The Boring PartsFederalLocal · USLocal · Canada
Woodbridge, NJ

Woodbridge public meetings in 2025

146 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Tue Dec 16, 2025

Council

Woodbridge Council to discuss traffic and road improvements

The Council will hold a work session to discuss a traffic ordinance amendment and road improvements. Items discussed at this meeting are scheduled for action on January 6, 2025.

trafficroadsinfrastructurenjdot
Tue Dec 16, 2025

Council

Woodbridge Council to review liquor license transfer for 85 Lafayette Rd.

The council will meet to discuss a variety of ward-specific projects and community initiatives. The agenda includes a specific application for a liquor license transfer in Fords.

liquor-licenseredevelopmentroadspublic-works
✓ Decided: Council meeting listed agenda items but recorded no decisions

The December 16, 2025 Woodbridge Township Council meeting recorded a list of agenda topics presented by council members. No votes, approvals, denials, or other formal actions were documented in the minutes. Therefore, the meeting did not record any substantive decisions.

Tue Dec 16, 2025

Council

Council approves acquisition of parcel near Smith and Newton Streets

The Woodbridge Township Council approved the minutes from the December 2, 2025 meeting and adopted several traffic and parking ordinances, including changes on Ridgedale Avenue, Park Place and Madaline Drive, and electric‑vehicle parking spaces. The council also authorized the acquisition of a parcel identified on the GPPM dated February 19, 2025, located near Smith Street and Newton Street. An ordinance establishing salary ranges for township employees was adopted, and a series of resolutions authorizing refunds, reappointments, and appointments were approved.

trafficparkingproperty-acquisitionsalariesrefundsappointments
✓ Decided: Council unanimously adopted new traffic ordinances, a property acquisition, and salary ranges

The Woodbridge Township Council approved five traffic‑related ordinances, including parking restrictions on Ridgedale Avenue, new parking on Park Place and Madaline Drive, and a revision of electric‑vehicle charging spaces. The Council also authorized the acquisition of a parcel near Smith and Newton Streets and adopted a salary‑range ordinance for township employees. Additional actions included multiple tax and sewer refunds, a liquor‑license transfer, and numerous reappointments of board and commission members.

Thu Dec 11, 2025

Zoning Board of Adjustment

Board will hear variances for a car wash conversion and several residential additions

The Woodbridge Zoning Board of Adjustment meeting on December 11, 2025 will approve the minutes from the November 13, 2025 regular meeting and consider a list of pending resolutions, some granted and some denied. The board will hold public hearings on multiple minor site plan, use and bulk variances, including a proposal to convert 1247 Saint Georges Avenue into a car wash and storage area. Additional hearings will address residential additions at 80 Woodbine Avenue, 124 Cleveland Avenue, 45 Thompson Avenue, and 85 Marconi Avenue.

zoningvariancesland-usehearingspermits
Wed Dec 10, 2025

Planning Board

Planning Board to consider site plans and a mausoleum project

The Woodbridge Township Planning Board will approve minutes from the November meeting and hear public comments on four site plan applications, including a proposed mausoleum and a solar panel installation.

planningzoningsite-planpublic-hearingwoodbridgeavenelcoloniacemeteries
Thu Dec 4, 2025

Public Library

Woodbridge Public Library Trustees to meet December 4

The Board of Trustees will meet to review director and board reports and handle new business. The agenda includes a recognition resolution and personnel matters.

librarypublic-meetingswoodbridge
✓ Decided: Board authorized a Cooperative Pricing Agreement for library purchases

The Board approved two resolutions: one to fund restroom upgrades and foot‑traffic counter improvements using up to $6,000 from the Facilities Reserve, and another to let the Library Director enter a Cooperative Pricing Agreement for goods and services. The Board also approved the appointment of Lily Amaya as a part‑time Library Assistant and accepted the resignation of Dan Dias. Finally, the Board approved bill lists totaling $133,132.66. All motions carried with unanimous approval.

Tue Dec 2, 2025

Council

Council will consider bond ordinances for $5.65 million in equipment and improvements.

The Woodbridge Township Council will hold a second reading of two bond ordinances that would appropriate $3,450,000 for various public improvements and new equipment, and $2,200,000 for replacement compressor units at the community‑center ice rink. The agenda also includes first‑reading of multiple traffic, parking, and administrative ordinances, as well as a series of resolutions covering appointments, refunds, software purchases, and liquor‑license transfers. All items are listed for discussion or approval at the December 2, 2025 regular meeting.

bondsfinancetrafficpolicesoftwarelicensingpublic‑improvements
Tue Dec 2, 2025

Council

Woodbridge Council adopts Route 1 Redevelopment Plan for Area 7

The Municipal Council voted to adopt the amended Route 1 Redevelopment Plan for Area 7 and approved several traffic and parking ordinances. The body also authorized various professional service contracts and municipal appointments.

redevelopmenttrafficparkingcontractspoliceappointments
✓ Decided: Council unanimously adopted multiple traffic, parking and acquisition ordinances

The council approved the minutes from the November 25, 2025 meeting and adopted ordinances A‑J by consent, covering traffic restrictions on Ridgedale Avenue, new electric‑vehicle parking spaces, acquisition of parcel P1 near Smith and Newton Streets, and township salary ranges. It also approved a series of resolutions appointing and reappointing officials, authorizing various refunds, software purchases, a liquor‑license transfer, and withdrawing support for Mad Hatter Dispensaries’ cannabis business. All motions were carried unanimously.

Tue Dec 2, 2025

Council

Woodbridge Council to review liquor license transfers

The council will consider several person-to-person and place-to-place liquor license transfers. The agenda also lists a wide range of council member priorities and recurring municipal administrative items.

liquor-licensesroadsredevelopmentpublic-safetyadministration
✓ Decided: No council decisions were recorded in the meeting minutes

The December 2, 2025 Woodbridge Township Council minutes list numerous agenda items, including holiday events, redevelopment projects, and liquor‑license transfers. The document does not record any votes, approvals, denials, or other formal actions taken by the council. Consequently, no substantive decisions are documented.

Tue Nov 25, 2025

Council

Council adopts FY2026 Main Street & Oak Tree Road SID budgets, passes budget ordinance

The Woodbridge Municipal Council opened a public hearing on the FY2026 Municipal Budget and the Main Street and Oak Tree Road Special Improvements District (SID) budgets. The council adopted an ordinance (2025-79) to exceed budget appropriation limits and establish a CAP Bank. It also approved the FY2026 Main Street SID budget of $310,000 and the Oak Tree Road SID budget of $517,965. The hearing was continued to January 20, 2026 at 5:00 PM.

budgetspecial-improvements-districtordinancefinancemunicipal-budgetcouncil
✓ Decided: Council adopted FY2026 Main Street and Oak Tree Road SID budgets, exceeding limits

The council opened a public hearing on the FY2026 municipal, Main Street SID and Oak Tree Road SID budgets and received no public comments. It unanimously adopted an ordinance to exceed budget appropriation limits and create a CAP Bank. The FY2026 Main Street SID budget of $310,000 and the Oak Tree Road SID budget of $517,965 were also adopted, and the municipal budget hearing was continued to Jan 20 2026.

Thu Nov 13, 2025

Zoning Board of Adjustment

Zoning Board to consider house of worship and residential variances

The Zoning Board of Adjustment will hold public hearings on four variance requests. The board will also tentatively adopt resolutions for four previously granted applications.

zoningpublic-hearinghousingreligious-facilitiesvariances
Wed Nov 12, 2025

Planning Board

Planning Board considers 30-unit apartment building on New Street

The Planning Board will hold a public hearing regarding a proposal for a four-story apartment building and associated parking. The board will also consider the adoption of a resolution for the Amended Route 1 Redevelopment Plan Redevelopment Area 7.

zoninghousingredevelopmentpublic-hearingapartments
Tue Nov 11, 2025

Council

Council approves $5.65 M in bond authorizations for public improvements and ice‑rink equipment

The Woodbridge Township Council adopted several traffic and health ordinances, including changes to Judy Drive parking hours and grease‑trap regulations. It approved two bond ordinances authorizing $3,450,000 for various public improvements and $2,200,000 for replacement compressor units at the community‑center ice rink. The Council also passed numerous resolutions covering refunds, grants, shared‑service agreements, and equipment purchases.

bondstrafficpublic-workspolicehousingfinance
✓ Decided: Council approves $3.45M bond ordinance for public improvements

The Woodbridge Municipal Council unanimously approved two bond ordinances, allocating $3,450,000 for various public improvements and $2,200,000 for replacing compressor units at the community‑center ice rink. The council also adopted several traffic‑related ordinances, including changes to Judy Drive parking hours and updates to traffic signal and pedestrian flashing listings, as well as a grease‑trap regulation amendment. Additional resolutions authorized the annual tree‑lighting sponsorship, refunds for overpaid taxes and sewer fees, and a shared‑services radio‑communications agreement among multiple fire departments.

Mon Nov 10, 2025

Council

Woodbridge Council to discuss tax refunds and veteran resolutions

The Woodbridge Township Council will discuss several administrative requests, including resolutions for tax and sewer overpayments, parking permit refunds, and a resolution for 100% disabled veterans. The body will also consider a change order for P & A Construction and drainage improvements at nine locations.

counciltaxsewerveteransconstructiondrainage
Mon Nov 10, 2025

Council

Woodbridge Council to review four liquor license transfers

The Municipal Council will meet to discuss various ward-specific projects and community initiatives. The agenda includes several applications for the transfer of liquor licenses.

liquor-licensesredevelopmentpublic-safetyinfrastructure
✓ Decided: Council listed agenda items but recorded no decisions

The November 10 Woodbridge Council meeting agenda covered topics such as holiday lighting, redevelopment projects, senior centers, and several liquor‑license transfers. The minutes do not record any approvals, denials, vote tallies, or other formal actions. Consequently, no substantive decisions were documented at this meeting.

Mon Nov 10, 2025

Council

Council approves $3.45 M bond ordinance for township public improvements

The Woodbridge Township Municipal Council adopted several ordinances, including bond authorizations for $3,450,000 of public improvements and $2,200,000 for ice‑rink compressor replacement. Traffic and health ordinance amendments were taken up on second and third reading and approved by consent. The council also passed a series of resolutions covering refunds, grants, shared‑service agreements, and equipment purchases.

bondstrafficpublic-workspoliceenvironmenthousing
✓ Decided: Council approved $3.45 M bond ordinance for public improvements

The Woodbridge Township Council adopted several traffic ordinances and a grease‑trap regulation by unanimous consent. It also approved two bond ordinances—$3.45 M for general public improvements and $2.2 M for ice‑rink compressor replacement—on first reading. A series of resolutions covering community events, tax refunds, fire‑district compensation, and multiple service contracts were also adopted unanimously.

Mon Nov 10, 2025

Council

Woodbridge Council considers $5.65 million in bond ordinances for equipment and repairs

The Council will vote on bond ordinances for public improvements and ice rink compressor replacements. The meeting also includes discussions on traffic regulations, redevelopment plans, and various municipal contracts.

budgetinfrastructurepoliceredevelopmenttrafficpublic-works
Thu Oct 23, 2025

Zoning Board of Adjustment

Zoning Board to review residential and business variance requests

The Zoning Board of Adjustment will hold public hearings for five variance applications. These requests include residential modifications and one proposal to convert a home into office space for a construction business.

zoningvariancesresidential-constructioncommercial-usepublic-hearings
Thu Oct 23, 2025

Public Library

Board to approve facilities reserve projects and county education membership

The Woodbridge Public Library Board will consider two resolutions: one to approve facilities reserve funded projects and another to approve membership in the Hunterdon County Education Cooperative. The meeting will also address personnel matters, approval of bills, and any other items the board brings forward. Public comments are scheduled before the meeting closes.

facilitieseducationmembershippersonnelbudget
Wed Oct 22, 2025

Planning Board

Amazon.com Services proposes a major site plan adding 57 parking spaces at 275 Omar Ave.

The Planning Board will approve minutes from its October 8, 2025 meeting and consider a resolution for Corrected Knock on Wood, LLC. Public hearings will address a subdivision extension request for 1 & 15 Montrose Ave., a parking lot expansion of 44 spaces at the Goddard school on 400 Gill Lane, and a major site plan by Amazon.com Services to add 57 parking spaces, new fencing, gates, and an attendant kiosk at 275 Omar Avenue.

zoningdevelopmentparkingpublic-hearingwoodbridge
Tue Oct 21, 2025

Council

Council reviews multiple liquor license transfers and corporate changes

The Woodbridge Township Council will consider several person‑to‑person liquor license transfer applications, including changes of corporate structure for specific establishments. The agenda also lists other community topics such as redevelopment projects, senior centers, and local events, but no decisions are detailed for those items. No further action items are specified beyond the listed agenda points.

liquor-licensesredevelopmentsenior-centerscommunity-eventsinfrastructure
✓ Decided: No council decisions were recorded in the October 21, 2025 meeting.

The minutes list numerous agenda items ranging from holiday events to redevelopment projects. However, the record does not include any votes, approvals, denials, or other formal actions taken by the council. Consequently, no substantive decisions can be reported from this meeting.

Tue Oct 21, 2025

Council

Council approves traffic ordinances and emergency contracts

The Woodbridge Municipal Council approved three ordinances, including one to authorize a lease for the Woodbridge Wolfpack Hockey Club at 585 Main Street. The body also authorized emergency contracts for HVAC repairs at the Community Center and sewer work on Rahway Avenue, and set a public hearing for November 10 regarding traffic and health regulations.

councilordinancehockeycontractssewertrafficpublic-hearing
✓ Decided: Council unanimously adopted several traffic ordinances and approved emergency contracts

The Woodbridge Township Council approved three second‑reading traffic ordinances, a lease of 585 Main Street, and several first‑reading traffic amendments. It also adopted multiple emergency agreements and refunds, and approved the Bill List. All actions were carried unanimously, with two members abstaining on the Bill List.

Tue Oct 21, 2025

Council

Council considers property lease at 585 Main Street and various traffic ordinances

The Council will vote on second readings for traffic ordinances and a property lease at 585 Main Street. The meeting includes first readings for grease trap regulations and parking changes on Judy Drive, as well as several emergency infrastructure contracts.

trafficzoninginfrastructurereal-estatebudget
Tue Oct 21, 2025

Council

Council to consider a resolution on tax and sewer overpayments

The Woodbridge Council work session will discuss several items, including a resolution on tax and sewer overpayments. The session also reviews traffic ordinance amendments and multiple change orders for public works projects. Action on these items is scheduled for the November 10, 2025 meeting.

financetaxessewerpublic-workstransportationordinances
Thu Oct 9, 2025

Zoning Board of Adjustment

Public hearing on bulk variance for 51 Hagaman Street, Port Reading

The Woodbridge Zoning Board of Adjustment will approve minutes from the September 25, 2025 meeting and adopt several resolutions for Outfront Media, LLC. The board will deny a variance request by Parth Patel. Several public hearings on use and bulk variances will be held, including a proposal to demolish and rebuild a two‑family dwelling at 51 Hagaman Street, Port Reading.

zoningvariancespublic-hearingboard-of-adjustmenthousing
Wed Oct 8, 2025

Planning Board

Public hearing on minor site plan to add 44 parking spaces at Goddard School

The Woodbridge Planning Board will approve minutes from the September 24, 2025 meeting and consider a resolution for Knock on Wood, LLC (P25-14). The board will review a redevelopment investigation for Block 880 Lot 3 and Lot 4 at 10 and 20 Production Way in Avenel. A public hearing will be held on a minor site plan at 400 Gill Lane, Iselin, where the applicant seeks to enlarge the parking lot by 44 spaces at the Goddard school.

planningredevelopmentpublic-hearingparkingzoning
Tue Oct 7, 2025

Council

Woodbridge Council considers $11.5 million for waterfront, marina, and court projects

The Council is reviewing several high-value capital ordinances for infrastructure and property acquisition. The meeting also includes first readings on traffic ordinance repeals and various community grant agreements.

infrastructurebudgetzoningpublic-worksgrants
Tue Oct 7, 2025

Council

Council to discuss multiple resolutions and a traffic ordinance amendment

The Woodbridge Council meeting on October 7, 2025 will discuss several items presented by administration and department heads. Items include resolutions on tax and sewer overpayments, parking permit refunds, a developer’s review fund refund, and a public works "Brew" resolution, as well as an amendment to the traffic ordinance. The council is scheduled to take action on these items at a later meeting on October 21, 2025.

financeparkingtrafficplanningpublic-works
Tue Oct 7, 2025

Council

Woodbridge Council to review liquor license transfers

The council will consider several liquor license transfers and corporate structure changes. The agenda also lists a wide array of council member focus areas and community projects for discussion.

liquor-licensesredevelopmentroadscommunity-events
✓ Decided: Council presented agenda items; no decisions recorded

The Woodbridge Township Council meeting on October 7, 2025 listed numerous agenda topics ranging from holiday events to redevelopment projects. The minutes do not record any votes, approvals, denials, or other formal actions on these items. Consequently, no substantive decisions were documented.

Tue Oct 7, 2025

Council

Council approves $4 M waterfront walkway, marina, and court property projects

The Woodbridge Township Council adopted several ordinances, including a $4,000,000 capital ordinance for the Woodbridge Waterfront Walkway Project funded by a federal grant, a matching $4,000,000 ordinance for Sewaren Marina improvements funded by a state grant, and a $3,500,000 bond ordinance to acquire property on Berry Street for a new municipal court facility. Additional actions included vacating a portion of Metuchen Avenue, adding a handicapped parking space on Fairfield Avenue, and approving the purchase of 511 Cliff Road. The council also passed a series of resolutions authorizing tax refunds, a security officer appointment, and multiple Community Development Block Grant agreements.

financeinfrastructurepublic-workscourtstransportationgrants
✓ Decided: Council approved $4M waterfront walkway project and $4M Sewaren Marina improvements

The council adopted several ordinances, including vacating a portion of Metuchen Avenue and authorizing $4,000,000 capital projects for the Woodbridge Waterfront Walkway and Sewaren Marina. It also approved a $3,500,000 bond to acquire property on Berry Street and added a handicap parking space on Fairfield Avenue. Additional actions included acquiring 511 Cliff Road, repealing certain traffic rules, and appointing a new township security officer.

Thu Sep 25, 2025

Public Library

Board to approve auditor for FY 2024‑2025

The Woodbridge Public Library Board will hear routine reports and then consider new business. The agenda includes a resolution to approve the auditor for fiscal year 2024‑2025. The board may also address personnel matters, approve pending bills, and consider any other items brought before it.

libraryfinancepersonnelgovernanceaudit
✓ Decided: Board approved $500,000 reserve for library facilities operations

The Board of Trustees adopted a resolution to set aside $500,000 for library facilities operations. It also approved a $94,500 labor contract for lighting upgrades at the Iselin Branch. Personnel changes were approved, including a new part‑time page and two resignations. Two bill lists totaling $225,783.84 were approved.

Thu Sep 25, 2025

Zoning Board of Adjustment

Zoning Board to review house of worship and industrial lab proposals

The Zoning Board of Adjustment will hold public hearings for four variance and site plan applications. The board will also consider the adoption of resolutions for four previous cases.

zoningpublic-hearingvariancesland-useindustrial
Wed Sep 24, 2025

Planning Board

Board to approve $11.5M in waterfront and marina projects

The Woodbridge Planning Board will review resolutions to adopt capital ordinances for the Woodbridge Waterfront Walkway and Sewaren Marina projects, as well as an ordinance for a municipal court property acquisition. The board will also acknowledge a request to investigate a potential redevelopment designation for a property in Avenel.

planning-boardwaterfrontmarinaredevelopmentzoningsubdivisionbond-ordinance
Tue Sep 23, 2025

Council

Council to discuss tax refunds and traffic safety markings

The Woodbridge Township Council will discuss administrative requests for a work session on September 23, 2025, including tax and sewer overpayments and a parking permit refund. The council is also set to consider a resolution regarding pavement markings at the intersection of Inman Avenue and Savoth Lane.

counciltaxespavement-markingstraffic-safetyresolutionswork-session
Tue Sep 23, 2025

Council

Council to authorize $11.5M in grants and contracts

The Woodbridge Municipal Council will consider ordinances for handicapped parking on three streets and authorize $11.5 million in capital projects and contracts, including the Woodbridge Waterfront Walkway and sewer improvements.

budgetcontractsinfrastructuresewerparkinggrantmunicipal-court
Tue Sep 23, 2025

Council

Council reviews multiple liquor license transfers and corporate changes

The Woodbridge Municipal Council will consider several person‑to‑person liquor license transfers, including changes of corporate structure for three establishments. The agenda also includes discussion of liquor license incidents, renewals, street closings for special events, upcoming elections, and a best practices inventory.

liquor-licensesbusinesspublic-safetyelectionsspecial-events
✓ Decided: Council presented agenda items but recorded no decisions

The September 23, 2025 Woodbridge Township Council meeting listed numerous agenda topics, including holiday events, redevelopment projects, and liquor license transfers. The minutes do not record any votes, approvals, denials, or other formal actions on these items. Consequently, no substantive decisions were documented.

Tue Sep 23, 2025

Council

Council approves $4 M Waterfront Walkway project funded by federal grant

The Woodbridge Township Council adopted capital ordinances to appropriate $4,000,000 for the Waterfront Walkway project using a federal grant and $4,000,000 for Sewaren Marina improvements using a state grant. A bond ordinance was approved to appropriate $3,500,000 for acquiring property for a future municipal court. The council also approved several contracts, including a $5,026,272 milling and resurfacing program and a $98,600 intersection improvement project. Handicapped parking spaces were added on Laurel, Douglas, and Fairfield streets through ordinance amendments.

capital-projectsinfrastructurefinancepublic-worksparkingcontracts
✓ Decided: Council approved $4 M Waterfront Walkway project funded by federal grant

The council unanimously approved the minutes from the September 9, 2025 meeting. It adopted three handicapped‑parking ordinances for Laurel Street, Douglas Street and Fairfield Avenue, and postponed the Metuchen Avenue vacate ordinance to the October 7 meeting. The council also passed a capital ordinance authorizing a $4 million Waterfront Walkway project using a federal grant, along with related capital and bond ordinances.

Thu Sep 11, 2025

Zoning Board of Adjustment

Board to consider a house of worship variance for 156-seat facility at 400 Green St

The Woodbridge Zoning Board of Adjustment will first approve the minutes from its August 28 meeting. It will then hold public hearings on several variances, including a minor site plan for a 156‑seat house of worship at 400 Green Street. Additional hearings will address driveway widening, a backyard patio, a home addition with a covered patio, and a conversion of an upstairs unit from one to three bedrooms.

zoningvarianceshousingreligious-useconstruction
Wed Sep 10, 2025

Planning Board

Planning Board to hear a minor site plan for parking at 190 Homestead Ave

The Board will first approve the minutes from its August 27, 2025 meeting. It will then hold a public hearing on a Minor Site Plan proposing 27 new onsite parking spaces at 190 Homestead Ave, Avenel. A second public hearing will consider a Preliminary/Final Major Subdivision and Bulk Variances for 203 Middlesex Ave, Iselin, which would split a 14,000‑sq‑ft lot into two parcels, one retaining an existing house and the other for a new single‑family dwelling.

planningzoningparkingsubdivisionhousingdevelopment
Tue Sep 9, 2025

Council

Intersection improvements at Oak Tree Road and Middlesex Avenue

The Woodbridge Council will discuss a series of administration‑requested items on September 9, 2025, including resolutions on tax and sewer overpayments, a 100% disabled‑veteran exemption, and a traffic ordinance amendment. The council is scheduled to act on September 23, 2025, on items such as the intersection improvements at Oak Tree Road and Middlesex Avenue, a change order for P&A Construction, and the 2025 milling and resurfacing program.

financepublic-safetytransportationinfrastructureplanning
Tue Sep 9, 2025

Council

Council to discuss Route 1 Redevelopment and related community projects

The Woodbridge Township Council meeting will cover a wide range of topics, including major redevelopment projects such as Route 1 and the Cloverleaf area, renewal of the Cable Commission, several liquor‑license transfer applications, and updates on local events and community programs.

redevelopmentlicensinginfrastructurecommunityevents
✓ Decided: No decisions were recorded at the Woodbridge Council meeting on Sept 9, 2025

The minutes list agenda topics such as holiday lighting, redevelopment projects, and community events, but they do not record any approvals, denials, votes, or other actions. Consequently, no substantive decisions were documented for this meeting.

Tue Sep 9, 2025

Council

Council authorizes $16.96 million General Improvement Bonds

The Woodbridge Township Council approved several traffic ordinances, including adding handicapped parking at 35 Powderhorn Court, Laurel Street and Douglas Street, and deleting a handicapped space on Church Street. The Council also adopted resolutions for community events, refunds of overpaid sewer fees and taxes, and multiple service agreements. A key financial action was the authorization of $16,962,000 in General Improvement Bonds dated October 1, 2025, along with related publishing and disclosure measures. All items were adopted by unanimous consent.

bondsfinanceparkingcommunity-eventspublic-works
✓ Decided: Council authorized $16.96 M general improvement bonds

The Woodbridge Township Council unanimously approved several traffic ordinances adding handicapped parking at 35 Powderhorn Court and removing it from Church Street, and also approved first‑reading ordinances for new handicapped parking on Laurel and Douglas Streets. The Council also authorized the issuance of $16,962,000 in General Improvement Bonds and approved refunds for overpaid sewer fees and taxes. Additional unanimous resolutions authorized community events, playground equipment purchases, and emergency elevator repairs.

Tue Sep 9, 2025

Council

Council will consider $16.96 million General Improvement Bonds

The Woodbridge Council will take a second reading on two traffic ordinances that add and delete handicapped parking spaces on specific streets, and a first reading on three additional traffic ordinances and a vacate/extinguish of a portion of Metuchen Avenue. It will also adopt a resolution authorizing $16,962,000 in General Improvement Bonds and related financial disclosures. Additional items include event authorizations, fee refunds, and service agreements.

bondstraffichandicapped-parkingpublic-rightscontracts
Thu Aug 28, 2025

Zoning Board of Adjustment

Zoning Board to consider new temple construction at 941 Port Reading Avenue

The Zoning Board of Adjustment will hold public hearings on several variance requests for residential and commercial properties. The board will also vote on the adoption of resolutions for four previously granted applications.

zoningland-usevariancescommercial-developmenthousing
Wed Aug 27, 2025

Planning Board

Planning Board to review self-storage facility and retail additions

The Planning Board will hold public hearings on several site plan applications. These include a proposal to replace a bowling alley with a self-storage facility and a request for a building addition and digital sign.

zoningsite-plancommercial-developmentpublic-hearing
Tue Aug 26, 2025

Council

Council considers redevelopment plans and $4 million marina grant

The Council will vote on redevelopment plans for Route 1 Area 26 and Pennvall and Cutters Dock Roads. The meeting includes decisions on affordable housing payment-in-lieu-of-construction and various municipal service contracts.

redevelopmentmarinazoningaffordable-housinginfrastructurebudget
Tue Aug 26, 2025

Council

Woodbridge Council to discuss tax and sewer overpayments

The Council will hold a work session to discuss items requested by the administration. Decisions on these items are scheduled for action on September 9, 2025.

taxessewertrafficordinances
Tue Aug 26, 2025

Council

Woodbridge Council to review liquor license transfers

The council will consider the transfer of two liquor licenses. The remainder of the agenda consists of lists of ongoing projects and priorities associated with individual council members.

liquor-licensesstreet-closingselectionsadministration
✓ Decided: No formal decisions were recorded at Woodbridge Council meeting on Aug 26, 2025

The minutes list numerous agenda items and topics presented by council members, but they do not record any approvals, denials, votes, or other formal decisions.

Tue Aug 26, 2025

Council

Woodbridge Council adopts redevelopment plans and e-bike regulations

The Municipal Council adopted several ordinances, including new regulations for bicycles and electric vehicles and two redevelopment plans. The body also amended affordable housing payment rules and updated specific parking restrictions.

zoningredevelopmenttrafficaffordable-housingelectric-vehicles
✓ Decided: Council adopts five ordinances covering traffic, redevelopment, and affordable housing

The Woodbridge Municipal Council approved the minutes from August 12, 2025. It adopted five ordinances—two traffic amendments, two redevelopment plans, and an affordable‑housing amendment—after closing public hearings and submitting them to the mayor. The council also passed first‑reading motions for two handicapped‑parking ordinances.

Thu Aug 14, 2025

Zoning Board of Adjustment

Zoning Board to review residential additions and a three-family conversion

The Zoning Board of Adjustment will hold public hearings for several bulk variance requests for single-family home improvements. The board will also consider a use variance to convert a two-family dwelling into a three-family dwelling. Additionally, the board will tentatively adopt resolutions for previous applications.

zoningvarianceshousingresidential-development
Wed Aug 13, 2025

Planning Board

Planning Board to vote on Route 1 and Pennval redevelopment plans

The Planning Board will consider adopting resolutions for the Route 1, Area 26 and the amended Pennval and Cutters Dock Roads redevelopment plans. The board will also introduce a land use ordinance regarding Payments in Lieu of Construction (PILOC).

redevelopmentzoningland-useordinance
Tue Aug 12, 2025

Council

Council approves $8.5M sewer project and new traffic rules for e-bikes

The Woodbridge Municipal Council held its August 12, 2025 meeting to approve ordinances, adopt redevelopment plans, and set public hearings. The council unanimously passed a $8.5 million bond ordinance for the Stafford Road Sanitary Sewer Improvement Project, adopted traffic amendments for handicapped parking, and advanced first readings of ordinances regulating micro-mobility devices and redevelopment plans.

sewerbondstrafficzoningredevelopmente-bikestax-refundspublic-safety
✓ Decided: Council approved $8.5 M bond for Stafford Road sewer improvement

The council unanimously approved an $8.5 million bond ordinance to fund the Stafford Road sanitary sewer improvement project. It also adopted amendments to traffic ordinances adding handicap parking at 323 Gill Lane and deleting it at Beverly Hill Terrace, and approved a discovery‑fees amendment. Several other ordinances were taken up on first reading, and the council authorized multiple community event permits and tax refunds.

Tue Aug 12, 2025

Council

Woodbridge Council to discuss tax overpayments and road resurfacing

The Council will hold a work session to discuss several administrative requests. Items slated for discussion include tax and sewer overpayments and a traffic ordinance amendment. Formal action on these items is scheduled for August 26, 2025.

taxessewertrafficroadsdigital-mapping
Tue Aug 12, 2025

Council

Woodbridge council reviews liquor license transfers and renewals

The Woodbridge Municipal Council’s August 12, 2025 meeting covers routine liquor license actions, street closures for events, and elections. No major ordinances or contracts are listed for a vote. The agenda is largely procedural with no substantive policy decisions.

liquor-licenseseventselectionsprocedural
✓ Decided: Council discussed many agenda items; no decisions or votes recorded

The August 12, 2025 Woodbridge Township Council meeting minutes list agenda topics presented by council members and the municipal clerk, covering items such as holiday lighting, redevelopment projects, senior centers, and liquor license applications. The minutes do not record any approvals, denials, votes, or other formal actions on these items. Therefore, no substantive decisions were documented during this meeting.

Tue Aug 12, 2025

Council

Woodbridge Council approves $8.5 million sewer project

The Municipal Council approved a bond ordinance for sanitary sewer improvements and updated traffic and administrative codes. The body also introduced new regulations for e-bikes and micro-mobility devices on public sidewalks.

sewerinfrastructuretraffice-bikesredevelopmentparking
✓ Decided: Council adopts $8.5 M sewer bond and multiple ordinances, schedules public hearing

The Woodbridge Township Council approved the July 22, 2025 minutes and adopted a bond ordinance authorizing $8,500,000 for the Stafford Road sanitary sewer improvement. It also passed amendments adding and deleting handicapped parking, changed discovery fee rules, and gave first‑reading approval to several ordinances—including a micro‑mobility regulation—with a public hearing set for August 26, 2025. Several community event resolutions were authorized by consent.

Thu Jul 24, 2025

Zoning Board of Adjustment

Zoning Board to consider new temple construction and residential variances

The Zoning Board of Adjustment will hold public hearings on several land-use requests. These include a proposal for a new temple in Port Reading and various residential driveway and patio projects. The board will also consider a parking lot expansion for a warehouse in Avenel.

zoningland-useconstructionparkingpublic-hearings
Thu Jul 24, 2025

Public Library

Library Board to vote on fund reserves and lighting installation costs

The Free Public Library of Woodbridge Trustees will meet to discuss operational funding and personnel. The board is scheduled to vote on resolutions regarding fund reserves and labor costs for grant-funded lighting.

librarybudgetlightingpublic-works
✓ Decided: Board approves $500,000 reserve for library facilities operations

At the July 24, 2025 meeting, the Woodbridge Library Board adopted a resolution creating a $500,000 reserve for facilities operations. It also approved a $94,500 labor contract with Gurney Electric to install lighting at the Iselin Branch, appointed a new part‑time library page, accepted two staff resignations, and approved bill payments totaling $225,783.84. All motions carried unanimously.

Wed Jul 23, 2025

Planning Board

Planning Board to consider $8.5 million sewer project and land use ordinances

The Woodbridge Planning Board will meet to discuss a bond ordinance for sewer improvements and a new land use ordinance for open space conservation. The board will also hold public hearings regarding a residential subdivision in Sewaren and a commercial conversion on Amboy Avenue.

sewerzoningopen-spacesubdivisioncommercial-development
Tue Jul 22, 2025

Council

Woodbridge Council considers $8.5 million sewer project and $1.3 million land acquisition

The Council is reviewing several bond ordinances for infrastructure and land acquisition. The meeting includes decisions on municipal contracts, tax refunds, and permits for upcoming community parades.

sewereminent-domainpolicebudgetinfrastructurezoning
Tue Jul 22, 2025

Council

Woodbridge Council to discuss tax and sewer overpayments and traffic ordinances

The Council is holding a work session to discuss several administrative requests. Items discussed at this meeting are scheduled for action on August 12, 2025.

taxessewerveteranstrafficordinances
Tue Jul 22, 2025

Council

Woodbridge Council to review liquor license transfer for 85 Lafayette Rd.

The Council will consider a person-to-person transfer of liquor license #1225-33-024-013 from Anais Lounge Center Jersey, LLC to Xperience Hospitality Group II, Inc. The remainder of the agenda consists of standing lists of council member priorities and procedural items.

liquor-licenseadministrationpublic-safetyeconomic-development
✓ Decided: Council meeting listed agenda items but recorded no formal decisions

The July 22, 2025 Woodbridge Township Council minutes enumerated numerous topics ranging from holiday events to redevelopment projects and license applications. The record does not include any approvals, denials, votes, or other actionable outcomes. Consequently, no substantive decisions were documented during this meeting.

Tue Jul 22, 2025

Council

Woodbridge Council approves $1.3 million for Sewaren open space acquisition

The Municipal Council adopted several ordinances, including a bond ordinance to acquire properties in Sewaren for open space. The body also introduced a new $8.5 million bond ordinance for sewer improvements on Stafford Road.

open-spacesewerseminent-domaininfrastructurepublic-auction
✓ Decided: Council approved $8.5 M Stafford Road sewer bond ordinance

The Woodbridge Municipal Council adopted a bond ordinance to fund an $8,500,000 sanitary sewer improvement on Stafford Road. It also approved several traffic and land‑use amendments, rescinded a parking restriction ordinance, and authorized a $1,168,000 county grant to purchase open‑space property in Sewaren. All motions were carried unanimously.

Thu Jul 10, 2025

Zoning Board of Adjustment

Zoning Board to review new temple and LED sign proposals

The Zoning Board of Adjustment will hold public hearings on several variance and site plan requests. These include a new temple construction and multiple digital advertising signs.

zoningpublic-hearingsadvertisingconstruction
Wed Jul 9, 2025

Planning Board

Planning Board to consider eminent domain for Sewaren open space

The Planning Board will review a bond ordinance for property acquisition and hold public hearings on two development projects. These include a business conversion and a residential lot subdivision.

eminent-domainopen-spacezoningsubdivisioncommercial-development
Tue Jul 8, 2025

Council

Woodbridge Council discusses Lyman Creek flood control and tax resolutions

The Council is holding a work session to discuss items for future action on July 22, 2025. Discussions include stormwater management and tax-related resolutions.

stormwatertaxesengineeringtrafficinfrastructure
Tue Jul 8, 2025

Council

Woodbridge Council to review liquor license transfers

The council will consider two person-to-person liquor license transfers. The remainder of the agenda consists of standing lists of projects and priorities associated with each council member.

liquor-licensesredevelopmentmunicipal-government
✓ Decided: Council meeting listed agenda items but recorded no decisions

The Woodbridge Township Council met on July 8, 2025. The agenda included items such as holiday lighting, redevelopment projects, senior centers, and liquor license applications. No motions were adopted, no votes were recorded, and no decisions were documented in the minutes.

Tue Jul 8, 2025

Council

Woodbridge Council considers $1.3 million for Sewaren property acquisitions

The Council will discuss a bond ordinance to acquire properties in Sewaren via eminent domain for open space and municipal use. The meeting also includes votes on several infrastructure contracts and the appointment of a Police Director.

eminent-domainsewersparksbudgetpublic-safetyreal-estate
Thu Jun 26, 2025

Public Library

Woodbridge Public Library Trustees to vote on FY 2026 budget

The Board of Trustees will meet to approve the budget for fiscal year 2026 and the audit for FY 2023-2024. The board is also considering a new strategic plan and amendments to the FY 25 annual budget.

librarybudgetauditstrategic-planning
✓ Decided: Board approves $128,624.30 in bills and key personnel actions

The Board of Trustees approved the minutes from the April 24 meeting and adopted a resolution honoring retiring employee Phyllis Jeanne Cifelli. It approved several personnel actions, including a new appointment, two promotions, a salary adjustment, a retirement and a resignation. The Board also approved two bill lists totaling $128,624.30. All motions carried.

Thu Jun 26, 2025

Zoning Board of Adjustment

Zoning Board to review subdivision and telecommunications projects

The Zoning Board of Adjustment will hold public hearings on several bulk variance requests for residential improvements. The board is also considering a minor subdivision to create a new single-family lot and a proposal for a telecommunications facility.

zoningsubdivisiontelecommunicationsresidential-developmentpublic-hearings
Wed Jun 25, 2025

Planning Board

Planning Board to hear subdivision requests for Montrose Ave and Old Road

The Woodbridge Planning Board will hold public hearings regarding two minor subdivision applications. The board will also consider the approval of minutes from the June 11, 2025 meeting.

zoningsubdivisionpublic-hearinghousing
Tue Jun 24, 2025

Council

Woodbridge Council considers $6 million for affordable housing initiative

The Council will vote on several traffic ordinances and a variety of municipal contracts. Key items include funding for deed-restricted affordable housing and the appointment of a new Tax Assessor.

housingtrafficbudgetcontractsappointments
Tue Jun 24, 2025

Council

Woodbridge Council discusses 2026 road milling and resurfacing program

The Council is holding a work session to discuss several administrative and infrastructure items. Decisions on these matters are scheduled for action on July 8, 2025.

roadstaxesordinancesinfrastructurepublic-works
Tue Jun 24, 2025

Council

Woodbridge Council to review liquor license transfer for Sarana Group LLC

The Municipal Council will meet to discuss a wide range of ward-specific projects and community initiatives. The agenda includes a specific application for a person-to-person liquor license transfer. No other formal votes or contracts are listed.

liquor-licenseredevelopmentroadspublic-workscommunity-events
✓ Decided: Council discussed many topics but recorded no formal decisions

The Woodbridge Township Council meeting on June 24, 2025 listed a wide range of agenda items—from holiday lighting and community events to redevelopment projects and public‑service programs. The minutes do not show any approvals, denials, votes, or other formal actions taken on these items. Consequently, no substantive decisions were documented.

Tue Jun 24, 2025

Council

Woodbridge Council authorizes $6 million for affordable housing initiative

The Municipal Council approved several contracts, appointments, and traffic ordinances. The body also authorized significant funding for affordable housing and various infrastructure repairs.

affordable-housingtrafficinfrastructurebudgetpublic-safety
✓ Decided: Council approved up to $6 million for a new affordable‑housing initiative

The Woodbridge Council adopted several traffic ordinances, approved a $6 million housing expenditure, and authorized multiple refunds, reappointments and contract agreements. All items were adopted by unanimous vote except one where the Vice President abstained. The meeting also included routine budget transfers and license renewals.

Thu Jun 12, 2025

Zoning Board of Adjustment

Woodbridge Zoning Board of Adjustment meeting cancelled

The Zoning Board of Adjustment meeting scheduled for June 12, 2025, has been cancelled. The next meeting is scheduled for June 26, 2025.

zoningmeeting-cancellation
Wed Jun 11, 2025

Planning Board

Woodbridge Planning Board to meet June 11

The Planning Board will meet via conference call to approve minutes from the May 21, 2025 meeting and consider the adoption of tentatively scheduled resolutions.

planning-boardprocedural
Tue Jun 3, 2025

Council

Woodbridge Council approves $14.45 million in bonds for roads and sewer utility

The Municipal Council adopted several bond ordinances for capital improvements and approved 30-year tax exemptions for three urban renewal projects. The body also authorized the public auction of township property on Oak Tree Road.

bondsroadssewertax-exemptionsreal-estateurban-renewal
✓ Decided: Council approved $11.42 M general bond and $3.03 M sewer utility bond ordinances

The Woodbridge Township Council unanimously approved the minutes from the May 20, 2025 meeting. It adopted two bond ordinances—$11,420,000 for general improvements and $3,030,000 for sewer‑utility upgrades—by second and third reading. The council also approved three 30‑year tax‑exemption agreements, a property‑sale ordinance, a permanent easement for Elizabethtown Gas, a traffic‑restriction amendment, and several routine resolutions.

Tue Jun 3, 2025

Council

Woodbridge Council considers $11.4 million bond for public improvements

The Council is reviewing two bond ordinances for township and sewer utility improvements. The meeting includes votes on long-term tax exemptions for urban renewal projects and the sale of township property.

budgetinfrastructureurban-renewalreal-estatesewer
Tue Jun 3, 2025

Council

Woodbridge Council to discuss Magnolia Road improvements and traffic ordinances

The Council will hold a work session to discuss several administrative requests. Items slated for discussion include tax and sewer overpayments and a traffic ordinance amendment.

roadstraffictaxesveteransinfrastructure
Tue Jun 3, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Municipal Council will meet to discuss various ward-specific projects and community initiatives. The agenda includes specific applications for liquor license transfers and corporate structure changes.

liquor-licensesredevelopmentinfrastructurecommunity-servicespublic-safety
✓ Decided: Council listed agenda items but recorded no formal decisions

The June 3, 2025 Woodbridge Council meeting agenda covered community events, redevelopment projects, licensing matters, and various department updates. The minutes do not show any votes, approvals, denials, or other formal actions taken on these items. Consequently, no substantive decisions were documented.

Thu May 22, 2025

Public Library

Woodbridge Public Library Trustees to meet May 22

The Board of Trustees will meet to review reports from the Library Director and Friends of the Libraries. The board will consider a resolution regarding the retirement of Phyllis Jeanne Cifelli and the approval of bills.

librarypersonnelpublic-services
✓ Decided: Board approved $102,416.38 bill list for library operations

The Board of Trustees approved the minutes from the March 27 meeting. They confirmed two new part‑time library pages, a promotion for a senior assistant, and a staff resignation. The board also approved a bill list totaling $102,416.38 for library expenses.

Thu May 22, 2025

Zoning Board of Adjustment

Zoning Board to review residential additions and property conversions

The Zoning Board of Adjustment will hold public hearings for five bulk variance requests. The board is also tentatively scheduled to adopt resolutions for six previously granted applications.

zoningresidential-developmentvarianceshousing
Wed May 21, 2025

Planning Board

Woodbridge Planning Board to review two bond ordinances totaling $14.45 million

The Planning Board will meet to approve minutes and consider two bond ordinances for public improvements and equipment. A public hearing for a subdivision at 72 Old Road has been postponed to June 25, 2025.

bond-ordinancepublic-improvementszoningsubdivision
Tue May 20, 2025

Council

Woodbridge Council considers $14.45 million in bond ordinances for equipment and improvements

The Council will discuss two bond ordinances to fund public improvements, vehicles, and sewer utility equipment. The meeting also includes votes on long-term tax exemptions for urban renewal projects and the appointment of a new Councilman-At-Large.

budgetinfrastructureurban-renewaltax-exemptionspublic-works
Tue May 20, 2025

Council

Council discusses intersection improvements and roadway grants

The Council will hold a work session to discuss several administrative requests, including a traffic ordinance amendment and infrastructure projects. Items discussed on May 20 are scheduled for action on June 3.

roadsinfrastructuretrafficbudgetpublic-works
Tue May 20, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Council will discuss various community projects, ward-specific initiatives, and municipal services. The meeting includes formal reviews of liquor license transfers and a corporate structure change for Red Lobster.

liquor-licensesredevelopmentpublic-safetyinfrastructurecommunity-services
✓ Decided: Council presented agenda items without any recorded decisions

The May 20, 2025 Woodbridge Township Council minutes list numerous agenda topics presented by council members. No motions, votes, approvals, denials, or other actions are documented. Consequently, the minutes contain no substantive decisions.

Tue May 20, 2025

Council

Woodbridge Council appoints Daniel Harris to vacant council seat

The Municipal Council appointed Daniel Harris as Councilman-At-Large to fill a vacancy. The body also approved a lease for parking on James Street and passed several first-reading bond ordinances for public improvements.

appointmentsbondsparkinginfrastructurepublic-works
✓ Decided: Council approved $11.42M and $3.03M bond ordinances for public improvements

The Woodbridge Municipal Council unanimously approved two bond ordinances—$11,420,000 for various public improvements and $3,030,000 for sewer‑utility upgrades. It also adopted a handicap‑parking ordinance for 323 Gill Lane and a lease ordinance for the James Street lot. Daniel R. Harris was appointed to the vacant Councilman‑At‑Large seat, and several other resolutions were passed.

Tue May 20, 2025

Council

Woodbridge Council appoints Daniel Harris to vacant council seat

The Municipal Council swore in Daniel Harris as Councilman-At-Large to fill a vacancy. The body also approved a lease for parking on James Street and a new handicap parking space on Gill Lane.

appointmentsparkingbondsinfrastructuresewer-utility
✓ Decided: Council approved $11.42 M bond ordinance for public improvements

The Woodbridge Municipal Council filled the vacant council seat by appointing Daniel R. Harris unanimously. It adopted a handicap‑parking ordinance for 323 Gill Lane and a lease ordinance for the James Street lot, both by unanimous vote. The council also approved two bond ordinances authorizing $11,420,000 and $3,030,000 for township and sewer‑utility projects, respectively, and authorized several tax‑exemption and infrastructure resolutions.

Thu May 8, 2025

Zoning Board of Adjustment

Woodbridge Zoning Board to hear three variance applications, including contractor business on Woodbine Ave

The Woodbridge Zoning Board of Adjustment will hold public hearings on three applications: a minor site plan for a construction contractor business with variances at 80 Woodbine Avenue, a use and bulk variance to finish a basement at 24 May Street, and a variance to replace a church sign with an LED sign at 1295 Oak Tree Road. The board will also adopt minutes from the April 24 regular meeting and consider a postponed resolution.

zoningpublic-hearingvariancessite-plansignagewoodbridge
Wed May 7, 2025

Planning Board

Woodbridge Planning Board meeting scheduled for May 7, 2025

The meeting is scheduled to take place via conference call. The agenda consists of procedural boilerplate, including the approval of minutes from the April 23, 2025 meeting.

proceduralplanning-board
Tue May 6, 2025

Council

Council to vote on amended Main Street Transit Village Plan as second-reading ordinance

The Woodbridge Township Council holds a regular meeting with second-reading ordinances including adoption of the amended Main Street Rehabilitation & Transit Village Plan, repeal and replacement of the C-PACE program ordinance, and first-reading ordinances for traffic changes and a land lease. The council also considers 23 resolutions covering block parties, appointments, tax refunds for disabled veterans, contracts for road resurfacing totaling over $4.8 million, emergency sewer repair, IT upgrades, and a developer utility agreement for a new sewer force main.

planningredevelopmenttrafficc-pacebudgetcontractsroadsinfrastructure
Tue May 6, 2025

Council

Council adopts amended Main Street Transit Village Plan, approves $4.9M road resurfacing

The council adopted four ordinances on second reading, including the amended Main Street Rehabilitation & Transit Village Plan, a traffic change at Avenel Street, and a C-PACE program repeal and readoption. They introduced two new ordinances for handicapped parking at 323 Gill Lane and a lease on the James Street lot. Resolutions authorized over $4.8 million in road resurfacing, emergency sewer repairs, technology contracts, and budget transfers. Public comment included discussion of a Trap-Neuter-Return program for feral cats.

redevelopmentroadspublic-workscontractstrafficc-pacebudgetappointments
✓ Decided: Council adopts Main Street Rehabilitation & Transit Village Plan amendment

The Woodbridge Township Council unanimously adopted several ordinances, including a traffic yield sign on Avenel Street (Ordinance A) and the amended Main Street Rehabilitation & Transit Village Plan (Ordinance B). It also repealed and re‑adopted the Garden State C‑PACE program (Ordinances C and D) and passed first‑reading ordinances for handicapped parking on Gill Lane (Ordinance E) and a lease for the James Street lot (Ordinance F). Numerous resolutions were approved, authorizing contracts, appointments, and a $500,000 NJDOT grant for Markley Street improvements.

Tue May 6, 2025

Council

Council to discuss NJDOT grant for Longfellow Drive roadway improvements

The Woodbridge Council will discuss several resolutions at its May 6 work session, with action scheduled for May 20. Items include tax and sewer overpayments, disabled veteran exemptions, and parking refunds. A notable resolution is a grant application with NJDOT for roadway improvements on Longfellow Drive. The meeting also includes refunds from current and other trust fund accounts.

counciltransportationgrantsroadsveteransfinancerefundspublic-works
Tue May 6, 2025

Council

Council to consider liquor license transfers for several restaurants

The Woodbridge Township Council will discuss a wide range of community updates and initiatives, including redevelopment projects, parks, and senior centers. The most concrete action items are several liquor license transfers and changes, including transfers for Violette's on Main St., a pocket license, a former T.G.I. Friday's location, and Red Lobster. The meeting also covers numerous reports from council members on events and local programs.

liquor-licenseredevelopmentcommunity-eventspublic-safetyparks
✓ Decided: No decisions were recorded at the May 6, 2025 Woodbridge Council meeting

The May 6, 2025 Woodbridge Township Council meeting listed a series of agenda topics ranging from community events to infrastructure projects. The minutes contain only the agenda items and no recorded votes, approvals, or denials. Consequently, no formal actions were documented during this session.

Thu Apr 24, 2025

Public Library

Library board holds routine monthly meeting with standard reports and bill approvals

This is a regularly scheduled trustees meeting of the Woodbridge Public Library board. The agenda consists primarily of procedural items: approval of prior minutes, correspondence, director's report, reports from the Friends group and board members, and new business covering personnel and approval of bills. No specific contracts, funding amounts, or policy changes are listed.

libraryboard-meetingproceduralpublic-comments
✓ Decided: Board approved $163,714.06 security camera purchase for three library locations

The Board approved the purchase and installation of security cameras at the Main Library, Iselin Branch, and Fords Branch, allocating $20,000 from the Special Projects reserve. It also adopted the Library Security Camera Policy and approved a $10,346.32 grant application to the New Jersey State Library. The Board selected Carpet Care Plus for carpet cleaning at a cost of $13,652.80 and appointed Natalie Dos Santos as a part‑time library page. Finally, a bill list totaling $93,210.15 was approved.

Thu Apr 24, 2025

Zoning Board of Adjustment

Minor subdivision to create new lot with single-family home, retaining 7-unit multifamily

The board will hold public hearings on several residential variance requests, including driveway widenings, new dwellings, and a minor subdivision. It will also hear an appeal of a zoning officer’s decision to legalize a two-family dwelling. Resolutions for previously granted applications are scheduled for adoption. The meeting opens with approval of minutes from April 3.

zoningpublic-hearingvariancessubdivisionappealresidential
Wed Apr 23, 2025

Planning Board

Public hearing on 72 Old Road subdivision postponed to May 21, 2025

The Woodbridge Planning Board will meet to adopt resolutions for several previously granted applications (750 Martin FE Urban Renewal #P24-31, 545 Route 9, LLC #P24-12, Butter Construction & Engineering Inc. #P25-01, Gary Bruno #P24-17, and Aylin Ventures, LLC #P25-03) and to approve minutes from the April 2 regular meeting. A public hearing for a minor subdivision and bulk variances at 72 Old Road, Sewaren (application #P25-02, applicant Gurcharan Singh) has been postponed to May 21, 2025.

planning-boardsubdivisionpublic-hearingwoodbridgeminor-subdivisionbulk-variancesr5-zone
Tue Apr 22, 2025

Council

Council considers Main Street Rehabilitation & Transit Village Plan

The Council will discuss the adoption of the amended Main Street Rehabilitation & Transit Village Plan and tax exemptions for two urban renewal projects. The meeting includes votes on several municipal contracts and updates to traffic and animal control ordinances.

redevelopmentzoningcontractstax-exemptionspublic-workstraffic
Tue Apr 22, 2025

Council

Council to discuss tax overpayments, veteran exemption, traffic ordinance

This is a work session of the Woodbridge Township Council for discussion on April 22, with action planned for May 6. The agenda includes resolutions on tax and sewer overpayments and a 100% veteran property tax exemption, plus a traffic ordinance amendment. Most departments listed have no specific items detailed.

woodbridgecouncilwork-sessiontaxsewerveteranstrafficordinance
Tue Apr 22, 2025

Council

Woodbridge Council to review multiple liquor license transfers

The Municipal Council will discuss a wide range of ward-specific projects and community initiatives. The meeting includes a review of several liquor license transfers and corporate structure changes.

liquor-licensescommunity-developmentinfrastructurepublic-safety
✓ Decided: Council reviewed many agenda items but recorded no formal decisions

The Woodbridge Township Council meeting on April 22, 2025 listed a wide range of agenda topics, including community events, redevelopment projects, senior centers, and liquor‑license applications. The minutes do not show any motions, votes, approvals, denials, or other formal actions taken on those items. Consequently, no substantive decisions were documented during this session.

Tue Apr 22, 2025

Council

Council amends animal control ordinance, removes oversight of commercial non-domestic animals

The Woodbridge Township Council adopted several ordinances on second reading, including amendments to traffic, animal control, administration, and two long-term tax exemption agreements. The animal control ordinance was amended to eliminate township oversight of commercial entities like the Woodbridge Aquarium, citing lack of legal jurisdiction. The council also introduced first reading ordinances, including adoption of the Amended Main Street Rehabilitation & Transit Village Plan and repeal of the C-PACE program.

animal-controlbusinesshousingredevelopmenttax-exemptiontrafficzoning
✓ Decided: Council approved tax exemptions for two developers and multiple ordinance changes

The Woodbridge Council adopted two long‑term tax‑exemption ordinances for Mazza Urban Renewal, LLC and Accu Re Woodbridge Urban Renewal, LLC. It also approved traffic‑related changes to handicap parking, an amendment to the animal‑control ordinance, and a personnel ordinance amendment. Additional ordinances were taken up for first reading, including an Avenel Street extension, the Main Street Rehabilitation & Transit Village Plan, and the repeal of the Garden State C‑PACE program. All motions were carried unanimously, with one council member abstaining on the Mazza tax‑exemption ordinance.

Thu Apr 3, 2025

Zoning Board of Adjustment

Woodbridge Zoning Board to hear eight variance requests for dwellings, patios, driveway

The Woodbridge Zoning Board of Adjustment will hold public hearings on eight variance applications, including proposed single-family dwellings, a driveway and patio, a basement finish, gazebos, a covered patio, and a contractor business expansion. The board will also adopt resolutions for five previously granted variance applications. Several items have been carried over from prior meetings.

zoningvariancespublic-hearingswoodbridgeiselinhopelawnfordsavenel
Wed Apr 2, 2025

Planning Board

Planning Board to decide on three subdivision applications, one postponed

The Woodbridge Planning Board will hold public hearings on three minor subdivision proposals in Port Reading, Sewaren, and Iselin, and adopt a resolution for a previously granted WaWa application. A fourth subdivision hearing at 72 Old Road, Sewaren, has been postponed to April 23. The board will also approve minutes from the March 19 meeting.

planning-boardsubdivisionspublic-hearingresolutionswoodbridgezoningminor-subdivision
Tue Apr 1, 2025

Council

Council considers $1.3 million police vehicle lease and tax exemptions

The Woodbridge Council will vote on several ordinances regarding police licensing and noise regulation. The body is also reviewing long-term tax exemptions for urban renewal projects and various municipal service contracts.

policetax-exemptionsurban-renewalpublic-safetycontracts
Tue Apr 1, 2025

Council

Woodbridge Council to discuss tax overpayments, veteran exemptions, traffic ordinance amendment

The Woodbridge Council will discuss several resolutions and an ordinance in a work session. Items include resolutions for tax and sewer overpayments, a 100% veteran property tax exemption, and a traffic ordinance amendment. A refund from the current fund account is also on the table. These items are scheduled for action on April 22, 2025.

woodbridgecouncilwork-sessiontax-overpaymentsveteran-exemptiontraffic-ordinancerefund
Tue Apr 1, 2025

Council

Woodbridge Council approves $1.3M police vehicle lease

The Council adopted ordinances expanding the Police Department Licensing Coordinator's authority and passed several first-reading ordinances regarding parking and tax exemptions. The body also approved numerous contracts for public works, police equipment, and home repairs.

policebudgetzoningpublic-worksordinances
✓ Decided: Council approved $4.276 M increase to Smith’s Creek Community Complex project

The council adopted three police‑licensing coordinator ordinances after a public hearing and moved several traffic, animal‑control and tax‑exemption ordinances to first reading. It approved a $4.276 M change order for the Smith’s Creek Community Complex Tiki & Marina Project and authorized a $1.299 M lease of police vehicles, along with multiple other resolutions and contracts.

Tue Apr 1, 2025

Council

Council to consider liquor license transfers, redevelopment, and community projects

The Woodbridge Township Council will hold a regular meeting on April 1, 2025, to discuss multiple liquor license transfers, redevelopment initiatives along Route 1 and Cloverleaf, and various community projects and events. The agenda includes reports from each council member on local priorities such as park improvements, road projects, and public safety. No formal ordinances or funding votes are listed.

woodbridgecouncilliquor-licensesredevelopmentcommunity-eventsparksroadspublic-safety
✓ Decided: Council meeting listed agenda items but recorded no decisions

The April 1, 2025 Woodbridge Township Council minutes consist of a list of agenda topics ranging from community events to liquor‑license transfers and redevelopment projects. No approvals, denials, votes, or other actions were documented in the record. Consequently, the meeting did not produce any formal decisions.

Thu Mar 27, 2025

Public Library

Library trustees to vote on security camera purchase and policy

The Woodbridge Public Library Board of Trustees will consider four resolutions, including the purchase of security cameras and adoption of a related policy. They will also vote on a New Jersey State Library grant and annual carpet cleaning at all locations. The meeting includes public comments and a closed session before adjournment.

librarysecurity-camerasgrantsmaintenancetrustees
✓ Decided: Board approved $117,716.77 in bills

The Board of Trustees approved the minutes from the January 23 meeting. They promoted Isabel Arocho to Senior Library Assistant effective March 2. The Board also approved a bill list totaling $117,716.77. Board Attorney Christopher Zingaro announced his departure and introduced Alex Avellan as the new board attorney.

Thu Mar 20, 2025

Zoning Board of Adjustment

Board to hear subdivision and variance for multifamily property on Devon Road, Colonia

The Woodbridge Zoning Board will hold public hearings on several variance requests, including a minor subdivision to split a 7-unit multifamily property into two lots. Other items include basement finishing, driveway widening, and garage construction at single-family homes. The meeting also includes adoption of resolutions for previously granted variances and postponements of two applications.

zoningvariancespublic-hearingwoodbridgesubdivisionresidential
Wed Mar 19, 2025

Planning Board

Planning Board to review warehouse and restaurant proposals

The Planning Board will hold public hearings for two development projects. One involves a warehouse in Avenel and the other a quick service restaurant in Hopelawn.

zoningwarehousingrestaurantsite-planredevelopment
Tue Mar 18, 2025

Council

Council to vote on $4M HUD grant for Woodbridge Waterfront Walkway

The Woodbridge Council will hold second-reading votes on ordinances including traffic changes, property conveyances, and an eminent domain acquisition, along with first-reading ordinances on police licensing and noise regulations. The agenda also includes resolutions for large contracts, such as a $798,541 emergency generator replacement and a $4 million HUD grant for the Waterfront Walkway.

trafficpolicepropertybudgetinfrastructureeminent-domaingrantsparks
Tue Mar 18, 2025

Council

Council to discuss traffic ordinance amendments and refund resolution

This is a work session agenda for discussion only, with action scheduled for April 1. The listed items include Traffic Ordinance Amendments and a Refund from Current Account, but no specific details or dollar amounts are provided. The agenda is largely procedural with minimal concrete information.

counciladministrationtrafficordinancesresolutionspublic-works
Tue Mar 18, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Council will consider several liquor license transfers and corporate structure changes for businesses in Woodbridge, Fords, and Avenel. The meeting also includes a broad list of council member priorities and community projects for discussion.

liquor-licensesredevelopmentbusinesscommunity-projects
✓ Decided: Council reviews liquor license transfers and renewals; no final votes taken

The Woodbridge Township Council meeting on March 18, 2025, was largely procedural, with council members presenting lists of ongoing projects and community events. The municipal clerk reported several liquor license transfers and corporate structure changes under review, but no final decisions or votes were recorded. The meeting appears to have been an informational session rather than a decision-making one.

Tue Mar 18, 2025

Council

Woodbridge Council approves property acquisitions and parking changes

The Municipal Council adopted several ordinances regarding property acquisitions, including one via eminent domain. The body also approved new handicapped parking designations and updated regulations for overnight parking of heavy trailers.

zoningparkingeminent-domainpublic-worksgrants
✓ Decided: Council adopts six ordinances including eminent domain for abandoned properties

The Woodbridge Township Council adopted six ordinances on second reading, including measures to add handicapped parking, regulate trailer parking, approve a revised license agreement for the Avenel Arts Center, convey property to Consolidated Rail Corporation, and authorize acquisition of two abandoned properties via easement and eminent domain. The council also passed three ordinances on first reading related to police licensing and noise regulation, and approved a consent agenda of resolutions including contracts, grants, and a $798,541 emergency generator replacement. Public comments included concerns about SeaQuest animal welfare, TNR (trap-neuter-return) for feral cats, and senior property tax relief.

Thu Mar 6, 2025

Zoning Board of Adjustment

Woodbridge Zoning Board to hear five variance applications for residential projects

The Woodbridge Zoning Board of Adjustment will hold public hearings on five variance applications for residential improvements, including gazebos, patios, a driveway, a glass enclosure, and a new single-family home. The board will also adopt resolutions for two previously granted variances and approve minutes from the February 20 meeting.

zoningboard-of-adjustmentvariancespublic-hearingwoodbridge
Wed Mar 5, 2025

Planning Board

Woodbridge Planning Board to hear Wawa drive-thru proposal at 440 King George Road, Fords

The Planning Board will hold a public hearing on a minor site plan for a drive-thru window at the existing Wawa on King George Road. Two previously granted resolutions are scheduled for adoption. A public hearing on a minor subdivision at 93 Spruce Street, Port Reading, has been postponed to April 2, 2025.

planning-boardpublic-hearingsubdivisioncommercial-developmentwawawoodbridge
Tue Mar 4, 2025

Council

Council to vote on acquiring abandoned property via eminent domain at 1450 St. Georges Avenue

The Woodbridge Township Council will consider multiple ordinances and resolutions at its March 4 regular meeting. Among the first-reading ordinances is a proposal to take abandoned property at 1450 St. Georges Avenue by eminent domain. Other ordinances address traffic changes, sewer amendments, a revised license agreement for the Avenel Arts Center, and property conveyances. The council will also vote on over a dozen resolutions, including contracts for police vehicles, legal services, and digital evidence software.

eminent-domaintrafficpolicebudgetpublic-safetypropertyarts
Tue Mar 4, 2025

Council

Council to discuss DPW shared services agreement with Sayreville

The Woodbridge Council holds a work session on March 4, 2025, to discuss resolutions scheduled for action on March 18. Items include a shared services agreement with Sayreville for Department of Public Works services, tax and sewer overpayments, and a 100% veteran property tax exemption. No other specific items are listed under the remaining departments.

councilwoodbridgeshared-servicesdpwproperty-taxveteransresolutions
Tue Mar 4, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Municipal Council will consider several liquor license transfers and corporate structure changes for businesses in Woodbridge, Fords, and Avenel. The meeting also includes a broad list of council member reports covering local projects and community services.

liquor-licensesbusinessmunicipal-governmentwoodbridge-nj
✓ Decided: Woodbridge council lists 2025 priorities; no votes taken

The Woodbridge Township Council met on March 4, 2025, and each council member presented a list of community priorities and ongoing projects for the year. No formal votes or decisions were recorded; the meeting was informational and procedural. The municipal clerk also reported several liquor license transfers and corporate changes under review.

Tue Mar 4, 2025

Council

Council adopts ordinance amending sewer user fees

The Woodbridge Township Council adopted two ordinances on second reading: one adding handicap parking on Loretta Street (2025-14) and one amending sewer user fees (2025-15). They also introduced six ordinances on first reading, including restrictions on overnight parking for heavy vehicles and unhitched trailers, a revised license agreement for the Avenel Arts Center, property conveyances, and an eminent domain action. The council approved a consent agenda of 20 resolutions covering a St. Patrick's Day parade, liquor license transfer, police vehicle lease adjustment, and multiple contracts. Public comments addressed fire district funding and animal welfare legislation.

trafficsewersparkingpolicecontractsliquor-licensepublic-hearing
✓ Decided: Council adopts traffic and sewer fee ordinances, approves contracts

The Woodbridge Township Council adopted two ordinances on second reading: one adding handicap parking on Loretta Street and another amending sewer user fees. The council also introduced six ordinances on first reading, including several for property acquisitions and a revised license agreement for the Avenel Arts Center. Numerous resolutions were approved, including contracts for police vehicles, HVAC services, and home repairs, as well as liquor license transfers and special event permits. The meeting included extensive public comments, primarily about SeaQuest and animal welfare, but no formal action was taken on those matters.

Thu Feb 27, 2025

Public Library

Library board holds routine monthly meeting with no major items

This is a procedural meeting of the Woodbridge Public Library Board of Trustees. The agenda includes approval of prior minutes, reports from the director and board members, and routine business such as personnel and bill approvals. No specific policy changes, contracts, or public hearings are listed.

librarytrusteesmeetingprocedural
✓ Decided: Library board appoints auditor and attorneys, approves $183K in bills

The Woodbridge Public Library Board of Trustees held its regular meeting, reappointing three trustees and electing officers for 2025. The board approved resolutions appointing PKF O'Connor Davies as auditor for FY 2024 (not to exceed $12,000) and Rainone, Coughlin, Minchello, LLC as both labor attorney (up to $30,000) and board attorney (up to $4,000). It also approved a personnel appointment and bill lists totaling $183,189.23.

Thu Feb 20, 2025

Zoning Board of Adjustment

Woodbridge Zoning Board to hear commercial variance for Joyalukkas Jewelry at 42 Marconi Avenue

The board will hold public hearings on several bulk variance applications, including a commercial use proposal at 42 Marconi Avenue in Iselin for Joyalukkas Jewelry. Other items include residential additions, garages, and driveway widenings. Several items are postponed until March or later.

zoningvariancespublic-hearingswoodbridgeresidentialcommercialsite-plan
Wed Feb 19, 2025

Planning Board

Planning Board to hear amended site plan adding 10 apartments, office, retail at 100 Middlesex-Essex Turnpike

The Woodbridge Planning Board will hold a public hearing on an amended preliminary/final major site plan for Building A at 100 Middlesex-Essex Turnpike in Iselin. The proposal increases apartment units from 235 to 245, adds 11,637 square feet of second-floor office space, expands retail/restaurant space slightly, reduces parking from 449 to 423 spaces, and adds six wall signs. The board is also scheduled to adopt resolutions and approve prior meeting minutes.

planning-boardsite-planpublic-hearinghousingcommercial-developmentparkingiselin
Tue Feb 18, 2025

Council

Council to vote on $1.18M generator, new traffic signals, and C-PACE

The Woodbridge Township Council will hold second-reading votes on four ordinances, including opting into the Garden State C-PACE program for commercial energy financing and a lease modification at 101 Main Street. First-reading ordinances propose adding parking restrictions on Loretta Street and amending sewer regulations. The council will also consider over 30 resolutions, including an emergency $1.18 million appropriation to replace the municipal building generator, new traffic signals at two intersections, a $107,000 fireworks contract, and a $471,492 change order for the Port Reading Interceptor odor control project.

woodbridgecouncilordinancesresolutionsemergency-appropriationc-pacetraffic-signalsfireworks
Tue Feb 18, 2025

Council

Council to discuss tax/ sewer overpayments, disabled veteran resolution, traffic ordinances

This is a work session agenda with items for discussion on February 18 and action on March 4, 2025. The agenda lists only two specific resolutions (tax and sewer overpayments, 100% disabled veteran) and proposed traffic ordinance amendments. Most other departments (recreation, health, planning, public works) are listed without any detailed items, making the agenda largely procedural.

councilresolutionstrafficveterantaxsewer
Tue Feb 18, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The council will consider several liquor license transfers and corporate structure changes. The meeting also lists a wide range of ongoing council member projects and municipal administrative items.

liquor-licensesmunicipal-governmentbusiness-permitswoodbridge-nj
✓ Decided: Council reviews liquor license transfers and renewals

The meeting was largely procedural, with council members presenting lists of ongoing projects and initiatives. The municipal clerk reported several liquor license transfers and corporate structure changes under review, including a transfer from MC Lemon Tree Bar & Restaurant to Violette's Cellar Woodbridge, LLC. No formal votes or final decisions were recorded in the minutes.

Tue Feb 18, 2025

Council

Council approves $1.18M emergency generator, traffic signals, and C-PACE program

The Woodbridge Township Council adopted ordinances to amend traffic regulations on Bunns Lane, modify a lease at 101 Main Street, and opt into the Garden State C-PACE program for business energy financing. They also approved 30 resolutions including a $1.18 million emergency appropriation for a new municipal building generator, agreements for two new traffic signals, and various contracts for services and equipment.

budgettrafficparkingenergyleasescontractspublic-safetyinfrastructure
✓ Decided: Council adopts 4 ordinances, approves $1.18M generator replacement

The Woodbridge Township Council adopted four ordinances on second reading, including changes to parking restrictions on Bunns Lane, a lease modification for 101 Main Street, and opting into the Garden State C-PACE program. The council also approved a $1.18 million emergency appropriation for a new municipal building generator and numerous other resolutions, including contracts for engineering, fireworks, and a police SWAT team medical services agreement. A memorandum of agreement with a local union was approved following a brief executive session.

Wed Feb 5, 2025

Planning Board

Planning Board to consider apartment increase, new office at 100 Middlesex-Essex Turnpike

The Woodbridge Planning Board will hold public hearings on a major site plan amendment (postponed to Feb. 19) that adds 10 apartments and an 11,637-square-foot office at 100 Middlesex-Essex Turnpike in Iselin, a 1-year extension for a Keasbey site plan, and a minor site plan for gas tank storage at 200 Riverside Drive. The board will also adopt two previously granted resolutions and approve prior meeting minutes.

planning-boardpublic-hearingsite-planzoningapartmentscommercial-spaceparkingkeasbey
Tue Feb 4, 2025

Council

Council to discuss traffic signals at West Ave/Milos Way and Oak Tree/Middlesex Ave

The Woodbridge Township Council will discuss and later vote on a traffic ordinance amendment, change orders for the Odor & Corrosion Control Port Reading Interceptor contract, and agreements with Middlesex County to install new traffic signals at West Avenue/Milos Way and Oak Tree Road/Middlesex Avenue. The agenda also includes resolutions for tax and sewer overpayments.

woodbridgetownship-counciltrafficcontractspublic-workstraffic-signalsordinancetax
Tue Feb 4, 2025

Council

Council to review liquor license transfers for 4 establishments

This is a regular council meeting featuring updates from council members on community initiatives and projects, including redevelopment on Route 1 and Cloverleaf. The council will review several liquor license transfers and corporate structure changes for establishments in Woodbridge, Fords, and Avenel. Other formal items include street closing requests, election matters, and a best practices inventory.

liquor-licensesredevelopmentcommunity-eventssenior-servicesyouth-programsroadspublic-safety
✓ Decided: Council reviews liquor license transfers and renewals

The Woodbridge Township Council meeting on February 4, 2025, was largely procedural, with council members presenting their committee reports and the Municipal Clerk listing liquor license applications under review, including transfers and changes of corporate structure. No formal votes or substantive decisions were recorded in the minutes.

Tue Feb 4, 2025

Council

Council adopts amended FY25 budget with minimal tax increase

The Woodbridge Council unanimously adopted the amended Fiscal Year 2025 budget, which Mayor McCormac described as having a minimal tax increase. They also approved an ordinance to vacate a portion of West Kelly Street and introduced four ordinances on first reading, including opting into the Garden State C-PACE program. Numerous resolutions were authorized, including professional service contracts and a community benefits program from Hackensack Meridian Health.

budgetordinancestrafficplanningeconomic-developmentcontractshealth
✓ Decided: Council adopts amended FY25 budget with minimal tax increase

The Woodbridge Township Council unanimously adopted the amended Fiscal Year 2025 budget, which the mayor described as having a minimal tax increase. The council also approved a consent agenda with 28 resolutions, including bond sales, professional service agreements, and a community benefits program with Hackensack Meridian Health. Several ordinances were introduced on first reading, including one to opt into the Garden State C-PACE program.

Mon Feb 3, 2025

Council

Council to discuss traffic ordinance amendments and contract change orders

This is a work session agenda for discussion on February 3, 2025, with action scheduled for February 17, 2025. Items include resolutions for tax and sewer overpayments and a 100% disabled veteran resolution, traffic ordinance amendments, and final change orders for two contracts: the 2024 Cleaning and Televising of S/S RVSA (Contract No. 2024-010) and the 2024 Milling and Resurfacing Program (Contract No. 2024-001).

local-governmentwoodbridgecounciltrafficcontractsresolutions
Thu Jan 23, 2025

Public Library

Woodbridge Library Board to appoint auditors and legal counsel

The Free Public Library of Woodbridge Board of Trustees will meet to elect officers and appoint professional services. The board will consider resolutions to hire an auditing firm and legal representation.

librarycontractslegal-servicesauditappointments
✓ Decided: Library board approves $126,804.61 in bills and new hire

The Woodbridge Public Library Board of Trustees approved the minutes from the October 24, 2024 meeting, a personnel report appointing Ivonne Castro as a part-time Library Assistant, and bill lists totaling $126,804.61. The board also discussed a proposed Local Author Collection policy and an ALA article about a photo ID library card program, with no final decisions on those items.

Thu Jan 23, 2025

Zoning Board of Adjustment

Zoning Board to review residential construction and variance requests

The Zoning Board of Adjustment will hold public hearings for four bulk variance applications. The board will also tentatively adopt resolutions for three previous cases.

zoningvariancesresidential-constructionpublic-hearings
Wed Jan 22, 2025

Planning Board

Planning Board to hear 972,000 sq ft warehouse proposal in Keasbey

The Woodbridge Planning Board will hold public hearings on a major warehouse development and an amended site plan, and adopt resolutions for two previously approved applications. One minor site plan application has been postponed to March 19, 2025.

planning-boardpublic-hearingwarehousesite-planvarianceswoodbridgekeasbey
Tue Jan 21, 2025

Council

Council considers tax exemptions for four urban renewal projects

The Council is reviewing long-term tax exemptions for four urban renewal LLCs and voting on several infrastructure contracts. The meeting also includes decisions on traffic ordinances, board appointments, and permits for community events.

tax-exemptionsurban-renewalinfrastructuretrafficbudgetappointments
Tue Jan 21, 2025

Council

Council approved long-term tax exemptions for four urban renewal projects

The Woodbridge Township Council adopted ordinances granting long-term tax exemptions to four LLCs for urban renewal projects: 750 Martin Fe, Fulton Street, IV5 Raritan River Logistics Center, and JAP Hospitality. They also amended the SFY2025 budget, passed traffic and cemetery regulation changes, and approved appointments to the Planning Board and Environmental Commission. Several event permits and a street vacation were authorized.

budgettax-exemptionurban-renewaltrafficplanning-boardappointmentsordinances
✓ Decided: Council approves SFY 2025 budget amendment and sets hearing

The Woodbridge Township Council held a special budget meeting and a regular meeting on January 21, 2025. At the special meeting, the Council unanimously approved a resolution to amend the State Fiscal Year 2025 budget and set a public hearing date. During the regular meeting, the Council adopted several ordinances on second reading, including traffic amendments, cemetery regulations, and long-term tax exemption agreements with multiple urban renewal LLCs. The Council also passed numerous resolutions, including appointments to the Planning Board and Environmental Commission, various contracts, and event permits.

Tue Jan 21, 2025

Council

Council to discuss CME Associates proposal for Route 9 & Main St roadway improvements

The Council will discuss several items, including traffic ordinance amendments, a proposal from CME Associates for roadway improvements at Route 9 and Main Street, and a refund of sidewalk permit fees. No formal action will be taken; votes are scheduled for February 4, 2025.

transportationpublic-workstraffic-safetysidewalkspermitsplanning
Tue Jan 21, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Municipal Council will review several liquor license applications, including a person-to-person transfer and corporate structure changes. The agenda also lists various council member portfolios and general administrative items.

liquor-licensesbusiness-permitsmunicipal-government
✓ Decided: Council reviews liquor license transfers and renewals

The meeting was largely procedural, with council members presenting their ward and committee priorities. The municipal clerk reported on liquor license transfers, including a person-to-person transfer from MC Lemon Tree to Violette's Cellar, and several corporate structure changes. No formal votes or final decisions were recorded in the minutes.

Thu Jan 9, 2025

Zoning Board of Adjustment

Zoning Board to review residential and commercial variance requests

The Zoning Board of Adjustment will hold public hearings for four variance applications. The board will also consider the adoption of resolutions for four previously granted applications.

zoningvariancesresidential-constructioncommercial-developmentpublic-hearings
Wed Jan 8, 2025

Planning Board

Planning Board to consider redevelopment investigation for Woodbridge Proper parcel

The Woodbridge Planning Board will hold a public hearing on a minor subdivision modification at 1 & 15 Montrose Ave. in Colonia and consider a minor site plan for a car wash addition at 30 Wylie Ave. in Avenel. The board is also scheduled to adopt a resolution responding to a municipal council request to investigate whether Block 300, Lot 51.01 in Woodbridge Proper should be designated as an area in need of redevelopment. Several resolutions for previously approved applications are tentatively scheduled for adoption.

planning-boardredevelopmentpublic-hearingsubdivisionbulk-variancescar-washwoodbridgecolonia
Tue Jan 7, 2025

Council

Council to introduce four long-term tax exemption ordinances for urban renewal

This regular meeting includes appointments of council president and vice president, first reading of several ordinances, and approval of numerous resolutions. The most notable ordinances would grant long-term tax exemptions for four urban renewal LLCs (750 Martin Fe, Fulton Street, Raritan River Logistics Center, and JAP Hospitality). Other business includes contracts for engineering services, mural installations, emergency elevator replacement, and a preliminary redevelopment investigation.

appointmentsordinancestax-exemptionsurban-renewalcontractsredevelopmentpublic-works
Tue Jan 7, 2025

Council

Council to discuss refund resolution and tax/sewer overpayments

The Woodbridge Council will discuss several administrative items on January 7, with action scheduled for January 21. Notable items include resolutions for tax and sewer overpayments and a refund from the current account. Most agenda entries are department-level requests without specific detail.

budgetfinancerefundstaxesadministration
Tue Jan 7, 2025

Council

Council adopts long-term tax exemptions for four urban renewal LLCs

The Woodbridge Council approved four ordinances granting long-term tax exemptions to 750 Martin Fe Urban Renewal LLC, Fulton Street Urban Renewal LLC, IV5 Raritan River Logistics Center Urban Renewal LLC, and JAP Hospitality Urban Renewal LLC. The council also adopted three traffic ordinance amendments adding restrictions on Louis Street, Cliff Road, and North James Street, and an ordinance amending cemetery regulations. Additionally, they authorized a street vacation on West Kelly Street, approved a $6,510.40 refund of permit fees to Berks Construction Group, and made appointments to the Planning Board and Environmental Commission.

zoningtax-exemptionurban-renewaltrafficappointmentspermitsplanning-boardenvironmental-commission
✓ Decided: Council adopts 8 ordinances incl. traffic changes and tax exemptions

The Woodbridge Township Council held a special budget meeting and a regular meeting on January 21, 2025. At the regular meeting, the Council adopted eight ordinances on second reading, including traffic amendments for Louis Street, Cliff Road, and N. James Street, a cemetery regulations amendment, and long-term tax exemption agreements with four urban renewal LLCs. The Council also passed an ordinance on first reading to vacate a portion of West Kelly Street, and approved 26 consent resolutions covering refunds, appointments, contracts, and event permits. The special budget meeting approved a resolution to amend the SFY 2025 budget and set a hearing date.

Tue Jan 7, 2025

Council

Woodbridge Council to review liquor license transfers and corporate changes

The Municipal Council will meet to discuss various community projects and administrative matters. The agenda includes several applications for liquor license transfers and corporate structure changes.

liquor-licensesbusinessmunicipal-government
✓ Decided: Council reviews liquor license transfers and renewals

The Woodbridge Township Council meeting on January 7, 2025, was largely procedural, with council members presenting their committee agendas. The only substantive item was the Municipal Clerk's report on liquor license applications, including transfers and corporate structure changes, which were noted as under review. No formal votes or decisions were recorded in the minutes.

Tue Jan 7, 2025

Council

Council advances long-term tax exemptions for four development projects

The Woodbridge Township Council reorganized for 2025, electing Cory Spillar as Council President and Sharon McAuliffe as Vice President. The council then approved first reading of several ordinances, including four long-term tax exemption agreements with developers for properties including 750 Martin FE, Fulton Street, IV5 Raritan River Logistics Center, and JAP Hospitality. A consent agenda authorized various routine resolutions including refunds, appointments, and a $13,692 engineering contract for Green Street Dam inspection.

tax-exemptionsdevelopmentcouncil-organizationbudgetpublic-safetyappointments
✓ Decided: Woodbridge Council reorganizes, elects Spillar president and McAuliffe vice president

The Woodbridge Township Council held its reorganization meeting, electing Cory Spillar as Council President and Sharon McAuliffe as Council Vice President for 2025. The council approved the December 17, 2024 minutes, passed eight ordinances on first reading (including traffic changes and tax exemptions), and approved a consent agenda of resolutions covering audits, appointments, refunds, and professional service agreements. Public comments focused on concerns about SeaQuest and animal welfare, with officials noting ongoing investigations.