
PC25-0045 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
PC25-0043 — tabled
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
PC25-0050 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
ID#25-00950 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
PC25-0040 — approved
7 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · Shawn Reilly yea · R.G. Keller yea · Jennifer Wallner yea
Wed May 28, 2025 · 4:30 PM

CDBG

CDBG board to vote on 2025 reallocation and 2026 allocation

The CDBG Board will hear public comment, approve minutes, and receive presentations on multiple grant applications for 2026. The board will then review and take possible action on the 2025 CDBG reallocation recommendation and the final 2026 CDBG allocation recommendation to the Common Council.

cdbgcommunity-developmentgrantswaukeshapublic-workspublic-artbusiness-facade
Training Room, 1st Floor .
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00901 — approved
5 yea · 1 absent
Robert Ford absent · Michael Crowley yea · Emy Llanas Wood yea · Amanda Roddy yea · Mike Anderson yea · Rico Camacho yea
ID#25-00903 — approved
5 yea · 1 absent
Robert Ford absent · Michael Crowley yea · Emy Llanas Wood yea · Amanda Roddy yea · Mike Anderson yea · Rico Camacho yea
ID#25-00902 — approved
5 yea · 1 absent
Robert Ford absent · Michael Crowley yea · Emy Llanas Wood yea · Amanda Roddy yea · Mike Anderson yea · Rico Camacho yea
Tue May 27, 2025 · 6:00 PM

Finance Committee

Committee to review holiday display, contracts, and crossing guard services

The Finance Committee will review and possibly act on the 2025 Walk of Lights holiday display and field services contract, a permanent memorial fund agreement, a HIDTA vehicle lease, and a crossing guard services contract for the 2025-2026 school year.

financecontractsholidaypoliceservicesparade
✓ Decided: Finance Committee approves HIDTA vehicle lease and several community contracts

The Finance Committee approved a grant‑funded vehicle lease for the High Intensity Drug Trafficking Area. It also approved the 2025 Walk of Lights holiday display, the Walk of Lights field services contract, the Waukesha Christmas Parade memorial fund agreement, and the 2025‑2026 school crossing guard services contract. All approvals were unanimous (4‑0). The meeting minutes from April 29 were also approved.

Council Chambers, City Hall
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Pieper and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
8 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea
A motion was made by Lemke and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
4 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea
A motion was made by Moltzan and seconded by Halvensleben that this item be approved. The motion carried by the following vote:
4 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea
A motion was made by Halvensleben and seconded by Moltzan that this item be approved. The motion carried by the following vote:
4 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Alicia Halvensleben yea
ID#25-00778 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson absent
ID#25-00779 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson absent
ID#25-00889 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson absent
ID#25-00947 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson absent
ID#25-00949 — approved
4 yea · 1 absent
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson absent
Thu May 22, 2025 · 5:30 PM

Board of Public Works

Board to review developer agreements for Winterberry Reserve and Rolling Meadows

The Waukesha Board of Public Works will review and possibly act on developer agreements and storm water maintenance agreements for the Winterberry Reserve and Rolling Meadows subdivisions. The board will also approve minutes from the previous meeting and payments.

public-worksdeveloper-agreementsstorm-waterinfrastructurewaukesha
✓ Decided: Board recommended council consent on multiple storm‑water and developer agreements

The Board approved the May 8 minutes and approved pending payments. It recommended council consent for storm‑water management agreements with BLD KDV, VH Winterberry Reserve, Rolling Meadows, and Bielinski Homes, as well as developer agreements with VH Winterberry Reserve and Rolling Meadows. The Board rejected the LaLonde Contractors bid for the Sunset Drive bridge and held the bid for the Les Paul Performance Center improvements.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
ID#25-00890 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00891 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00892 — approved
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00894 — held
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00906 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00907 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00925 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00928 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00931 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
ID#25-00934 — recommended for Council Consent
5 yea
Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea
Wed May 21, 2025 · 6:00 PM

Human Resources Committee

HR Committee to consider Carroll University EMS ride-along agreement

The committee will review and possibly approve an agreement allowing Carroll University health services students to participate in ride-alongs with the Waukesha Fire Department's EMS. It will also enter closed session to discuss the City Administrator's performance review, with possible action afterward.

human-resourcesfire-departmentemscarroll-universitycity-administratorperformance-reviewride-alongwaukesha
✓ Decided: Human Resources Committee approved minutes and a student ride‑along agreement

The committee approved the minutes from the April 16, 2025 meeting. It also approved an agreement allowing Carroll University health‑services students to ride‑along with the fire department EMS. Members voted to enter a closed session and approved the city administrator's goals, evaluation process, and criteria with modifications.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Motion by Ald Anderson, second by Ald Wutseka to approve the minutes of the April 16, 2025 meeting
4 yea
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea
Motion by Ald Chrisien, second by Ald Matthews, to move into closed session
5 yea
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea · evaluation process yea
ID#25-00940 — approved
4 yea · 1 absent
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea · Mike Chrisien absent
ID#25-00636 — approved
10 yea
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea · Mike Chrisien yea · Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea · Mike Chrisien yea
ID#25-00884 — approved
5 yea
Doreen Wigderson yea · Paul Wuteska yea · Mike Anderson yea · Dale Matthews yea · Mike Chrisien yea
Tue May 20, 2025 · 6:00 PM

City Council

Council to award $359,730 bid for Alley 92 Reconstruction

The Waukesha City Council will vote on consent agenda items including a FlexRide transit contract with MobilSE, Inc., an amendment to Wisconsin Transit Lines' service agreement, parking changes, and license renewals. New business includes a presentation on the employee health clinic and a memorandum of understanding for countywide damage assessment. The council will also consider bids for the new Water Utility Operations Center and award a $359,730 contract for Alley 92 Reconstruction.

transitparkingcontractspublic-workswater-utilitylicensesalley-reconstruction
✓ Decided: Council approved $359,730.70 contract to rebuild Alley 92

The council approved the low‑bid contract from Wandel Contractors, Inc. to reconstruct Alley 92 for $359,730.70. It also approved the bid for the new Waukesha Water Utility Operations Center and a Fire Department memorandum of understanding for county‑wide damage assessment. Additionally, the council renewed numerous beer and liquor permits and confirmed board and commission appointments. All votes were 14‑aye, 0‑nay, with one member absent.

Council Chambers, City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Chrisien, to approve the Minutes from the May 6, 2025 meeting. The motion carried by the following vote:
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
A motion was made by Ald. Pieper, seconded by Ald. Halvensleben, to approve the Fire Department Memorandum of Understanding for Countywide Cooperative Damage Assessment. The motion carried by the…
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
A motion was made by Ald. Matthews, seconded by Ald. Halvensleben, to approve the bid for the New Waukesha Water Utility Operations Center. The motion carried by the following vote: Page 3City of…
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
[context] The motion carried by the following vote:
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
A motion was made by Ald. Pieper, seconded by Ald. Payne, to approve the low bid from Wandel Contractors, Inc., in the amount of $359,730.70 for the reconstruction of Alley 92. The motion carried by…
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
A motion was made by Ald. Pieper, seconded by Ald. Payne, to approve Board and Commission Appointments. The motion carried by the following vote:
14 yea
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rico Camacho yea
ID#25-00803 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
ID#25-00791 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
ID#25-00883 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
ID#25-00852 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
ID#25-00941 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
ID#25-00879 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric Payne yea · Doreen Wigderson yea · Joe Pieper yea · Steve Van Trieste yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dale Matthews yea · Dean D. Lemke yea · Rick Lemke absent · Rico Camacho yea
Tue May 20, 2025 · 5:30 PM

Ordinance & License Committee

Ordinance committee to review sidewalk cafe and premise licenses

The Ordinance & License Committee will review and possibly act on various sidewalk cafe and extension of premise license applications. No specific applications are listed in the agenda.

licensessidewalk-cafepremisesordinance-and-license-committee
✓ Decided: Committee approved seven sidewalk café and premise extension applications

The Ordinance & License Committee voted to approve multiple sidewalk café and premise extension requests. Ald. Halvensleben moved, Ald. Manion seconded, and the motion passed unanimously with four votes in favor and one member absent. The approved businesses include BB's on Main, Idyllic Bubble Tea House, Magellan's, Travieso's, Mia's, Salty Toad, and Spring City Wine House.

Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve various Sidewalk Cafe and Extension of Premise Applications including BB's on Main Extension of Premise, Idyllic Bubble Tea…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-00942 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Mon May 19, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to vote on beer contract for Jazz at Cutler Park and Oktoberfest agreements

The board will decide on a beverage service contract with North Pillar Brewing Company for Jazz at Cutler Park, vendor agreements for Oktoberfest, and a special use request for Memorial Day and Veterans Day events. Other items include a We Energies easement at Merrill Crest Park, a Saratoga Lake aquatic plant contract, and a proclamation for July as Parks and Recreation Month. The board will also elect its president, vice president, and secretary.

parksrecreationcontractsveteransjazzoktoberfesteasementslake-management
✓ Decided: Board elected new President and Vice President, approved several event contracts

The Parks, Recreation & Forestry Board approved a special‑use request for Veterans and Cutler Parks, a beverage service contract for Jazz at Cutler Park, a banner‑sponsorship agreement with the Wisconsin Army Reserve National Guard, a proclamation for July as National Parks & Recreation Month, an easement with We Energies for Merrill Crest Park, Oktoberfest vendor agreements, and a Saratoga Lake aquatic‑plant management contract. All motions carried unanimously (7‑0) with one member absent. The board also elected Jennifer Wallner as President and Sarah Roth as Vice President.

Council Chambers, City Hall
🗳️ How they voted (27 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Johnson, seconded by Yoss, that the Minutes be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Johnson, seconded by Ald. Wells, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Recreation yea
A motion was made by Ald. Wells, seconded by Ald. Camacho, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Wallner, seconded by Ald. Wells, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Johnson, seconded by Ald. Camacho, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Ald. Wells, seconded by Roth, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Wallner, seconded by Ald. Camacho, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
A motion was made by Johnson, seconded by Wallner, that this Discussion and Recommendation be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Johnson, seconded by Wallner, that this Matter of Report be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Ald. Wells, seconded by Ald. Camacho, that this Matter of Report be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Ald. Wells, seconded by Yoss, that this Matter of Report be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
A motion was made by Ald. Wells, seconded by Wallner, that this Matter of Report be approved. The motion carried by the following vote:
7 yea
Rico Camacho yea · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Recreation yea
A motion was made by Ald. Wells, seconded by Johnson, that this Matter of Report be approved. The motion carried by the following vote:
14 yea
Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
ID#25-0064 — approved
7 yea · 1 absent
Eric Huemmer absent · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
ID#25-00650 — approved
7 yea · 1 absent
Eric Huemmer absent · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
ID#25-00656 — approved
7 yea · 1 absent
Eric Huemmer absent · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Jack Wells yea · Rico Camacho yea · Jennifer Wallner yea
ID#25-00909 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer absent · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-00911 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer absent · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-00917 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer absent · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
ID#25-00919 — approved
7 yea · 1 absent
Rico Camacho yea · Eric Huemmer absent · Steve Johnson yea · Sarah Roth yea · John Schmitz yea · Jack Wells yea · Jennifer Wallner yea · Erica Yoss yea
Thu May 15, 2025 · 6:00 PM

Waukesha Water Commission

Commission to consider bid for new Water Utility Operations Center

The Waukesha Water Commission will vote on approving a bid for a new Water Utility Operations Center, along with multiple other contracts and change orders. They also will consider payments, staking services for Gascoigne utility improvements, watermain offsets for flood mitigation, and a change order for Contract Package 3/3A. A closed session is scheduled to discuss employee employment, promotion, compensation, and performance data.

water-utilityinfrastructurebudgetcontractsconstructionoperations-centerflood-mitigationemployee-compensation
Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
ID#25-00874 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#24-10982 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#24-10983 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00875 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00877 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00878 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00879 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00880 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-00876 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01006 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
ID#25-01005 — approved
5 yea · 2 absent
Paul Ybarra absent · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri yea · Joe Piatt yea · Dale Matthews yea · Shawn Reilly absent
Wed May 14, 2025 · 6:00 PM

Plan Commission

Plan Commission reviews zoning code district and use standards

The Plan Commission will hold a review and discussion of draft recommendations for the Zoning Code Update, focusing on district and use standards. This is an opportunity for commissioners and council members to provide input. No final votes or decisions are scheduled.

zoningcode-updateplan-commissionland-usepublic-hearing
✓ Decided: Plan Commission reviewed zoning code update and heard staff presentations

The Waukesha Plan Commission met on May 14, 2025 to review the Zoning Code Update (ID#25-00848). Staff presented the district and use standards, and Kari Papelbon from Houseal Lavigne presented zoning standards. No decisions, approvals, or votes were recorded during the meeting.

Council Chambers, City Hall
Tue May 13, 2025 · 6:00 PM

Library Public Art Committee

Committee to discuss public art policy and exterior facade art

The Library Public Art Committee will meet to discuss and take action on the Library Board Public Art Policy. The body will also review the loan of a Gary Gresl piece and plan for a 20th anniversary celebration in September 2025.

public-artlibrarypolicywaukesha
✓ Decided: Committee approved loan of Gary Gresl art piece

The Library Public Art Committee unanimously approved the minutes from February 6, 2025. The Public Art Policy D-4 was unanimously tabled for later consideration. The loan of the Gary Gresl piece was also unanimously approved.

Library Board Room
Mon May 12, 2025 · 6:00 PM

Ordinance & License Committee

Committee will discuss a proposed entertainment district and retail permits

The Ordinance & License Committee will consider a cigarette, tobacco, and electronic vaping device retail license application for Buma Smoke LLC and review other renewal applications. It will discuss the idea of creating an entertainment district in the City of Waukesha. The committee will also consider full‑service retail permit applications for Aspen Sky LLC, Boehm & Hocking LLC, and Raised Grain Brewing Company LLC.

licensingentertainment-districtretail-permitsbusiness
✓ Decided: Committee approved three full-service retail permits

The Ordinance & License Committee approved the April 28 meeting minutes by unanimous consent. It held the Buma Smoke LLC cigarette, tobacco, and electronic vaping device retail license application. The committee approved other renewal license applications with a 4‑0 vote. It also approved full-service retail permit applications for Aspen Sky LLC, Boehm & Hocking LLC, and Raised Grain Brewing Company LLC.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] ID#25-00852 Other Renewal Applications Other Applications- 5.12.25Attachments: approved
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-00852 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-00864 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Thu May 8, 2025 · 4:45 PM

Library Board

Library Board to discuss 2026 budget standards and strategic plan

The Waukesha Library Board will review financial reports and the 2025 calculation for 2026 budget minimum to exempt standards. The board will also receive a strategic plan update and a report on a new collection.

librarybudgetstrategic-planningpublic-services
✓ Decided: Library Board approves minutes, bills, financial report, and proclamations

The board unanimously approved the April 10 meeting minutes. The board approved the bills (ID#25-00714) with a 9‑0 vote. The financial report (ID#25-00718) was approved with a 10‑0 vote. Proclamations to honor Terry Carpenter and to exempt Waukesha County Minimums were also approved unanimously.

Library Board Room
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-00714 — approved
9 yea · 2 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman absent · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
ID#25-00718 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman absent · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Austin Dutter yea · Megan Lach yea · Alicia Halvensleben yea
Thu May 8, 2025 · 5:30 PM

Board of Public Works

Board to open bids for Alley 92 Reconstruction and elect officers

The Board will open bids received for Alley 92 Reconstruction, elect officers for the coming term, approve minutes from the April 17 meeting, and authorize payment approvals. The board will also receive notices of future bids for the Les Paul Performance Center improvements, W. Sunset Drive Bridge sealing and rehabilitation, and Deer Trails and Fox Lake Village pump station improvements.

public-worksbidsalley-92reconstructionelectionspaymentsbridgespump-stations
✓ Decided: Board recommends awarding Alley 92 contract to Wandel Contractors, $359,730.70

The Board of Public Works kept Steve Kassens as Chair and Chad O'Donnell as Vice Chair. It approved the April 17 meeting minutes and the listed payments. The board recommended awarding the Alley 92 contract to Wandel Contractors for $359,730.70. Official notices were posted for several upcoming bids.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-00788 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00789 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00790 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00791 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu May 8, 2025 · 5:30 PM

Transit Commission Meeting

Transit Commission to consider FlexRide contract and bus route amendments

The Waukesha Transit Commission will elect officers and then discuss and recommend action on two key contracts: a proposed FlexRide agreement with MobilSE, Inc. and an amendment to the purchase service agreement with Wisconsin Transit Lines for routes 901, 904, and 905. The commission will also receive reports on an on-demand study and first-quarter 2025 ridership.

transitcontractsridershippublic-transportationwaukesha
✓ Decided: Commission recommends FlexRide contract and transit amendment for council consent

The Transit Commission kept Steve Kassens as Chairman and Chad O'Donnell as Vice Chairman. It approved the March 6, 2025 meeting minutes. The commission recommended the FlexRide contract with MobilSE, Inc. and Amendment 2 to the Wisconsin Transit Lines agreement for council consent. The meeting was then adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Chair Steve Kassens, seconded by Member Kevin Reilly, that the Chairman, Steve Kassens, and Vice Chairman, Chad O'Donnell, remain the same. The motion carried by the following…
4 yea
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Steve Kassens yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of March 6, 2025, be approved. The motion carried by the following vote:
4 yea
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Steve Kassens yea
ID#25-00681 — approved
4 yea · 1 absent
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea
ID#25-00691 — approved
4 yea · 1 absent
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Joe Pieper absent · Steve Kassens yea
ID#25-00683 — recommended for Council Consent
5 yea
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Steve Kassens yea
ID#25-00682 — recommended for Council Consent
5 yea
Chad O'Donnell yea · Kevin Reilly yea · Eric Payne yea · Joe Pieper yea · Steve Kassens yea
Wed May 7, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to decide on roof, windows at historic district home

The Commission will review a Certificate of Appropriateness for 301 Windsor Dr. in the Caples Park Historic District, addressing a request to replace the roof and two windows and tuckpoint the siding. They will also comment on the Architecture/History Investigation of three Waukesha Water Utility facilities and consider an update on adjusting the boundaries for the Senator William and Henrietta Blair House's National Register listing. Additionally, there is an item on Paint and Repair Grant Funds.

landmarkshistoric-districtcertificate-of-appropriatenesswater-utilityblair-housegrantspreservation
Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-00793 — approved
5 yea · 1 absent · 1 abstain
Marty Larson yea · Jennifer Wall yea · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Mike Chrisien abstain
ID#25-00794 — held
6 yea · 1 absent
Marty Larson yea · Jennifer Wall yea · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Mike Chrisien yea
Tue May 6, 2025 · 6:00 PM

City Council

City Council considers $10.9 million in promissory notes

The City Council will review a resolution to authorize the sale of up to $10.9 million in general obligation promissory notes. The body is also considering several public works contracts and a zoning code amendment regarding vote requirements for amendments.

budgetpublic-workszoninginfrastructurecontracts
✓ Decided: Council approved $10.9 million in general‑obligation promissory notes

The council unanimously approved the issuance of up to $10,900,000 in Series 2025A general‑obligation promissory notes. It also repealed the super‑majority voting requirement for zoning amendments and rejected a special charge for a Silvernail Road sidewalk. Additional actions included approving several public‑works contracts, denying a bartender license, and confirming board and commission appointments.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-00784 — approved
11 nay · 4 yea
Mike Chrisien yea · Eric Payne nay · Doreen Wigderson nay · Joe Pieper nay · Steve Van Trieste nay · Jack Wells nay · Daniel Manion nay · Elizabeth Moltzan nay · Paul Wuteska yea · Mike Anderson nay · Alicia Halvensleben nay · Dale Matthews nay · Dean D. Lemke yea · Rick Lemke yea · Rico Camacho nay
The other 9 items passed by unanimous or near-unanimous consent.
Tue May 6, 2025 · 5:00 PM

Public Art Committee

Public Art Committee to discuss Friedman Alley Murals and 2026 CDBG

The Public Art Committee will meet to discuss new business regarding the 2026 Community Development Block Grant and murals for Friedman Alley. The committee will also review minutes from the October 1, 2024 meeting.

public-artmuralsgrantscommunity-development
✓ Decided: Public Art Committee approved 2026 CDBG funding and meeting minutes

The committee approved the minutes from the October 1, 2024 meeting (ID#25-00780) by a unanimous 4‑0 vote. It also approved the 2026 Community Development Block Grant (ID#25-00781), selecting Friedman Alley as the first choice and Riverwalk sculptures/art as the second choice, with a 5‑0 vote. No other decisions were recorded.

Training Room, First Floor City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Curt Otto that the meeting be adjourned. The motion carried by the following vote:
4 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea
ID#25-00780 — approved
4 yea · 1 absent
Rose Lange absent · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
ID#25-00781 — approved
5 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
Adjournment — adjourned
5 yea
Rose Lange yea · Curt Otto yea · Gwenda Helgert yea · Amy Cropper yea · Elizabeth Moltzan yea
Tue May 6, 2025 · 7:30 AM

City Council

City Council to attend Celebrate Waukesha Breakfast

The agenda consists of a single item for the Mayor's Celebrate Waukesha Breakfast. No official city business or legislative actions are listed for decision.

community-event
Tuscan Hall 409 Delafield St. Waukesha, WI 53188
Mon May 5, 2025 · 5:30 PM

Building and Grounds

Building and Grounds to discuss handicap spot removal, 4-way stop

The committee will discuss three parking and traffic proposals: removing a handicap parking spot at Madison and Washington, revising parking on South Charles Street, and converting the Westowne-Brad intersection to a four-way stop. They will also review the current building and grounds budget.

parkingtrafficstreetshandicappublic-worksbudget
✓ Decided: Council approves parking revisions and removes a handicap spot

The Building and Grounds Committee approved the March 31, 2025 meeting minutes. It voted to remove the existing handicap parking spot at the northwest corner of Madison Street and Washington Avenue. It also adopted a new parking plan for the 100 block of South Charles Street, setting no‑parking zones on the west side and 4‑hour limits on the east side. The proposal to convert Westowne Avenue and Brad Street to a 4‑way stop was held for later consideration.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Rick Lemke, seconded by Mike Anderson, to approve the Minutes of March 31, 2025. The motion carried by the following vote:
4 yea
Eric Payne yea · Rick R. Lemke yea · Dale Matthews yea · Mike Anderson yea
A motion was made by Rick Lemke, seconded by Mike Anderson that the existing handicap parking spot in the northwest corner of Madison Street and Washington Avenue be removed. The motion carried by…
4 yea
Eric Payne yea · Rick R. Lemke yea · Dale Matthews yea · Mike Anderson yea
A motion was made by Rick Lemke, seconded by Dale Matthews, that there would be no parking on the west side S. Charles Street from E. College Avenue to the north property line of 140 S. Charles…
4 yea
Eric Payne yea · Rick R. Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-00670 — approved
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-00671 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
ID#25-00672 — recommended for Council Consent
4 yea · 1 absent
Eric Payne yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Mike Anderson yea
Tue Apr 29, 2025 · 6:00 PM

Finance Committee

Finance Committee to consider $10.9M borrowing for capital projects

The committee will hear a presentation on the city's proposed 2025 borrowing to support the Capital Improvement Plan, then vote on a resolution authorizing the issuance of up to $10.9 million in general obligation promissory notes. They will also consider a $320,000 carryover from 2024 to 2025 for the Water Softener Rebate Program and review fund capital carryovers from 2024 to 2025.

financeborrowingcapital-improvementswater-softener-rebatebudgetcarryover
✓ Decided: Finance Committee approves $320K water fund carryover and $10.9M bond issuance

The committee approved the April 8, 2025 meeting minutes without objection. It voted to carry over $320,000 from 2024 to 2025 in the Clean Water Plant Fund to fund the Water Softener Rebate Program. It also approved a resolution authorizing up to $10,900,000 in general‑obligation promissory notes for 2025.

Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-00677 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
ID#25-00678 — approved
5 yea
Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Alicia Halvensleben yea · Doreen Wigderson yea
Mon Apr 28, 2025 · 6:00 PM

Redevelopment Authority

RDA to consider $50K Habitat for Humanity home repair loan

The Redevelopment Authority will hear an update on its loan programs and vote on two Habitat for Humanity requests: construction loans for two lots at Domenica Park Subdivision and a $50,000 Affordable Housing Rehabilitation grant for critical home repairs.

affordable-housingloanshabitat-for-humanityredevelopmenthousing-rehabilitation
✓ Decided: Authority approves housing loan requests and adopts prior meeting minutes

The Redevelopment Authority approved the minutes from the December 16, 2024 meeting. It approved Habitat for Humanity's request for construction loans for Lots 1 and 13 at the Domenica Park Subdivision. It also approved a $50,000 request from Habitat for Humanity for its Home Preservation Program for critical home repairs. All three motions passed unanimously (5‑0) with one member absent.

Training Room, First Floor City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Gerald Couri, seconded by Member Meena Granado, that the Minutes be approved. The motion carried by the following vote:
5 yea
Gerald Couri yea · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick R. Lemke yea
A motion was made by Member Gerald Couri, seconded by Member Paul Zinck, that this item be approved. The motion carried by the following vote:
5 yea
Gerald Couri yea · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick R. Lemke yea
A motion was made by Member Paul Zinck, seconded by Member Gerald Couri, that this item be approved. The motion carried by the following vote: Page 1City of Waukesha April 28, 2025Redevelopment…
5 yea
Gerald Couri yea · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick R. Lemke yea
ID#25-00667 — approved
5 yea · 1 absent
Gerald Couri yea · Dan Budde absent · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea
ID#25-00668 — approved
5 yea · 1 absent
Gerald Couri yea · Dan Budde absent · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea
ID#25-00669 — approved
5 yea · 1 absent
Gerald Couri yea · Dan Budde absent · Mike Duffek yea · Meena Granado yea · Paul Zinck yea · Rick Lemke yea
Mon Apr 28, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews liquor and bartender license applications

The Ordinance & License Committee will meet to review several license applications. The body is considering bartender and liquor license requests for specific individuals and businesses.

licensesliquor-licensebusiness-permits
✓ Decided: Committee denied bartender license for Maureen Delgadillo.

The Ordinance & License Committee approved several license applications and denied one. The bartender license for Maureen Delgadillo was denied by a vote of three aye, one absent, and one abstain. Approvals included a bartender license for Melissa Corrigan, a Class B beer and Class C wine license for Mama Ducky's Desserts, a successor of agent for Walgreens #07730, and private alarm system licenses for ADT and Interface Security Systems LLC, each passing with four aye votes and one absent member.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Manion, seconded by Ald. Halvensleben, to approve the denial of the Bartender License Application for Maureen Delgadillo. The motion carried by the following vote:
3 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Dean D. Lemke absent
A motion was made by Ald. Halvensleben, seconded by Ald. Wuteska, to approve the Bartender Application for Melissa Corrigan. The motion carried by the following vote:
3 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve Mama Ducky's Desserts Class "B" Beer and "Class C" Liquor (wine only) License Application. The motion carried by the…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Halvensleben, seconded by Ald. Manion, to approve the Successor of Agent for Walgreens #07730. The motion carried by the following vote:
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
A motion was made by Ald. Wuteska, seconded by Ald. Halvensleben, to approve the Private Alarm System License Applications for ADT and Interface Security Systems LLC. The motion carried by the…
4 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea
ID#25-00620 — denied
3 yea · 1 abstain · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste abstain · Dean D. Lemke absent
ID#25-00658 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-00659 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-00662 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
ID#25-00665 — approved
4 yea · 1 absent
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Steve Van Trieste yea · Dean D. Lemke absent
Fri Apr 25, 2025 · 5:00 PM

Open Meeting

Street Uses Panel to consider objection to bookstore event permit

The Street Uses Panel will review an objection to Martha Merrell's Bookstore's application for a Special Event and Street Closure permit. The meeting includes only this agenda item and adjournment.

street-usespecial-event-permitpermitsbookstorewaukesha
Council Chambers, City Hall
Wed Apr 23, 2025 · 6:00 PM

Plan Commission

Plan Commission to vote on conditional use for heavy truck repair at 411 Travis Lane

The Plan Commission will hold a public hearing and then vote on a conditional use permit for Olender Truckworx LLC to operate a heavy truck and trailer repair and sales business at 411 Travis Lane in the M-2 General Manufacturing District. The commission will also review a minor site plan to replace deteriorating exterior stucco at the medical building at 1111 Delafield Street. Approval of the March 26, 2025 minutes is on the agenda.

plan-commissionconditional-use-permitcommercial-developmentsite-plan-reviewwaukesha
✓ Decided: Plan Commission approves two development permits with conditions

The commission approved the minutes from the March 26, 2025 meeting. It approved a conditional use permit for Olender Truckworx LLC at 411 Travis Lane in the M‑2 General Manufacturing District, with conditions. It also approved a minor site plan and architectural review for Remedy Medical Properties at 1111 Delafield Street in the B‑4 Office and Professional Business District, with conditions. All three approvals passed with six votes in favor and one member absent.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Joan Francoeur, seconded by Ald. Elizabeth Moltzan, that the Minutes be approved. The motion carried by the following vote:
5 yea · 1 absent
Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea · Jack Wells absent
A motion was made by Mayor Shawn Reilly, seconded by R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Member R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
6 yea
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea
ID#25-00551 — approved
5 yea · 1 abstain · 1 absent
Corey Montiho abstain · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea
PC25-0038 — approved with conditions
6 yea · 1 absent
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea
PC25-0037 — approved with conditions
6 yea · 1 absent
Corey Montiho yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells absent · Shawn Reilly yea · R.G. Keller yea · John Schmitz yea
🏢 Building at this address: 5 m tall
Mon Apr 21, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board meeting canceled; pending reviews of park event requests and contracts

The Parks, Recreation and Forestry Board meeting scheduled for April 21, 2025 was cancelled. The agenda listed several items that would have been considered, including a special use request for Memorial Day and Veterans Day events at Veterans and Cutler Parks, a beverage service contract for the 2025 Jazz at Cutler Park events, an agreement for sponsorship banner posting with the Wisconsin Army Reserve National Guard, a distribution easement with We Energies for an underground line in Merrill Crest Park, and a proclamation declaring July as National Parks & Recreation Month.

parkseventscontractseasementproclamation
Council Chambers, City Hall
Thu Apr 17, 2025 · 5:30 PM

Board of Public Works

Board to consider contract amendment for biogas purification and sludge drying project

The Board of Public Works will consider resolutions, review bids, and act on several contracts and agreements. Notable items include bids for Greenmeadow Drive/Cascade Drive utility and street improvements, Frame Park formal gardens pathway improvements, and Les Paul Performance Center improvements; a contract amendment for the Biogas Purification and Sludge Drying project; and a change order for pump station improvements.

public-worksinfrastructurebidscontractsstreetsparksbiogascapital-projects
Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
ID#25-00623 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00624 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00625 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00626 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00627 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00629 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00630 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00633 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00634 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00631 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu Apr 17, 2025 · 6:00 PM

Waukesha Water Commission

Commission considers over $2.5 million in water main replacement contracts

The Waukesha Water Commission will vote on two utility and street improvement contracts and a developer's agreement for the Winterberry Reserve Development. The body will also review the 2025 utility performance report and March financial reports.

water-utilityinfrastructurecontractsdevelopmenteasements
✓ Decided: Commission ratifies $1.6M water main contract with LaLonde Contractors

The Waukesha Water Commission approved the March 20 minutes and March payment vouchers unanimously. It ratified a $1,604,732.52 water main replacement contract with LaLonde Contractors and approved a $943,141.21 contract with Wandel Contractors. The commission also approved a revised easement with WE Energies at the Crestwood Pump Station and a developer agreement for Phase 1 of the Winterberry Reserve project.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
[context] ID#25-00638 Approve Minutes of March 20,2025 Meeting 03 2025 Meeting MinutesAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea · Shawn Reilly yea
[context] ID#25-00639 Approve Payments from the General Fund and the Improvement Fund March VouchersAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea · Shawn Reilly yea
[context] Post Bid Memo_GascoigneAttachments: approved
4 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea
[context] Post Bid Memo_Green MeadowAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea · Shawn Reilly yea
to Approve EasementAttachments: approved
4 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Joe Piatt yea · Shawn Reilly yea · Gerald Couri absent · Dale Matthews absent
to Approve DAAttachments: approved
5 yea
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Joe Piatt yea · Shawn Reilly yea
ID#25-00638 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-00639 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-00640 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-00641 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-00642 — approved
4 yea · 2 absent · 1 abstain
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle abstain · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
ID#25-00643 — approved
5 yea · 2 absent
Paul Ybarra yea · Joan Francoeur yea · Jeff Fowle yea · Gerald Couri absent · Joe Piatt yea · Dale Matthews absent · Shawn Reilly yea
Wed Apr 16, 2025 · 6:00 PM

Human Resources Committee

City Administrator performance review considered in closed session

The Human Resources Committee will approve the minutes from the February 19, 2025 meeting. It will then convene a closed session to discuss the City Administrator’s performance review and related employment matters. After the closed session, a motion may be made to reconvene in open session to consider any actions. The meeting will conclude with adjournment.

human-resourcesperformance-reviewcity-administratorclosed-sessionminutes
✓ Decided: Human Resources Committee approved minutes and entered closed session

The committee unanimously approved the minutes from the February 19, 2025 meeting. It also unanimously moved the discussion on the City Administrator’s performance review into a closed session. No other substantive actions were taken.

Council Chambers, City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ID#25-00637 — approved
3 yea
Mike Chrisien yea · Doreen Wigderson yea · Mike Anderson yea
ID#25-00636 — approved
3 yea
Mike Chrisien yea · Doreen Wigderson yea · Mike Anderson yea
Tue Apr 15, 2025 · 6:00 PM

City Council

Council to hold public hearing on rezoning for Operation Finally Home homes

The City Council will hold a public hearing and consider rezoning 0.61 acres on Big Bend Road from T-1 to Rs-3 for two new homes for Operation Finally Home. Also up for action are several contracts including AT&T phone services renewal, a mowing contract, and a WEDC grant. The council will also elect a Council President and receive an update on the 2025 citywide revaluation.

zoningpublic-hearingcontractsroadsveteranshousingbudget
✓ Decided: Council approved rezoning of 22.2‑acre Winterberry Reserve to a PUD overlay

The Common Council approved a rezoning of 22.196 acres at Winterberry Reserve to a Rs‑3 single‑family residential district with a Planned Unit Development overlay (12‑1 vote). It also approved the rezoning of 0.61 acres on Big Bend Road from T‑1 to Rs‑3 (13‑0 vote). The council elected Ald. Alicia Halvensleben as President unanimously and approved United Way eligibility for five years (13‑0 vote).

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Halvensleben, seconded by Ald. R. Lemke, to approve Rezoning Rs-3 PUD Single Family Residential with a Planned Unit Development Overlay District, Winterberry Reserve…
12 yea · 1 nay
Mike Chrisien yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Rick R. Lemke yea · Dale Matthews yea · Rico Camacho yea · Steve Van Trieste yea · Eric E. Payne nay
PC25-0012 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric E. Payne nay · Doreen Wigderson yea · Joe Pieper yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke absent · Rick Lemke yea · Dale Matthews yea · Rico Camacho yea · Steve Van Trieste yea
The other 31 items passed by unanimous or near-unanimous consent.
Mon Apr 14, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews liquor and bartender license applications

The Ordinance & License Committee will meet to review several license applications. The body is considering a liquor license for Mayor's Restaurant and bartender applications for two individuals.

licensesliquor-licensealcohol-sales
✓ Decided: Committee approves several liquor licenses, bartender apps and renewals

The Ordinance & License Committee approved the Mayor's Restaurant Class B beer and liquor license and a bartender application for Destiny Lares. It also approved Magellan's Sidewalk Cafe application pending engineering comments and a comprehensive list of license renewals. The bartender application for Maureen Delgadillo was withheld for the next meeting. The March 24, 2025 committee minutes were approved by unanimous consent.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00615 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00616 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00617 — approved
10 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea · Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Mon Apr 14, 2025 · 4:00 PM

Board of Zoning Appeals

Appeal for setback variance at 534 Grove Street

The Board of Zoning Appeals will hold a public hearing and decide on an appeal for a dimensional variance at 534 Grove Street. The variance would allow a detached garage with a setback of less than 1 foot from the lot line, instead of the required 5 feet. The meeting also includes approval of previous minutes and public comment.

zoningvariancesetbackpublic-hearingwaukesha
✓ Decided: Board approves dimensional variance for detached garage at 534 Grove St

The Board of Zoning Appeals approved the March 10, 2025 meeting minutes. It also granted a dimensional variance allowing a detached garage with a setback of less than 1 foot at 534 Grove Street. Both motions passed unanimously with a 4‑0 vote. The meeting was then adjourned.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Christine D'Angelo, seconded by Kevin Reilly, that the Minutes be approved. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
A motion was made by Christine D'Angelo, seconded by Timothy Retic, that this item be approved. The motion carried by the following vote:
4 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
A motion was made by Kevin Reilly, seconded by Christine D'Angelo, that the meeting be adjourned. The motion carried by the following vote:
3 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea
Adjournment — approved
4 yea · 1 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
ID#25-00518 — approved
4 yea · 1 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
ID#25-00519 — approved
4 yea · 1 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic yea
Thu Apr 10, 2025 · 4:45 PM

Library Board

Library board to discuss allowable costs for 2026 budget

The Waukesha Library Board will consider approval of minutes, financial reports, and several new business items including a National Library Week proclamation, allowable costs for the 2026 budget, a teen summer internship grant, and potential changes to IMLS funding. Board education on the Book Bike program and reports from committees and the director are also on the agenda.

librarybudgetgrantsteen-internshipnational-library-weekimlsbook-bike
✓ Decided: Board approved April bills totaling $259,872.32

The Library Board approved the April bills for $259,872.32 with a 10‑0 vote. It also approved the financial reports, the 2026 allowable‑costs budget form, a teen summer internship grant, a letter on IMLS funding changes, and several proclamations and education items, all unanimously.

Library Board Room
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Bills — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Financial Reports — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Tue Apr 8, 2025 · 6:00 PM

Finance Committee

Finance Committee to review grant and service contracts

The Finance Committee will review and act on agreements with the Waukesha County Center for Growth and the Wisconsin Economic Development Corporation. The body will also consider contracts for mowing services and fund transfers for the Prairie Home Cemetery.

contractsgrantscemeteryeconomic-developmentmaintenance
✓ Decided: Finance Committee approved contracts and cemetery fund withdrawals

The committee approved the February 25 meeting minutes without objection. It unanimously approved five items: an agreement with the Waukesha County Center for Growth, a mowing services contract, a grant contract with the Wisconsin Economic Development Corporation, and two withdrawals from trust funds to the Prairie Home Cemetery operating fund. All motions passed with a 4‑0 vote.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Pieper and seconded by Moltzan that this item be approved. The motion carried by the following vote:
4 yea
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea
A motion was made by Moltzan and seconded by Lemke that this item be approved. The motion carried by the following vote:
4 yea
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea
A motion was made by Pieper and seconded by Bartels that this item be approved. The motion carried by the following vote:
12 yea
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea · Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea
ID#25-00313 — approved
4 yea · 1 absent
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Frank McElderry absent
ID#25-00355 — approved
4 yea · 1 absent
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Frank McElderry absent
ID#25-00598 — approved
4 yea · 1 absent
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Frank McElderry absent
ID#25-00599 — approved
4 yea · 1 absent
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Frank McElderry absent
ID#25-00548 — approved
4 yea · 1 absent
Peter Bartels yea · Joe Pieper yea · Elizabeth Moltzan yea · Rick Lemke yea · Frank McElderry absent
Mon Apr 7, 2025 · 5:30 PM

Cemetery Commission

Consideration of $56,844 Endowment Trust withdrawal for cemetery operations

The Cemetery Commission will consider two trust fund withdrawals: $1,658.67 from the Perpetual Care Trust and $56,844.22 from the Endowment Trust to fund Prairie Home Cemetery operations. They will also approve minutes from the December 2024 meeting and receive reports from the Cemetery Director and Friends of Prairie Home Cemetery.

cemeterytrust-fundsoperating-budgetprairie-home-cemetery
City Hall Training Room
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Adjournment — adjourned
7 yea
Pat Grulke yea · Amanda Roddy yea · Mike Chrisien yea · Cory C. Payne yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea
ID#25-00601 — approved
7 yea
Pat Grulke yea · Amanda Roddy yea · Mike Chrisien yea · Cory C. Payne yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea
ID#25-00603 — approved
7 yea
Pat Grulke yea · Amanda Roddy yea · Mike Chrisien yea · Cory C. Payne yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea
ID#25-00604 — approved
7 yea
Pat Grulke yea · Amanda Roddy yea · Mike Chrisien yea · Cory C. Payne yea · Don Paul Browne yea · Terry Timm yea · Ed Raether yea
Thu Apr 3, 2025 · 6:00 PM

City Council

Council to consider TIF aid for Mandel Group's Delafield St. project and $7.3M resurfacing

The Waukesha City Council will review a term sheet for TIF assistance to Mandel Group for a development at 130, 200, and 318 Delafield St., and vote on a $7,298,487.54 street resurfacing contract with Payne & Dolan, Inc., plus a $1,942,624 flood mitigation contract. The consent agenda includes multiple parks and recreation contracts, a certified survey map for a Starbucks at 101 W. Sunset Drive, and liquor licenses for Gyro House and Dollar General. A closed session is scheduled for the city administrator's performance review.

developmentbudgetcontractsflood-mitigationstreetslicensesparkstif
✓ Decided: City Council approved $7.3M asphalt resurfacing contract

The council approved a $7,298,487.54 contract with Payne and Dolan, Inc. for 2025 street resurfacing and utility improvements. It also approved a $1,942,624 flood‑mitigation contract, a TIF assistance term sheet for the Mandel Group, and several service contracts. A bartender license application was rejected. All approvals were by unanimous or near‑unanimous vote.

Council Chambers, City Hall
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Pieper, seconded by Bartels, to approve the term sheet outlining TIF assistance to Mandel Group related to the proposed project at 130, 200 and 318 Delafield St. The motion…
9 yea · 1 nay
Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Peter Bartels yea · Mike Chrisien nay
A motion was made by Ald. Wuteska, seconded by Ald. Halvensleben, to approve the Bartender Application for Joseph A. Porter. The motion failed by the following vote: Page 6 City of Waukesha April 3…
5 yea · 5 nay
Doreen Wigderson yea · Daniel Manion yea · Paul Wuteska yea · Alicia Halvensleben yea · Dean D. Lemke yea · Mike Chrisien nay · Joe Pieper nay · Elizabeth Moltzan nay · Rick R. Lemke nay · Peter Bartels nay
A motion was made by Ald. R. Lemke, seconded by Ald. Halvensleben, to approve the increase in the City Administrators salary at 4%, retroactive to January 1, 2025 with no other changes to the…
8 yea · 2 nay
Mike Chrisien yea · Doreen Wigderson yea · Joe Pieper yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Alicia Halvensleben yea · Rick R. Lemke yea · Dean D. Lemke nay · Peter Bartels nay
ID#25-00556 — approved
9 yea · 4 absent · 2 nay
Mike Chrisien nay · Eric E. Payne absent · Doreen Wigderson yea · Joe Pieper yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dean D. Lemke yea · Rick Lemke yea · Frank McElderry nay · Peter Bartels yea · Cory C. Payne absent
ID#25-00531 — approved
6 nay · 5 yea · 4 absent
Mike Chrisien nay · Eric E. Payne absent · Doreen Wigderson yea · Joe Pieper nay · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dean D. Lemke yea · Rick Lemke nay · Frank McElderry nay · Peter Bartels nay · Cory C. Payne absent
ID#25-00573 — approved
9 yea · 4 absent · 2 nay
Mike Chrisien yea · Eric E. Payne absent · Doreen Wigderson yea · Joe Pieper yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson absent · Alicia Halvensleben yea · Dean D. Lemke nay · Rick Lemke yea · Frank McElderry yea · Peter Bartels nay · Cory C. Payne absent
The other 16 items passed by unanimous or near-unanimous consent.
Thu Apr 3, 2025 · 5:30 PM

Board of Public Works

Board to vote on special charge for Silvernail Road sidewalk installation

The Board of Public Works will consider a resolution to install sidewalks along Silvernail Road from Sussex Lane to University Drive, funded by a special charge on affected properties. They will also review bids for multiple capital projects, including city-wide asphalt repairs, Clean Water Plant Phase 3 improvements, and Gascoigne Drive utility work. Additionally, the board will discuss a contract for roof rehabilitation at the Schuetze Recreation Center through the OMNIA Partners cooperative.

sidewalksinfrastructurebidspublic-workscontractsroadsparkscemeteries
✓ Decided: Board directs Silvernail Rd sidewalk plan and recommends multiple project contracts

The board approved the March 20, 2025 minutes and the associated payments. It directed staff to proceed with the revised Silvernail Road sidewalk plan, replacing the segment east of Sussex Lane and not extending west. The board recommended awarding contracts for six city projects, including asphalt repairs, HVAC replacement, Clean Water Plant Phase 3, cemetery fountain, utility and street improvements, and a roof rehabilitation contract for the Schuetze Building. No bids were received for the Badger Drive Bus Wash Replacement, and the meeting was adjourned unanimously.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Joe Pieper, seconded by Chairperson Steve Kassens, to direct staff to proceed with the sidewalk plan, replacing sidewalk from Sussex Lane east to join up with the existing…
2 yea · 1 nay
Steve Kassens yea · Joe Pieper yea · Kevin Reilly nay
ID#25-00562 — recommended for approval
2 yea · 2 absent · 1 nay
Steve Kassens yea · Chad O'Donnell absent · Kevin Reilly nay · Eric E. Payne absent · Joe Pieper yea
The other 16 items passed by unanimous or near-unanimous consent.
Wed Apr 2, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to review historic home gutter repair, awards, and grant funds

The Landmarks Commission will decide on a Certificate of Appropriateness for repairs at 242 N. Hartwell Ave., including gutter work with copper linings in the McCall Street Historic District. They will also discuss the 2025 Landmarks Commission Awards and the Paint and Repair Grant Funds program. An educational presentation on window restoration from Thoughtful Craftsman is scheduled.

landmarkshistoric-preservationcertificate-of-appropriatenessawardsgrantswindow-restorationwaukesha
✓ Decided: Landmarks Commission approved awards and a certificate of appropriateness

The commission approved the March 5 minutes with five votes in favor and two members abstaining. It approved a Certificate of Appropriateness for repairs at 242 N. Hartwell Ave. with a unanimous seven‑member vote. The commission awarded a Certificate of Merit to Nicholas Martinez for work at 910‑914 Clinton Ave. with a unanimous seven‑member vote. It also granted the John Schoenknecht "Spirit of Preservation" award to David Kopp, again unanimously.

Council Chambers, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Elizabeth Moltzan, seconded by Member Carmen De La Paz, that the Minutes be approved. The motion carried by the following vote:
4 yea
Marty Larson yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
A motion was made by Member Jennifer Wall, seconded by Member Carmen De La Paz, to award the Landmarks Commission's John Schoenknecht "Spirit of Preservation" award to David Kopp. The motion carried…
5 yea
Marty Larson yea · Jennifer Wall yea · Julie Scarpace yea · Matt Retzak yea · Aaron Spencer yea
ID#25-00550 — approved
7 yea
Marty Larson yea · Jennifer Wall yea · Julie Scarpace yea · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#25-00554 — approved
14 yea
Marty Larson yea · Jennifer Wall yea · Julie Scarpace yea · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea · Marty Larson yea · Jennifer Wall yea · Julie Scarpace yea · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#25-00555 — approved
5 yea · 2 abstain
Marty Larson yea · Jennifer Wall abstain · Julie Scarpace abstain · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
Mon Mar 31, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to recommend contracts for July 4th beer sales and drone light show

The Parks, Recreation and Forestry Board will review and vote on recommendations to the Common Council for several contracts, including beverage services for the Independence Day fireworks and Tribute Tuesday concerts, a drone light show for Oktoberfest, and street median mowing. The board will also set summer recreation and pool fees, approve seasonal staff wages, and consider updates to the parade application.

parks-and-recreationcontractsfireworksoktoberfestfeeseventsmaintenance
✓ Decided: Board approved beverage contracts, recreation services and park program fees

The Parks, Recreation and Forestry Board approved a series of contracts and fee schedules. Items approved included beverage service contracts for the Independence Day fireworks and Tribute Tuesday concerts, a street‑median mowing contract, equipment purchase, summer recreation program fees, pool program fees, recreation service contracts, and Oktoberfest vendor agreements. All motions passed with unanimous or near‑unanimous votes.

Training Room, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Huemmer, seconded by Wallner, that this Discussion and Recommendation be approved. The motion carried by the following vote:
5 yea · 1 nay
Jennifer Wallner yea · Eric Huemmer yea · John Schmitz yea · Erica Yoss yea · Steve Johnson yea · Paul Wuteska nay
ID#25-00501 — approved
5 yea · 2 absent · 1 nay
Jennifer Wallner yea · Eric Huemmer yea · Sarah Roth absent · John Schmitz yea · Erica Yoss yea · Jack Wells absent · Steve Johnson yea · Paul Wuteska nay
The other 26 items passed by unanimous or near-unanimous consent.
Mon Mar 31, 2025 · 5:30 PM

Building and Grounds

Committee to discuss parking and traffic safety changes

The Building and Grounds committee will discuss and make recommendations regarding parking signs and traffic control measures. The meeting also includes a review of the current Building and Grounds budget.

parkingtraffic-safetyroadsbudget
✓ Decided: Council approved removal of no‑parking signs on N. West Ave and added 2‑hour parking

The Building and Grounds Committee voted to remove the existing no‑parking signs on the east side of the 300 block of N. West Ave and replace them with a two‑hour parking zone from 6 AM to 5 PM, except weekends and holidays. The committee also approved moving stop signs to create a four‑way stop at Chapman Dr. and Green Valley Dr., making Chapman Dr. free‑flow. Finally, a solar‑powered pedestrian crossing sign was approved for the Gascoigne Dr. and Pewaukee Rd. intersection, amended to flashing signs for both directions.

Council Chambers, City Hall
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Cory Payne, seconded by Ald. Rick Lemke, to approve the Minutes of March 3, 2025. The motion carried by the following vote:
3 yea
Eric Payne yea · Cory C. Payne yea · Rick R. Lemke yea
A motion was made by Ald. Rick Lemke, seconded by Ald. Cory Payne, that the existing no parking zone on the east side of the 300 block of N. West Ave. be removed and to install 2 hr. parking 6 AM -…
3 yea
Eric Payne yea · Cory C. Payne yea · Rick R. Lemke yea
A motion was made by Ald. Eric Payne, seconded by Ald. Rick Lemke, that the existing stop signs, and "cross traffic does not stop" signs on Chapman Dr. to be moved to stop traffic along Green Valley…
3 yea
Eric Payne yea · Cory C. Payne yea · Rick R. Lemke yea
A motion was made by Ald. Eric Payne, seconded by Ald. Cory Payne, to install new pedestrian signing at the intersection of Pewaukee Rd. and Gascoigne Dr. Motion was amended to include flashing…
3 yea
Eric Payne yea · Cory C. Payne yea · Rick R. Lemke yea
ID#25-00546 — approved
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
ID#25-00543 — recommended for Council Consent
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
ID#25-00544 — recommended for Council Consent
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
ID#25-00545 — recommended for Council Consent
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
Wed Mar 26, 2025 · 6:00 PM

Plan Commission

Plan Commission to vote on rezoning 0.61 acres for two Operation Finally Home homes

The Plan Commission will consider several site plans and land-use items, including a rezoning and certified survey map for two new homes through Operation Finally Home on Big Bend Road. Other agenda items include final approval for a new Water Utility Operations Center on Chapman Road, a 117,000 sq. ft. industrial facility on Corporate Drive, and a conditional use permit for an auto dealership at 2000 Davidson Road. A consent agenda item for a Walmart backup generator at 2000 S. West Avenue is also set for approval.

zoningsite-planconditional-usehousingeconomic-developmentpublic-works
✓ Decided: Plan Commission approved final site plan for new Water Utility Operations Center

The Waukesha Plan Commission approved several development applications with conditions, each receiving four affirmative votes and three absences. Items approved included a backup generator for Walmart, a new Water Utility Operations Center, an industrial facility for Briohn Builders, rezoning and a certified survey map for Belman Homes, and a conditional use for Freeland Cars. All motions passed by the same four‑member majority.

Council Chambers, City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Elizabeth Moltzan, seconded by Ald. Jack Wells, that the Minutes be approved. The motion carried by the following vote:
5 yea
Shawn Reilly yea · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
A motion was made by Ald. Jack Wells, seconded by Member R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
4 yea
R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Ald. Jack Wells, that this item be approved with conditions. The motion carried by the following vote:
4 yea
R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
A motion was made by Ald. Jack Wells, seconded by Member R.G. Keller, that this item be approved. The motion carried by the following vote:
4 yea
R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
A motion was made by Member Joan Francoeur, seconded by Ald. Jack Wells, that this item be approved with conditions. The motion carried by the following vote:
3 yea
R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea
A motion was made by Ald. Elizabeth Moltzan, seconded by Member R.G. Keller, that this item be approved with conditions. The motion carried by the following vote:
4 yea · 2 absent
R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · John Schmitz absent · Shawn Reilly absent
ID#25-00294 — approved
5 yea · 2 absent
John Schmitz absent · Shawn Reilly yea · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
PC25-0023 — approved
4 yea · 3 absent
John Schmitz absent · Shawn Reilly absent · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
PC25-0024 — approved with conditions
4 yea · 3 absent
John Schmitz absent · Shawn Reilly absent · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
PC25-0032 — approved with conditions
4 yea · 3 absent
John Schmitz absent · Shawn Reilly absent · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
PC25-0033 — approved with conditions
4 yea · 3 absent
John Schmitz absent · Shawn Reilly absent · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
PC25-0034 — approved with conditions
4 yea · 3 absent
John Schmitz absent · Shawn Reilly absent · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
Mon Mar 24, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider beer and wine licenses for Gyro House and Dollar General

The Ordinance & License Committee will hear three invited license applications: a Class B Beer and Class C Liquor (wine only) license for Gyro House, a Class A Beer and Class C Liquor (wine only) license for Dollar General #21577, and a bartender license for Joseph A. Porter. The meeting also includes public comment and approval of the March 10, 2025 minutes.

licensesalcoholbeerliquorwinepublic-hearingcommittee
✓ Decided: Committee approved three alcohol licenses and a bartender application

The Ordinance & License Committee approved the March 10, 2025 meeting minutes by unanimous consent. It also approved all pending Other Applications, a Gyro House beer and wine license, a Dollar General beer and wine license, and a bartender application for Joseph A. Porter. All approvals were by vote, with the bartender application passing 4‑1.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#25-00531 — approved
4 yea · 1 nay
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson nay · Doreen Wigderson yea
The other 4 items passed by unanimous or near-unanimous consent.
Thu Mar 20, 2025 · 5:30 PM

Board of Public Works

Board to vote on DNR grant for stormwater management plan update

The Board of Public Works will act on a resolution for a DNR Urban Nonpoint Source and Stormwater Management Grant to update the Stormwater Quality Management Plan. They will also review bids for 2025 asphalt street resurfacing and utility improvements, and for the Area 7 Flood Mitigation channel and storage improvements. Other items include approving storm sewer and drainage easements for Area 7 with the School District of Waukesha, updating residential garbage and recycling regulations, and authorizing agreements for e-waste and paper shredding events.

public-worksstormwaterflood-mitigationgrantsstreetsgarbage-recyclinge-wastepaper-shredding
Council Chambers, City Hall
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
ID#25-00485 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00486 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00487 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00488 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00489 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00496 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00514 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00517 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00516 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu Mar 20, 2025 · 6:00 PM

Waukesha Water Commission

Commission approves street resurfacing contract and utility easements

The Waukesha Water Commission will vote to approve payments, a water main replacement contract worth $1.9 million, and easement agreements with WeEnergies. The meeting also includes a report on utility performance and financials.

waterstreetscontractbudgetpayrollpublic-works
✓ Decided: Water Commission approves water main contract and related payments

The Waukesha Water Commission approved the minutes from the February 20, 2025 meeting. It also approved payments from the General Fund and Improvement Fund, an easement agreement at Well No. 9 with WeEnergies at no cost, a water main replacement contract with a total of $1,924,337.68, and water main offsets of $47,697.10.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
Tue Mar 18, 2025 · 6:00 PM

City Council

Council to vote on rezoning for 79-lot Winterberry Reserve and new Starbucks

The council will hold public hearings and take action on two major development proposals: a rezoning and planned unit development amendment for a new Starbucks at 101 W. Sunset Drive, and a rezoning for the 79-lot Winterberry Reserve subdivision north of Summit Avenue. The consent agenda includes a final site plan for the Starbucks, transit service reductions, license approvals, and other routine items. A closed session is scheduled to discuss a counter offer for the sale of city-owned property at Buena Vista and Pewaukee Rd. The council will also vote on a $397 per tree assessment for the spring street tree planting program and a sanitary sewer assessment along Silvernail Road.

councilzoninghousingdevelopmentpublic-hearingconsent-agendaparkstransit
✓ Decided: Council approves Winterberry Reserve rezoning and preliminary plat for 79-lot subdivision

The Waukesha City Council approved the rezoning of approximately 22.196 acres north of Summit Avenue to a Planned Unit Development overlay for the Winterberry Reserve subdivision, and also approved the preliminary plat for a 79 single-family lot subdivision. The council also approved a $35,000 sale of .15 acres of city-owned property at Buena Vista and Pewaukee Rd., and awarded contracts for concrete patching and traffic signal improvements.

Council Chambers, City Hall
🗳️ How they voted — 9 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Wells, seconded by Ald. R. Lemke, to approve Planned Unit Development Agreement Amendment - 101 W. Sunset Drive, Brighton Square - A request to amend the Brighton Square…
8 yea · 4 nay
Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Mike Chrisien nay · Eric E. Payne nay · Paul Wuteska nay · Cory C. Payne nay
A motion was made by Ald. Wells, seconded by Ald. R. Lemke, to approve rezoning Rs-3 PUD Single Family Residential with a Planned Unit Development Overlay District, Winterberry Reserve Subdivision…
10 yea · 2 nay
Mike Chrisien yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Eric E. Payne nay · Cory C. Payne nay
A motion was made by Ald. R. Lemke, seconded by Ald. Moltzan, to approve the A. PC25-0011 Preliminary Subdivision Plat - Winterberry Reserve, north of Summit Avenue - A request to approve the Final…
9 yea · 1 nay
Mike Chrisien yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Eric E. Payne nay
A motion was made by Ald. C. Payne, seconded by Ald. E. Payne, to reconsider item PC25-0011 Preliminary Subdivision Plat - Winterberry Reserve, north of Summit Avenue - A request to approve the Final…
9 yea · 1 nay
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Elizabeth Moltzan nay
A motion was made by Ald. Moltzan, seconded by Ald. Pieper, to reapprove Preliminary Subdivision Plat - Winterberry Reserve, north of Summit Avenue - A request to approve the Final Plat for a 79…
8 yea · 2 nay
Mike Chrisien yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Eric E. Payne nay · Cory C. Payne nay
PC25-0019 — approved
9 yea · 4 nay · 1 absent
Mike Chrisien nay · Eric E. Payne nay · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay
PC25-0012 — approved
11 yea · 2 nay · 1 absent
Mike Chrisien yea · Eric E. Payne nay · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay
ID#25-00274 — approved
11 yea · 3 absent · 1 nay
Mike Chrisien yea · Eric E. Payne yea · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay
PC25-0011 — approved
29 yea · 9 absent · 4 nay
Mike Chrisien yea · Eric E. Payne nay · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Mike Chrisien yea · Eric E. Payne yea · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska absent · Mike Anderson yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Mike Chrisien yea · Eric E. Payne nay · Doreen Wigderson absent · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska absent · Mike Anderson yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay
The other 18 items passed by unanimous or near-unanimous consent.
Mon Mar 17, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to vote on drone light show contract for Oktoberfest

The Parks, Recreation and Forestry Board will review and recommend to Common Council several contracts for 2025 events and services, including a drone light show for Oktoberfest, beverage services for fireworks and concerts, and a Children's Entrepreneur Market at Movie Nights. The board will also set summer recreation and pool fees, approve staff wages, and consider a special use request for veterans' events.

parksrecreationcontractseventsdrone-showoktoberfestfeesmowing
Council Chambers, City Hall
Thu Mar 13, 2025 · 4:45 PM

Library Board

Library Board to discuss loan period policy and art purchases

The Waukesha Library Board will consider changes to loan period and unreturned materials policies, and vote on two public art proposals for the library. Several policy items have been withdrawn from the agenda. The board will also receive a director's report and committee updates.

librarypoliciespublic-artrfidwaukesha
✓ Decided: Library Board approves new loan policy, withdraws two older ones

The Waukesha Library Board approved a consolidated loan policy (C:3) and withdrew two older policies (C:4 and C:5) that it replaced. It also approved a policy on unreturned materials, withdrew a rental collection policy, and approved two public art acquisitions and a new committee member. All votes were unanimous except for the bills and financial reports, which passed 10-0 with one absence.

Library Board Room
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Bills — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Financial Reports — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Mon Mar 10, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews 11 liquor, beer, and sidewalk cafe license applications

The Ordinance & License Committee will consider multiple license and permit applications, including new and renewal requests for sidewalk cafes, beer and liquor licenses, and a secondhand article dealer. Among the items are applications from Taco Jalisco, The Tap Yard, Tofte's Table, Dave's Restaurant, and Foxx View Lanes. No ordinances or policy changes are on the agenda.

licensesbeerliquorsidewalk-cafesecondhand-dealerwaukeshaordinance-and-license-committee
✓ Decided: Committee approves sidewalk cafe permits and liquor licenses for 8 businesses

The Ordinance & License Committee unanimously approved all license applications on the agenda, including a sidewalk cafe permit for Joey's Diner, a secondhand dealer license for One Stop Wonders, an extension of premise for Foxx View Lanes, and a consolidated motion covering eight other applications for beer/liquor licenses and sidewalk cafe permits. No public comment was made, and the meeting adjourned at 6:11 PM.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-00264 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00316 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00325 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00349 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Mon Mar 10, 2025 · 4:00 PM

Board of Zoning Appeals

Board to decide on variance for rear yard setback at Woodfield Circle

The Board of Zoning Appeals will hear an appeal from Joseph D. Robison for a dimensional variance to allow a rear yard setback of 42 feet 8 inches instead of the required 45 feet for a single-family dwelling on Parcel WAKC1311092 at the west end of Woodfield Circle. This is the only item of new business on the agenda; the rest of the meeting consists of call to order, roll call, public comment, approval of minutes, and adjournment.

zoningvarianceboard-of-zoning-appealswaukeshasetbacksingle-family-dwelling
✓ Decided: Board approves rear-yard setback variance for Woodfield Circle home

The Board of Zoning Appeals approved a dimensional variance allowing a single-family dwelling at the west end of Woodfield Circle with a rear yard setback of 42 feet 8 inches, instead of the required 45 feet. The vote was 3-0, with two members absent. The board also approved the minutes from the January 13, 2025 meeting.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Bryan Erickson, seconded by Kevin Reilly, that the Minutes be approved. The motion carried by the following vote:
3 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea
A motion was made by Kevin Reilly, seconded by Bryan Erickson, that this item be approved. The motion carried by the following vote:
3 yea
Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea
A motion was made by Christine D'Angelo, seconded by Bryan Erickson, that the meeting be adjourned. The motion carried by the following vote:
2 yea · 1 absent
Christine D'Angelo yea · Kevin Reilly yea · Ed Raether absent
Adjournment — approved
3 yea · 2 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic absent
ID#25-00111 — approved
3 yea · 2 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic absent
ID#25-00112 — approved
3 yea · 2 absent
Ed Raether absent · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson yea · Timothy Retic absent
Thu Mar 6, 2025 · 5:30 PM

Board of Public Works

Public hearing on Silvernail Road sanitary sewer special assessment

The Board of Public Works will hold a public hearing and consider a resolution for a special assessment to install a sanitary sewer along Silvernail Road from STH 318/Meadowbrook Road to Sussex Lane. The board will also approve minutes, payments, and review bids received for city-wide concrete pavement patching and traffic signal improvements at W. Sunset Dr. and Oakdale Dr. Official notices will be given for upcoming bids on asphalt resurfacing, flood mitigation, and clean water plant improvements.

public-worksspecial-assessmentsewerinfrastructurebidstraffic-signalsconcrete-patching
✓ Decided: Board recommends $17,711.76 per-address sewer assessment on Silvernail Road

The Board of Public Works recommended approval of a special assessment for sanitary sewer installation along Silvernail Road from STH 318/Meadowbrook Road to Sussex Lane, at $17,711.76 per address, with a 2% interest rate over 15 years. The board also recommended awarding bids for concrete pavement patching and sawing city-wide to Wandel Contractors for $681,597.50, and for traffic signal improvements at W. Sunset Dr. and Oakdale Dr. to Zenith Tech, Inc. for $393,889.30. All votes were 5-0. The board approved the February 20, 2025 minutes and payments.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-00328 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00329 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00332 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00334 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00336 — approved
10 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea · Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00333 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu Mar 6, 2025 · 5:30 PM

Transit Commission Meeting

Transit Commission to vote on Route 1 service cuts effective June 2

The Waukesha Transit Commission will discuss and act on a proposal to reduce Route 1 service levels starting June 2, 2025. They will also consider resolutions authorizing a 2025 federal grant filing and adopting a Title VI plan for 2025-2027. The agenda includes approval of January 2025 minutes and review of ridership and WisDOT management reports.

transitroute-1service-reductionfederal-granttitle-viridershipwaukesha
✓ Decided: Transit Commission recommends reduced Route 1 service and 2025 federal grant filing

The Waukesha Transit Commission unanimously recommended for Council Consent reduced Route 1 service levels effective June 2, 2025, a resolution authorizing the filing of the 2025 federal grant, and the 2025-2027 Title VI Plan with supporting resolution. The commission also received the 2024 ridership report showing a 16% increase in fixed route ridership and a 7% increase in Metrolift ridership, and a WisDOT management review summary. No public comments were made.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#25-00306 — approved
5 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00307 — recommended for Council Consent
5 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00308 — recommended for Council Consent
5 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00309 — recommended for Council Consent
5 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu Mar 6, 2025 · 12:00 PM

Waukesha Intergovernmental Health Group Advisory Council

Council will review and approve the 2025 addendum to the Medical Clinic agreement

The Waukesha Intergovernmental Health Group Advisory Council will consider the Year 10 utilization review for the clinic and vote on an amended and restated Medical Clinic Intergovernmental Cooperation Agreement addendum for 2025. The meeting also includes routine approval of minutes from the September 18, 2024 session and any other business raised. The council may conduct the meeting in person or via live stream.

healthintergovernmental-cooperationclinicminutespublic-meeting
✓ Decided: Health group approves clinic agreement addendum

The Waukesha Intergovernmental Health Group Advisory Council approved the minutes from the September 18, 2024 meeting and approved the amended and restated Medical Clinic Intergovernmental Cooperation Agreement addendum. A consultant presented a utilization review for Clinic Year 10, but no action was taken on it. The meeting adjourned at 12:26 pm.

City Hall Room 201 201 Delafield Street Waukesha, WI 53188
Wed Mar 5, 2025 · 6:00 PM

Landmarks Commission

Commission to review roof replacement at 311 McCall St., discuss historic property recognition

The Landmarks Commission will consider a Certificate of Appropriateness for a roof replacement at 311 McCall St. in the McCall Street Historic District. They will also discuss Paint and Repair Grant funds, hear a presentation on potentially recognizing additional historic properties, and consider a draft letter to historic property owners.

landmarkshistoric-districtcertificate-of-appropriatenesshistoric-preservationgrantspublic-hearing
✓ Decided: Landmarks Commission approves roof replacement at 311 McCall St.

The Landmarks Commission approved a Certificate of Appropriateness for a roof replacement at 311 McCall St. in the McCall Street Historic District. The commission also discussed a draft letter to historic property owners and heard a presentation on historic properties. No other substantive decisions were made.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Aaron Spencer, seconded by Member Carmen De La Paz, that the Minutes be approved. The motion carried by the following vote:
3 yea · 2 absent
Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea · Jennifer Wall absent · Julie Scarpace absent
A motion was made by Member Elizabeth Moltzan, seconded by Member Matt Retzak, that this item be approved. The motion carried by the following vote:
4 yea
Marty Larson yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#25-00250 — approved
5 yea · 2 absent
Marty Larson yea · Jennifer Wall absent · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#25-00255 — approved
4 yea · 2 absent · 1 abstain
Marty Larson abstain · Jennifer Wall absent · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
Tue Mar 4, 2025 · 6:00 PM

City Council

Council to award $798,923.40 contract for Bethesda Court and Park Avenue improvements

The Waukesha City Council will consider several items, including a closed‑session vote to appoint Katie Panella as City Clerk. Council members will review a $77,406 carryover to the 2025 General Fund and a developer agreement for the Olde Farm Subdivision. They will also vote on two public‑works contracts: $361,045 for citywide concrete sidewalk replacement and $798,923.40 for Bethesda Court and Park Avenue utility and street improvements.

city-clerkbudgetpublic-workscontractssidewalksstreets
✓ Decided: Council approves Katie Panella as City Clerk

The City Council approved the appointment of Katie Panella as City Clerk, including all terms of the offer letter, after a closed session discussion. The council also approved several contracts and policies, including a $361,045 sidewalk replacement bid and a $798,923.40 utility and street improvement bid. All votes were unanimous except for the downtown kiosk advertising policy, which passed 12-1.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Pieper, seconded by Ald. Halvensleben, to approve the advertising policy and fees for the downtown kiosks. The motion carried by the following vote:
11 yea · 1 nay
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea · Elizabeth Moltzan nay
ID#24-11497 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan nay · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke absent · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
The other 16 items passed by unanimous or near-unanimous consent.
Mon Mar 3, 2025 · 5:30 PM

Building and Grounds

Street closure permit for House of Guinness at Municipal Lot No. 3

The Building and Grounds Committee will discuss and vote on a Street Closure Permit for Municipal Lot No. 3, requested by House of Guinness for a special event. The meeting also includes approval of the January 6, 2025 minutes and public comment.

building-and-groundsstreet-closurepermitseventswaukesha
✓ Decided: Building and Grounds approves street closure for House of Guinness event

The Building and Grounds Committee approved a street closure permit for Municipal Lot No. 3 for the House of Guinness special event. The committee also approved the minutes from the January 6, 2025 meeting. Both motions passed unanimously with a 3-0 vote, with two members absent.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Rick Lemke, seconded by Ald. Cory Payne, to approve the Minutes of January 6, 2025. The motion carried by the following vote:
3 yea
Eric E. Payne yea · Cory C. Payne yea · Rick R. Lemke yea
A motion was made by Ald. Rick Lemke, seconded Ald. Cory Payne, that the Street Closure Permit for Municipal Lot No. 3 for the House of Guinness be approved. The motion carried by the following vote:
3 yea
Eric E. Payne yea · Cory C. Payne yea · Rick R. Lemke yea
ID#25-00299 — approved
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
ID#25-00300 — recommended for Council Consent
3 yea · 2 absent
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke absent · Mike Anderson absent
Wed Feb 26, 2025 · 6:00 PM

Plan Commission

Plan Commission considers new housing subdivision and Starbucks development

The Plan Commission will hold a public hearing for an auto sales business and review several development requests. Key items include a 79-lot residential subdivision and a new Starbucks location. The body will also review a city flood mitigation project near Waukesha North High School.

zoninghousingcommercial-developmentflood-mitigationpublic-hearings
✓ Decided: Plan Commission approves conditional use permit for You Drive It Now auto sales

The Waukesha Plan Commission approved a conditional use permit for You Drive It Now auto sales at 1531 E Moreland Blvd, with conditions including staff comments, allowing one car parked after hours in front of garage doors, and a review next February. The commission also recommended approval for rezoning and preliminary plat for the Winterberry Reserve subdivision, a Starbucks development at 101 W. Sunset Drive, and a flood mitigation project at Waukesha North High School. All votes were 5-1 or 6-0, with one member absent.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Member Shawn Reilly, seconded by Member Joan Francoeur, that this item be approved with conditions including staff comments, and to allow one car to be parked after business…
5 yea · 1 nay
John Schmitz yea · Shawn Reilly yea · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells nay
PC25-0013 — approved with conditions
5 yea · 1 absent · 1 nay
John Schmitz yea · Shawn Reilly yea · Corey Montiho absent · R.G. Keller yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells nay
The other 15 items passed by unanimous or near-unanimous consent.
Tue Feb 25, 2025 · 6:00 PM

Finance Committee

Finance Committee to approve $77,406 carryover to 2025 General Fund

The Waukesha Finance Committee will consider two business items. First, they will review and vote on the downtown kiosk advertising policy and associated fees. Second, they will act on a recommendation to carry over $77,406.00 from the 2024 General Fund to the 2025 General Fund.

financebudgetadvertisinggeneral-fundkiosks
✓ Decided: Finance Committee approves downtown kiosk advertising policy and fees

The Finance Committee approved the downtown kiosk advertising policy and fees (3-1), and approved carrying over $77,406.00 from 2024 to 2025 in the General Fund (4-0). The minutes from December 10, 2024 were also approved. No public comments were made.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Pieper and seconded by McElderry that this item be approved. The motion carried by the following vote:
5 yea · 1 nay
Joe Pieper yea · Rick R. Lemke yea · Elizabeth Moltzan nay · Joe Pieper yea · Elizabeth Moltzan yea · Rick R. Lemke yea
ID#24-11497 — approved
3 yea · 1 absent · 1 nay
Peter Bartels absent · Joe Pieper yea · Elizabeth Moltzan nay · Rick Lemke yea · Frank McElderry yea
The other 1 item passed by unanimous or near-unanimous consent.
Mon Feb 24, 2025 · 6:00 PM

Ordinance & License Committee

Committee reviews sidewalk cafe and liquor license applications

The Ordinance & License Committee is meeting to review several permit and license applications. The body will consider requests for sidewalk cafes and taxi services.

licensespermitssidewalk-cafestaxi-servicesliquor-license
✓ Decided: Committee approves sidewalk cafe permits and licenses

The Ordinance & License Committee approved three license applications: a sidewalk cafe permit for People's Park, a taxicab and taxi driver application for Best Cab/Jon Beutler-Woo, and a temporary Class B retailer's license for Waukesha Old Car Club. All motions passed unanimously with a 5-0 vote. The meeting was brief and procedural, with no public comment or substantive policy decisions.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00263 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00283 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00293 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Thu Feb 20, 2025 · 6:00 PM

City Council

City to consider rezoning 11 acres for Water Utility Operations Center

The council will hold a public hearing and vote on rezoning 11.09 acres on Chapman Drive from industrial to institutional for a new water utility operations center. Several public works contracts are up for approval, including a $2.99 million Silvernail Road improvement project, a $53,400 boiler replacement at Fire Station #1, and a $174,982 door and window replacement at the Rotary Building. A closed session is scheduled to discuss selling a 0.15-acre city-owned parcel at Buena Vista and Pewaukee Road. Other items include a sponsorship agreement with Generac Foundation for the 2026 JanBoree and license extensions for Foxx View Lanes and Hilltop Pub.

zoningwater-utilitypublic-workscontractsroadsflood-mitigationlicensesjanboree
✓ Decided: Council approves $2.99M Silvernail Road utility and street improvements contract

The Waukesha City Council approved several public works contracts, including a $2,985,434.16 bid for Silvernail Road utility and street improvements. It also approved the Williams Street Placemaking Plan, ratified an EAP contract with ComPsych, and approved a rezoning for the Water Utility Operations Center. All votes were 11-0 with three members absent.

Council Chambers, City Hall
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Moltzan, seconded by Ald. D. Lemke, to approve the minutes from February 4, 2025 meeting. The motion carried by the following vote:
11 yea · 2 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea · Jack Wells absent · Cory C. Payne absent
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve Williams Street Placemaking Plan. The motion carried by the following vote:
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. R. Lemke, seconded by Ald. Chrisien, to approve the ratification of the EAP contract with ComPsych. The motion carried by the following vote:
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Moltzan, seconded by Ald. Bartels, to approve the rezoning petition for Waukesha Water Utility Operations Center, Chapman Road, TK #1332001008 - A request from the Waukesha…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve low bid from August Winter & Sons, Inc., in the amount of $53,400.00 for Fire Station #1 Boiler Replacements. The motion…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve the low bid from LaLonde Contractors, Inc., in the amount of $2,985,434.16 for Silvernail Road Utility and Street Improvements…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve the low bid from Hennes Services, Inc., in the amount of $63,990.00 for Badger Drive HVAC Improvements. The motion carried by…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve the only bid from Corcoran Glass LLC in the amount of $174,982.00 for Rotary Building Door and Window Replacement. The motion…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. Manion, to go into Closed Session pursuant to Wisconsin Statutes §19.85(1)(e) to discuss the sale of .15 acres of City owned property at the corner…
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve matters discussed in closed session. The motion carried by the following vote
11 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
ID#25-00245 — approved
11 yea · 3 absent · 1 abstain
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben abstain · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00246 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
PC25-0005 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00052 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00257 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00259 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00262 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00104 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00105 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-00106 — approved
11 yea · 3 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells absent · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Frank McElderry absent · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
Thu Feb 20, 2025 · 5:30 PM

Board of Public Works

Board to review developer's agreement for Olde Farm Subdivision

The Board of Public Works will discuss and recommend action on a developer's agreement with Bielinski Homes for the Olde Farm Subdivision north of Madison Street. They will also review a utility easement for the Cobblestone Hotel at 704 N. Grand Avenue and act on bids for city-wide concrete sidewalk replacement and Bethesda Court/Park Avenue utility and street improvements. Additionally, three requests for one-time sewer credits are on the agenda. The meeting includes approval of prior minutes and notices of upcoming bid closures.

public-worksstreetssidewalksutilitiesdevelopmentsubdivisionbids
✓ Decided: Board recommends $361K sidewalk contract and $798K Bethesda Court project

The Board of Public Works voted unanimously to recommend awarding the 2025 Concrete Sidewalk Replacement contract to State Contractors, Inc. for $361,045.00, and the concrete bid for the Bethesda Court and Park Avenue Utility and Street Improvements to LaLonde Contractors, Inc. for $798,923.40. The board also recommended approval of a utility easement for the Cobblestone Hotel property and a developer's agreement with Bielinski Homes for the Olde Farm Subdivision, plus one-time sewer credits for three residents. All votes were 5-0.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-00249 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00251 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00252 — recommended for approval
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00265 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00266 — recommended for Council Consent
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
ID#25-00253 — approved
5 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper yea
Thu Feb 20, 2025 · 5:00 PM

Waukesha Water Commission

Water Commission considers $230,695 for Silvernail utility improvements

The Waukesha Water Commission will vote on several contracts and material purchases. The body will also discuss elevated tank and reservoir storage use.

water-utilityinfrastructurecontractspublic-works
✓ Decided: Water commission approves $230,695 water main replacement

The Waukesha Water Commission approved a $230,695.74 water main replacement for the Silvernail Utility & Street Improvements, along with a $130,000 contract amendment with Stafford Rosenbaum, payments from the General and Improvement Funds, and material purchases from Ferguson and Core & Main. All votes were 4-0 with three members absent. The commission also discussed elevated tank and reservoir storage use and received performance and financial reports.

Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Commissioner Joan Francoeur, seconded by Alderman Jeff Fowle, that this item be approved. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Jeff Fowle yea · Peter Bartels yea · Joe Piatt yea
A motion was made by Alderman Jeff Fowle, seconded by Commissioner Joan Francoeur, that this item be approved. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Jeff Fowle yea · Peter Bartels yea · Joe Piatt yea
A motion was made by Commissioner Joan Francoeur, seconded by Commission President Peter Bartels, that this item be approved. The motion carried by the following vote:
4 yea
Joan Francoeur yea · Jeff Fowle yea · Peter Bartels yea · Joe Piatt yea
A motion was made by Commission President Joe Piatt, seconded by Commission President Peter Bartels, that this item be approved. The motion carried by the following vote:
8 yea · 2 absent
Joan Francoeur yea · Jeff Fowle yea · Peter Bartels yea · Joe Piatt yea · Joan Francoeur yea · Jeff Fowle yea · Peter Bartels yea · Joe Piatt yea · Paul Ybarra absent · Shawn Reilly absent
ID#25-00285 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly absent · Jeff Fowle yea · Peter Bartels yea · Gerald Couri absent · Joe Piatt yea
ID#25-00286 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly absent · Jeff Fowle yea · Peter Bartels yea · Gerald Couri absent · Joe Piatt yea
ID#25-00287 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly absent · Jeff Fowle yea · Peter Bartels yea · Gerald Couri absent · Joe Piatt yea
ID#25-00288 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly absent · Jeff Fowle yea · Peter Bartels yea · Gerald Couri absent · Joe Piatt yea
ID#25-00289 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly absent · Jeff Fowle yea · Peter Bartels yea · Gerald Couri absent · Joe Piatt yea
Wed Feb 19, 2025 · 6:00 PM

Human Resources Committee

HR Committee to review 2025 staffing list and City Administrator performance

The Human Resources Committee will review and approve the updated 2025 B16 Staffing Resolution Job List. The committee will also enter a closed session to discuss the City Administrator's performance evaluation.

personnelstaffingperformance-reviewcity-administration
✓ Decided: HR Committee approves 2025 staffing resolution job list

The Human Resources Committee approved the minutes of the December 18, 2024 meeting and the 2025 updated B16 Staffing Resolution Job List. The committee also held a closed session to discuss the City Administrator's performance evaluation. All votes were unanimous among the four members present.

Training Room, City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] Call To Order Paul Wuteska, Mike Anderson, Mike Chrisien and Doreen WigdersonPresent: 4 - Frank McElderry and Elizabeth Moltzan
4 yea
Paul Wuteska yea · Mike Anderson yea · Mike Chrisien yea · Doreen Wigderson yea
Resolution Job List
4 yea
Paul Wuteska yea · Mike Anderson yea · Mike Chrisien yea · Doreen Wigderson yea
Approval of Minutes — adjourned
4 yea · 2 absent
Paul Wuteska yea · Frank McElderry absent · Mike Anderson yea · Mike Chrisien yea · Elizabeth Moltzan absent · Doreen Wigderson yea
ID#25-00279 — approved
4 yea · 2 absent
Paul Wuteska yea · Frank McElderry absent · Mike Anderson yea · Mike Chrisien yea · Elizabeth Moltzan absent · Doreen Wigderson yea
ID#25-00280 — approved
4 yea · 2 absent
Paul Wuteska yea · Frank McElderry absent · Mike Anderson yea · Mike Chrisien yea · Elizabeth Moltzan absent · Doreen Wigderson yea
Mon Feb 17, 2025 · 5:30 PM

Parks, Recreation and Forestry Board

Board to hold public hearing on spring street tree planting at $350 per tree

The Parks, Recreation and Forestry Board will hold a public hearing on the Spring 2025 Public Street Tree Planting Program, with a proposed assessment of $350 per tree. The board is also recommending that the Common Council set a public hearing to act on the assessment. Additionally, the board will review a sponsorship agreement with the Generac Foundation for the 2026 Waukesha JanBoree, consider purchasing three TurboChef ovens for concession stands, and review preliminary 2025 pool fees and charges.

parkstreespublic-hearingsponsorshipequipmentpool-feesjanboree
✓ Decided: Board recommends $397/tree street tree planting assessment to Common Council

The Parks, Recreation and Forestry Board voted unanimously to recommend that the Common Council set a public hearing to review and act on the proposed assessment for the Spring 2025 Public Street Tree Planting Program at $397.00 per tree. The board also unanimously recommended approval of a sponsorship agreement with Generac Foundation for the 2026 Waukesha JanBoree event and approved the purchase of three TurboChef rapid cook ovens for concession stands. The board opened and closed the public hearing for the tree planting program and reviewed the preliminary 2025 pool program with no action taken.

Council Chambers, City Hall
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-00270 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
ID#25-00272 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
ID#25-00273 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
ID#25-00274 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
ID#25-00275 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
ID#25-00276 — approved
7 yea
Eric Huemmer yea · Sarah Roth yea · John Schmitz yea · Erica Yoss yea · Jack Wells yea · Steve Johnson yea · Paul Wuteska yea
Thu Feb 13, 2025 · 4:45 PM

Library Board

Library Board to discuss compensation review and job descriptions

The Library Board will consider the 2024 annual report, budget carryover requests, and a proposed addition to the public art collection. They will also discuss the next steps for classification and compensation review and vote on several new job descriptions for library staff.

librarybudgetpublic-artcompensationjob-descriptionsannual-reportwaukesha
✓ Decided: Library Board approves 2024 budget carryovers and multiple job descriptions

The Waukesha Library Board approved the February bills, financial report, 2024 budget carryover requests, the DPI 2024 annual report, adding Chuck Wickler's 'Paying Homage' to the public art collection, and several job descriptions (Administrative Services Manager, Building Maintenance Coordinator, Finance Analyst, Custodian, Special Projects Coordinator, Community Engagement Services Manager, Bridges ILS Manager). All votes were unanimous except for bills, financial report, and budget carryovers, which passed 10-1 with Erik Helgestad absent. The meeting was procedural and administrative in nature.

Library Board Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00115 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
ID#25-00118 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
ID#25-00122 — approved
10 yea · 1 absent
Melissa Baxter yea · Martha Ryan yea · Dr. Kevin Guilfoy yea · Sandra Ammerman yea · Erik Helgestad absent · Betsy Forrest yea · Bonnie Byrd yea · James Sebert yea · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Thu Feb 13, 2025 · 4:15 PM

Library Human Resources Committee

Library HR Committee will discuss multiple staff job descriptions

The Library Human Resources Committee will approve the minutes from the November 14, 2024 meeting. It will review next steps for the class and compensation review. The committee will discuss and consider action on job descriptions for several positions, including Administrative Services Manager, Building Maintenance Coordinator, Finance Analyst, Custodian, Special Projects Coordinator, Community Engagement Services Manager, and Bridges ILS Manager.

libraryhuman-resourcesjobscompensationboard-meeting
✓ Decided: Library HR committee approves 8 job descriptions

The Library Human Resources Committee unanimously approved eight job descriptions, including Administrative Services Manager, Building Maintenance Coordinator, Finance Analyst, Custodian, Special Projects Coordinator, Community Engagement Services Manager, and Bridges ILS Manager. The committee also approved the minutes from the November 14, 2024 meeting. No other substantive decisions were made.

Library Board Room
Mon Feb 10, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider liquor license extensions for Foxx View Lanes and Hilltop Pub

The Ordinance & License Committee will review two applications for extension of premise liquor/beer licenses (Foxx View Lanes, The Hilltop Pub) and a change of agent for Speedway LLC. The committee will also approve minutes from previous meetings. No other substantive items are on the agenda.

licensesalcoholcity-of-waukeshaordinance-and-license-committee
✓ Decided: Committee approves liquor license extensions for two Waukesha venues

The Ordinance & License Committee unanimously approved extension of premise licenses for the sale of liquor and/or beer for Foxx View Lanes and The Hilltop Pub, and approved a change of agent for Speedway LLC. Minutes from January 13 and 27 were also approved by unanimous consent. No other substantive decisions were made.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00109 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00110 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00146 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Thu Feb 6, 2025 · 5:30 PM

Board of Public Works

Board to consider accepting Michigan Avenue parcel for stormwater detention pond

The Board of Public Works will vote on accepting a 1.926-acre property on Michigan Avenue at no cost for a stormwater detention pond as part of the Area 7 flood mitigation project. They will also approve minutes and payments, review bids for Silvernail Road improvements, Badger Drive HVAC, and Rotary Building door/window replacement, and note upcoming bid deadlines.

public-worksstormwaterflood-mitigationproperty-acquisitionbidsroadsinfrastructure
✓ Decided: Board awards $2.99M Silvernail Road utility and street project

The Board of Public Works approved the low bid for the Silvernail Road Utility and Street Improvements project, awarded to LaLonde Contractors, Inc. for $2,985,434.16. It also recommended approval of bids for Badger Drive HVAC improvements and Rotary Building door/window replacement, and recommended the purchase of property for a stormwater pond. All votes were 4-0 with one member absent.

Council Chambers, City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the Minutes of January 23, 2025, be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric E. Payne, seconded by Member Kevin Reilly, that the Payments be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the low bid from LaLonde Contractors, Inc., for the Silvernail Road Utility and Street Improvements project be approved…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the low bid from Hennes Services, Inc., for the Badger Drive HVAC Improvements project be recommended for approval. The…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made Ald. Eric Payne, seconded by Vice Chair Chad O'Donnell, that the only bid from Corcoran Glass LLC for the Rotary Building Door and Window Replacement project be recommended for…
3 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, to recommend for Council Consent the purchase of approximately 1.926 +/- acres of real property known as Tax Key WAKC 1313 999…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
ID#25-00081 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00082 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00104 — recommended for approval
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00105 — recommended for approval
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00106 — recommended for approval
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00103 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Thu Feb 6, 2025 · 6:00 PM

Library Public Art Committee

Library Public Art Committee to review artist proposals

The committee will hear a presentation from artist Robin Jebavy. Members will discuss and consider artist proposals and fundraising efforts.

public-artlibraryfundraisingarts
✓ Decided: Committee recommends two artworks for Library collection

The Library Public Art Committee unanimously recommended adding two artworks to the Library collection: 'Still Life with Melon and Grapes' by Jill Bedford at a cost of $980, contingent on the artist meeting necessary parameters, and 'Set Table Amber' by Robin Jebavy, contingent on funding. The committee also voted unanimously to invite Chris Fenner to rejoin the Committee following a fundraising discussion. Minutes from the January 27, 2025 meeting were approved unanimously.

Library Board Room
Wed Feb 5, 2025 · 6:00 PM

Landmarks Commission

Landmarks Commission to discuss Blair House boundary adjustment and fire escape beams at 402 Wisconsin Ave

The Landmarks Commission will review a Certificate of Appropriateness request for adding structural support beams to the fire escape at 402 Wisconsin Avenue in the Madison Street Historic District. The commission will also discuss and possibly take action on a pending application to adjust the boundaries of the National Register listing for the Senator William and Henrietta Blair House and on a draft response letter. The meeting additionally includes a discussion of the Paint and Repair Grant Funds.

landmarkshistoric-preservationcertificate-of-appropriatenessnational-registerboundary-adjustmentgrants
✓ Decided: Landmarks Commission approves fire escape supports at 402 Wisconsin Ave

The Waukesha Landmarks Commission approved a Certificate of Appropriateness for structural support beams for the fire escape at 402 Wisconsin Avenue, with a condition to consider adding a veneer or concrete stamp to match the building's foundation. The commission also approved the draft response letter regarding the boundary adjustment for the Senator William and Henrietta Blair House National Register listing. Minutes from January 8, 2025, were approved with three ayes, two abstentions, and two absences.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Spencer, seconded by Member De La Paz, that the Minutes be approved. The motion carried by the following vote:
2 yea · 2 absent
Matt Retzak yea · Aaron Spencer yea · Marty Larson absent · Elizabeth Moltzan absent
A motion was made by member Jennifer Wall, seconded by member Aaron Spencer, to approve this item with the condition that the applicant consider adding a veneer or a concrete stamp to the base of the…
4 yea
Jennifer Wall yea · Julie Scarpace yea · Matt Retzak yea · Aaron Spencer yea
A motion was made by member Carmen De La Paz, seconded by member Aaron Spencer, to approve the letter as written by Jennifer Wall, with Carmen’s signature. The motion carried by the following vote:
4 yea
Jennifer Wall yea · Julie Scarpace yea · Matt Retzak yea · Aaron Spencer yea
Tue Feb 4, 2025 · 6:00 PM

City Council

Council to consider a contract amendment up to $20,000 for Clean Water Plant assistance

The Waukesha City Council will review items on the consent agenda, which have been approved by committees. New business includes a contract amendment not to exceed $20,000 for operational assistance at the Clean Water Plant, a contract extension with United Liquid Waste for bio‑solids hauling, and a change order for the 2024 Alley Reconstruction project. The council will also hear a sidewalk installation agreement with Waukesha County and consider rezoning of S West Avenue and amendments to municipal code for alcohol licenses.

public-workscontractszoninginfrastructurealcohol-licensing
✓ Decided: Council approves Silvernail Road sanitary sewer special assessment

The City Council approved a resolution for a special assessment to install sanitary sewer along Silvernail Road from STH 318/Meadowbrook Road to Sussex Lane. The council also approved a sidewalk installation agreement with Waukesha County, a rezoning ordinance for S West Avenue, and amendments to municipal code regarding alcohol license agent residency and qualifications. All consent agenda items, including a certified survey map for a future Cobblestone Hotel, were passed unanimously.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Pieper, seconded by Ald. Moltzan, to approve the sidewalk installation agreement with Waukesha County. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
A motion was made by Ald. Moltzan, seconded by Ald. Wells, to approve the Rezoning Ordinance for S West Avenue. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
A motion was made by Ald. Wuteska, seconded by Ald. McElderry, to approve amendments to Mun. Code 9.09(1) regarding residency restrictions for Alcohol and Tobacco License Agents. The motion carried…
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
A motion was made by Ald. Wuteska, seconded by Ald. McElderry, to approve amendments to Mun. Code 9.09 and 9.11 regarding qualifications for "Class C" and Class "B" retail alcohol beverage licenses…
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00077 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00079 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00063 — approved
15 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#24-11265 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00031 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00083 — approved
15 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
Mon Feb 3, 2025 · 5:30 PM

Building and Grounds

Building and Grounds meeting canceled for February 3

The February 3, 2025, Building and Grounds Committee meeting has been canceled. The next regular meeting is scheduled for March 3, 2025, at 5:30 P.M. No business will be conducted at this canceled meeting.

cancelledbuilding-and-groundswaukesha
Council Chambers, City Hall
Mon Jan 27, 2025 · 6:00 PM

Library Public Art Committee

Committee to hear artist presentations and discuss Wickler donation

The Library Public Art Committee will hear presentations from three artists (Robin Jebavy, Jill Bedford, Jonathan Shaw) and may take action on selecting an artist. They will also discuss a donation from Chuck Wickler, along with consulting for Waukesha Reads, policy update next steps, and planning for a 20th anniversary celebration. The meeting includes approval of prior minutes and public comment.

librarypublic-artartistsdonationspolicyanniversary
✓ Decided: Committee recommends accepting Chuck Wickler donation to Library Board

The Library Public Art Committee met on January 27, 2025, and approved the December 16, 2024 meeting minutes. The committee unanimously recommended that the Library Board accept a donation from Chuck Wickler. Artist presentations were given by Robin Jebavy, Jill Bedford, and Jonathan Shaw, but no action was taken on them. Other items were discussed but not voted on.

Library Board Room
Mon Jan 27, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider three alcohol license applications

The Ordinance & License Committee will review three invited alcohol license applications: Devi Corner LLC and 3J Liquor LLC seek Class A Beer and Class A Liquor licenses, and Castle Hart LLC requests an extension of premise license for liquor and/or beer sales. The committee will also approve minutes from previous meetings.

licensesalcoholbeerliquorordinance-committeewaukesha
✓ Decided: Committee approves three liquor license applications unanimously

The Ordinance & License Committee approved three liquor license applications, all by a 5-0 vote. Devi Corner LLC's license is contingent on completing the Responsible Server Course. The committee also approved the January 13, 2025 minutes by unanimous consent.

Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ID#25-00067 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00068 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00069 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Thu Jan 23, 2025 · 5:30 PM

Board of Public Works

Board considers sanitary sewer assessment for Silvernail Road

The Board of Public Works will review a resolution to prepare plans and advertise bids for sanitary sewer installation on Silvernail Road. The body is also acting on several contract amendments and reviewing requests for one-time sewer credits.

sewerscontractsinfrastructurepublic-workssilvernail-road
✓ Decided: Board recommends Silvernail sewer assessment at $17,711.67 per address

The Board of Public Works recommended approval of the special assessment for sanitary sewer installation along Silvernail Road, amending it to Option 3 at $17,711.67 per address with a 5% interest rate over 10 years. The board also recommended awarding the low bid for Fire Station #1 boiler replacements to August Winter & Sons, Inc. for $53,400. Other recommendations included contract amendments and extensions for Clean Water Plant services, a change order for alley reconstruction, and approval of one-time sewer credits for nine residents. No bids were received for the Cemetery Admin Building HVAC replacement.

Council Chambers, City Hall
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of January 9, 2025, be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
motion to adjust the interest rate from 8% to 5% for 10 years, seconded by Member Kevin Reilly be recommended for approval. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the low bid from August Winter & Sons, Inc., for the 2025 Fire Station #1 Boiler Replacements be recommended for approval…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the Contract Amendment 6 for Operational Assistance Services with Strand Associates not to exceed $20,000 for on-going…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Contract extension with United Liquid Waste for bio-solids hauling for the City's Clean Water Plant be recommended for…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the Contract Change Order No. 1 with All-Ways Contractors, Inc., for the 2024 Alley Reconstruction project be recommended…
3 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea
A motion was made by Chairperson Steve Kassens, seconded by Ald. Eric Payne, that the Payments be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Member Kevin Reilly, seconded by Vice Chair Chad O'Donnell, to approve the one-time sewer credits for Angie Goodman, Nancy Roberts, Paul Newman, Gene Geiger, Candace Fleming…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
ID#25-00045 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00046 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00052 — recommended for approval
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00049 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00050 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00051 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00064 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#25-00063 — recommended for approval
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Wed Jan 22, 2025 · 6:00 PM

Plan Commission

Plan Commission to discuss 120-unit apartment project on Harris Highland Drive

The Plan Commission will hold public hearings and consider a conditional use permit for a hair salon, discuss conceptual plans for a 12-duplex development and a 120-unit apartment project, and vote on final site plans for a salt shed replacement and a warehouse addition. Also on the agenda is a rezoning petition for the Waukesha Water Utility Operations Center.

zoninghousingcommercialpublic-hearingsite-planrezoningapartmentsconditional-use-permit
✓ Decided: Plan Commission approves hair salon, salt shed, lumber addition, sign, rezoning

The Waukesha Plan Commission approved a conditional use permit for Elegant Hair LLC at 1501 Delafield Street, a final site plan for the Waukesha County salt shed replacement at 1641 Woodburn Road, a final site plan for a 10,200 sq. ft. addition to Bliffert Lumber at 2132 S. West Avenue, a sign variance for Catholic Charities at 717 N. East Avenue, and recommended approval of a rezoning for the Waukesha Water Utility Operations Center on Chapman Drive. All votes were 6-0 except the Bliffert Lumber item, which passed 5-1. The consent agenda, including a site plan for WEC Energy Group and a certified survey map for a future Cobblestone Hotel, was passed unanimously.

Council Chambers, City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
A motion was made by Member Shawn Reilly, seconded by Member Joan Francoeur, that this item be approved with conditions. The motion carried by the following vote:
5 yea · 1 nay
John Schmitz yea · Shawn Reilly yea · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea · R.G. Keller nay
PC24-0647 — approved with conditions
5 yea · 1 absent · 1 nay
John Schmitz yea · Shawn Reilly yea · Corey Montiho absent · R.G. Keller nay · Joan Francoeur yea · Elizabeth Moltzan yea · Jack Wells yea
The other 12 items passed by unanimous or near-unanimous consent.
Tue Jan 21, 2025 · 6:00 PM

City Council

Council to hold public hearings on rezoning and new condominium development

The City Council will conduct public hearings regarding a rezoning request on S. West Avenue and a site plan for the Hawks Landing Condominiums. The body will also consider transit service changes, road improvement agreements, and amendments to alcohol license requirements.

zoninghousingroadstransitbudgetalcohol-licenses
✓ Decided: Council approves Hawks Landing duplex development and West Avenue rezoning

The City Council approved the final site plan, architectural review, and PUD review for the Hawks Landing Condominiums, a 12-unit duplex development on Garden Prairie Drive, with a traffic calming bump out condition. It also approved rezoning 2.35 acres at 2001 S. West Avenue from M-1 to MM-1, including adjacent properties. The 2025 tax levy ordinance and several municipal code amendments were also approved.

Council Chambers, City Hall
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
A motion was made by Ald. Wells, seconded by Ald. Moltzan, to approve the Final Site Plan & Architectural Review and PUD Review - Garden Prairie Drive (Private), Hawks Landing Condominiums with all…
8 yea · 4 nay
Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea · Eric E. Payne nay · Paul Wuteska nay · Mike Anderson nay · Cory C. Payne nay
A motion was made by Ald. Wells, seconded by Ald. Moltzan, to approve PC24-0589 Certified Survey Map - Garden Prairie Drive (private) extended- A request to approve a one lot CSM covering 3.6933…
11 yea · 1 nay
Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Cory C. Payne yea · Doreen Wigderson yea · Eric E. Payne nay
A motion was made by Ald. Alicia Halvensleben, seconded by Ald. Joe Pieper, to go into Closed Session pursuant to Wisconsin Statutes §19.85(1)(e) to discuss the sale of .755 acres of City owned…
10 yea · 2 nay
Joe Pieper yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea · Eric E. Payne nay · Cory C. Payne nay
PC24-0588 — approved
8 yea · 5 nay · 2 absent
Mike Chrisien absent · Eric E. Payne nay · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska nay · Mike Anderson nay · Alicia Halvensleben yea · Frank McElderry nay · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay · Doreen Wigderson yea
PC24-0589 — approved
12 yea · 2 absent · 1 nay
Mike Chrisien absent · Eric E. Payne nay · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne yea · Doreen Wigderson yea
ID#25-00056 — approved
11 yea · 2 absent · 2 nay
Mike Chrisien absent · Eric E. Payne nay · Joe Pieper yea · Peter Bartels absent · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne nay · Doreen Wigderson yea
The other 12 items passed by unanimous or near-unanimous consent.
⚠️ FEMA flood zone AE at this address
Tue Jan 21, 2025 · 4:00 PM

Board of Building Appeals

Appeal for variance from stairway width code at 1205 Ellis St

The Board of Building Appeals will hear an appeal from homeowners Zachary & Nora Vick for a variance from Uniform Dwelling Code stairway width requirements at 1205 Ellis Street. The appellants argue the code does not cover the basement stairway width; if granted, the stairway would be less than the required 36-inch minimum.

building-appealsvarianceuniform-dwelling-codehousingproperty
Council Chambers, City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Adjournment — approved
3 yea · 2 absent
Jason Romenesko yea · Sarah Wilke absent · Brian Trautman yea · Dan Budde yea · Robert Ford absent
ID#24-11429 — approved
3 yea · 2 absent
Jason Romenesko yea · Sarah Wilke absent · Brian Trautman yea · Dan Budde yea · Robert Ford absent
ID#24-11430 — approved
3 yea · 2 absent
Jason Romenesko yea · Sarah Wilke absent · Brian Trautman yea · Dan Budde yea · Robert Ford absent
Thu Jan 16, 2025 · 6:00 PM

Waukesha Water Commission

Commission will hold closed session to discuss S.J. Louis Construction lawsuit

The Waukesha Water Commission will convene a closed session to confer with legal counsel about the ongoing S.J. Louis Construction v. City of Waukesha lawsuit. The commission will also approve payments from the General Fund and Improvement Fund, designate 2025 depositories, and approve the Hawk’s Landing Development agreement at no cost to the utility. Inspection fees of $41,032.97 for the Public Works Department will be approved, and performance and financial reports will be reviewed.

lawsuitfinancedepositoriesdevelopmentinspection-feeswater-utility
Water Utility Conference Room 115 Delafield St. Waukesha, Wi 53188
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
ID#25-00032 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
ID#25-00033 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
ID#25-00034 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
ID#25-00035 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
ID#25-00036 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
ID#24-10994 — approved
4 yea · 3 absent
Paul Ybarra absent · Joan Francoeur yea · Shawn Reilly yea · Jeff Fowle yea · Peter Bartels absent · Gerald Couri absent · Joe Piatt yea
Wed Jan 15, 2025 · 6:00 PM

Plan Commission

Plan Commission to review preliminary zoning code updates

The Waukesha Plan Commission will review a preliminary recommendations report for the Zoning Code Update. Commissioners and attendees can provide input on the recommendations. No final decisions are scheduled; this is a discussion item.

zoningplan-commissionwaukeshacode-update
✓ Decided: Plan Commission reviews zoning code update, takes no action

The Waukesha Plan Commission met on January 15, 2025, and reviewed the preliminary recommendations for a zoning code update. The item was for review and input only, with no formal action taken. All other agenda items were procedural.

Council Chambers, City Hall
Mon Jan 13, 2025 · 4:00 PM

Board of Zoning Appeals

Board will consider two dimensional variance appeals for driveway and gazebo

The Board of Zoning Appeals will review two dimensional variance requests. Jeff Wasson seeks permission to build a driveway up to the lot line at 1108 Lynne Drive, overriding the usual five‑foot side‑lot setback. Julie Faubel requests a variance to place a gazebo behind her L‑shaped house at 1823 Sycamore Drive, extending into the rear yard beyond standard accessory‑structure limits. The board will decide whether to grant each variance.

zoningvariancesresidentialpermitsboard-of-zoning-appeals
✓ Decided: Board denies two zoning variance appeals for driveway and gazebo

The Board of Zoning Appeals denied both variance requests on the agenda. Jeff Wasson's appeal for a driveway with no side setback at 1108 Lynne Drive was denied 3-2. Julie Faubel's appeal for a gazebo placement at 1823 Sycamore Drive was denied unanimously 5-0. The board also approved the December 9, 2024 minutes.

Council Chambers, City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ID#24-11496 — denied
3 yea · 2 nay
Ed Raether yea · Christine D'Angelo yea · Kevin Reilly yea · Bryan Erickson nay · Timothy Retic nay
The other 5 items passed by unanimous or near-unanimous consent.
Mon Jan 13, 2025 · 6:00 PM

Ordinance & License Committee

Committee to consider changes to alcohol license qualifications and residency restrictions

The Ordinance & License Committee will discuss and recommend amendments to city code regarding residency restrictions for alcohol and tobacco license agents, and qualifications for Class C and Class B retail alcohol beverage licenses. The committee will also consider new license applications from Fisk Avenue LLC for beer and wine sales, and a rooming house at 362 West Main St.

licensesalcoholrooming-housecode-amendmentsresident-restrictions
✓ Decided: Committee approves wine license, rooming house, and code changes

The Ordinance & License Committee approved a Class C wine license for Fisk Avenue LLC and a rooming house application for 362 West Main St, both unanimously. It also recommended amendments to municipal code sections 9.09(1) and 9.09/9.11 regarding residency restrictions for alcohol/tobacco license agents and qualifications for Class C and B retail alcohol licenses, all by unanimous votes. No public comment was made, and the meeting adjourned at 6:22 PM.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ID#24-11403 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00004 — approved
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#24-11265 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
ID#25-00031 — Recommended for Second Reading
5 yea
Paul Wuteska yea · Alicia Halvensleben yea · Daniel Manion yea · Mike Anderson yea · Doreen Wigderson yea
Thu Jan 9, 2025 · 4:45 PM

Library Board

Waukesha Library Board to review 2025 strategic plan and director evaluation

The Library Board will discuss the 2025 Strategic Plan goals and review a statistical snapshot of 2024 savings. The board also plans to enter a closed session to discuss the Library Director's annual performance evaluation.

librarystrategic-planningpersonnelpublic-art
✓ Decided: Library Board approves 2.5% salary increase for Library Director

The Library Board approved the January bills and financial reports, accepted the Public Art Committee's recommendation to keep two art pieces, and approved a 2.5% salary increase for the Library Director after a closed session. All votes were unanimous.

Library Board Room
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Bills — approved
7 yea · 4 absent
Melissa Baxter absent · Martha Ryan absent · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
Financial Reports — approved
7 yea · 4 absent
Melissa Baxter absent · Martha Ryan absent · Dr. Kevin Guilfoy absent · Sandra Ammerman yea · Erik Helgestad yea · Betsy Forrest yea · Bonnie Byrd yea · James Sebert absent · Alicia Halvensleben yea · Austin Dutter yea · Megan Lach yea
ID#24-11492 — adopted
4 absent
Melissa Baxter absent · Martha Ryan absent · Dr. Kevin Guilfoy absent · James Sebert absent
Thu Jan 9, 2025 · 5:30 PM

Transit Commission Meeting

Public hearing on transit service changes effective June 2025

The Transit Commission will hold a public hearing on proposed service changes set to take effect June 2, 2025. Following the hearing, the commission will discuss and vote on a resolution approving route revisions for Routes 3, 6, 8, and 15, along with associated bus stop changes. The commission will also consider revisions to the Public Hearing Notice Policy and receive an analysis of on-demand transit service.

transitpublic-hearingservice-changesroute-revisionspolicy
✓ Decided: Transit Commission recommends June 2025 service changes to Council

The Transit Commission held a public hearing on proposed service changes effective June 2, 2025, with no public comments submitted except from Pro Health Care. The commission voted 4-0 to recommend the service changes for Council consent and approved revisions to the Public Hearing Notice Policy. Minutes from December 5, 2024, were also approved.

Council Chambers, City Hall
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
motion to open the public hearng at 5:32 p.m., seconded by Member Kevin Reilly. Motion carried by the following vote
4 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea
motion to close the public hearing at 5:46 p.m., seconded by Member Kevin Reilly. Motion carried by the following vote:
4 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made that the Minutes of December 5, 2024, be approved. The motion carried by the following vote:
3 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly that the revisions to the Public Hearing Notice Policy be approved. The motion carried by the following vote:
4 yea
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea
ID#24-11513 — approved
4 yea · 1 absent
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11514 — recommended for Council Consent
4 yea · 1 absent
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11515 — approved
4 yea · 1 absent
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Public Hearing- Proposed Service Changes Effective June 2, 2025 — approved
4 yea · 1 absent
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Public Hearing Presentation of Service Changes Effective June 2, 2025 — approved
4 yea · 1 absent
Chad O'Donnell yea · Steve Kassens yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Thu Jan 9, 2025 · 5:30 PM

Board of Public Works

Board to act on state road grant agreements for N. University Dr. and STH 59

The Board of Public Works will review and recommend to the City Council on two state agreements with the Wisconsin Department of Transportation: a revised LRIP grant for N. University Drive reconstruction and a separate agreement for STH 59 from Sunset Dr. to Arcadian Ave. The board will also act on a contract change order for Buchner Park baseball lighting upgrades. Routine approvals of minutes and payments are scheduled, and bids for HVAC and boiler replacements will be opened later.

public-worksroadsgrantswisconsin-dotcontractslightingbiddingwaukesha
✓ Decided: Board recommends three WisDOT road agreements to Council

The Board of Public Works voted 4-0 (with one absence) to recommend three items to the Common Council for consent: a revised state agreement for the N. University Drive reconstruction, a state agreement for STH 59 work from Sunset Dr. to Arcadian Ave., and a change order for Buchner Park ball diamond lighting. The board also approved payments and heard a report on the 2024 leaf collection, which saved $140,000.

Council Chambers, City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the Minutes of December 19, 2024, be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric Payne, seconded by Member Kevin Reilly, that the revised Two-Party State Municipal Agreement between the City of Waukesha and the Wisconsin Department of Transportation…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Member Kevin Reilly, seconded by Ald. Eric Payne, that the Two-Party State Municipal Agreement between the City of Waukesha and the Wisconsin Department of Transportation…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Ald. Eric E. Payne, seconded by Member Kevin Reilly, that the Contract Change Order No. 1 with Pieper Electric, Inc. for 2024 Buchner Park Ball Diamond Lighting Upgrades be…
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
A motion was made by Vice Chair Chad O'Donnell, seconded by Member Kevin Reilly, that the Payments be approved. The motion carried by the following vote:
4 yea
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea
ID#24-11520 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11521 — approved
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11522 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11525 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
ID#24-11526 — recommended for Council Consent
4 yea · 1 absent
Steve Kassens yea · Chad O'Donnell yea · Kevin Reilly yea · Eric E. Payne yea · Joe Pieper absent
Wed Jan 8, 2025 · 6:00 PM

Landmarks Commission

Commission to act on Blair House National Register boundary adjustment

The Landmarks Commission will consider approving minutes from November and December 2024, discuss the Paint and Repair Grant Funds, and take possible action on a pending application to adjust the boundaries of the National Register listing for the Senator William and Henrietta Blair House at 130 Delafield Street. The commission will also review a draft response letter regarding the application.

historic-preservationlandmarks-commissionnational-registerblair-houseboundary-adjustmentgrant-fundswaukesha
✓ Decided: Landmarks Commission approves prior minutes, holds Blair House letter

The Landmarks Commission approved the minutes from its November 6 and December 4, 2024 meetings. It discussed but took no action on a draft response letter regarding the National Register boundary adjustment for the Senator William and Henrietta Blair House, holding the item until the next meeting. No other substantive decisions were made.

Council Chambers, City Hall
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Member Carmen De La Paz, seconded by Member Elizabeth Moltzan, that the Minutes of November 6, 2024 be approved. The motion carried by the following vote:
3 absent · 2 yea
Aaron Spencer yea · Elizabeth Moltzan yea · Marty Larson absent · Jennifer Wall absent · Julie Scarpace absent
A motion was made by Member Elizabeth Moltzan, seconded by Member Carmen De La Paz, that the Minutes of December 4, 2024 be approved. The motion carried by the following vote:
3 yea
Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#24-11519 — approved
4 yea · 3 absent
Marty Larson absent · Jennifer Wall absent · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak yea · Aaron Spencer yea · Elizabeth Moltzan yea
ID#24-11275 — approved
3 absent · 3 yea · 1 abstain
Marty Larson absent · Jennifer Wall absent · Julie Scarpace absent · Carmen De La Paz yea · Matt Retzak abstain · Aaron Spencer yea · Elizabeth Moltzan yea
Tue Jan 7, 2025 · 6:00 PM

City Council

Council considers land use change for former UWM-Waukesha campus

The City Council will hold a public hearing regarding a request to change the land use category of the 75.9-acre UWM-Waukesha campus at 1500 N. University Drive to Residential Flexible. The body will also consider a zoning code amendment to remove a supermajority vote requirement for certain zoning changes.

zoningland-usehousingcontractspublic-works
✓ Decided: Council approves UWM-Waukesha campus land use change to residential

The City Council approved a comprehensive plan amendment changing the land use designation for the 75.9-acre UWM-Waukesha campus from Civic and Institutional to Residential Flexible, anticipating future redevelopment. The council also approved the consent agenda, including a sponsorship agreement with DICK's Sporting Goods and a temporary easement with WisDOT, and approved the 2025 Capital Improvement Projects. Several claims for damages were approved or denied as recommended.

Council Chambers, City Hall
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Ald. E. Payne, seconded by Ald. Manion, to approve the Minutes from December 17, 2024. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. Moltzan, to approve Joseph Knauer's Claim for damages to auto. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. Moltzan, to deny Jeff Wehr's Claim for damages to vehicle. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Moltzan, seconded by Ald. McElderry, to deny Michele Neilson's Claim for property damage. The motion carried by the following vote: Page 3City of Waukesha January 7…
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Wells, seconded by Ald. R. Lemke, to approve the Comprehensive Plan Amendment for the UWM-Waukesha Campus, 1500 N.University Drive. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Pieper, seconded by Ald. E. Payne, to approve 2025 CIP Projects (Department of Public Works Program). The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
A motion was made by Ald. Wells, seconded by Ald. Pieper, to approve Board and Committee Appointments. The motion carried by the following vote:
13 yea
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Dean D. Lemke yea · Rick R. Lemke yea · Doreen Wigderson yea
ID#24-11449 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
PC24-0630 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#24-11527 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#24-11532 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#24-11537 — denied
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-11541 — denied
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
ID#25-11542 — approved
14 yea · 1 absent
Mike Chrisien yea · Eric E. Payne yea · Joe Pieper yea · Peter Bartels yea · Jack Wells yea · Daniel Manion yea · Elizabeth Moltzan yea · Paul Wuteska yea · Mike Anderson yea · Alicia Halvensleben yea · Frank McElderry yea · Dean D. Lemke yea · Rick Lemke yea · Cory C. Payne absent · Doreen Wigderson yea
Mon Jan 6, 2025 · 5:30 PM

Building and Grounds

Committee reviews Washington-Lindbergh intersection, considers $4,300 improvements

The Building and Grounds Committee will discuss and possibly recommend action on several traffic and parking issues. A held item from October reviews the Washington Avenue and Lindbergh Avenue intersection, with an estimated $4,300 for pavement markings and signing. New requests include traffic studies on Cleveland Avenue and East Avenue, a speed study on Sunset Drive, no-parking zones on National Avenue and East North Street, and caution signs for a child with disabilities on Garfield Avenue.

trafficparkingsafetyspeed-limitpublic-worksbudgetpedestrian
✓ Decided: Building and Grounds recommends traffic, parking, and speed changes

The Building and Grounds Committee unanimously recommended six traffic and parking measures for City Council approval, including curve warning signs, no parking zones, speed limit changes, and a child disability sign. All votes were 5-0. A speed study on East Avenue was discussed but no action was taken.

Council Chambers, City Hall
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
ID#24-11502 — approved
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-10754 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-10989 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-11503 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-11504 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-11508 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea
ID#24-11509 — recommended for Council Consent
5 yea
Eric Payne yea · Cory C. Payne yea · Rick Lemke yea · Dean D. Lemke yea · Mike Anderson yea