The Boring PartsFederalLocal · USLocal · Canada
San Bruno, CA

San Bruno public meetings in 2021

208 substantive meetings from 2021, with official agendas or minutes and plain-English summaries.

Tue Dec 21, 2021

Senior Advisory Board

December 21 Senior Citizens Advisory Board meeting cancelled

The regularly scheduled meeting of the Senior Citizens Advisory Board for December 21, 2021, has been cancelled. The next meeting is scheduled for January 18, 2022.

senior-citizensmeeting-cancellation
Thu Dec 16, 2021

Culture & Arts Commission

San Bruno Culture & Arts Commission meeting cancelled

The regularly scheduled Culture & Arts Commission meeting for December 16, 2021, has been cancelled. The next meeting is scheduled for January 20, 2022, at 6:30 p.m. This notice is procedural only.

cancellationculture-arts-commissionmeeting
Thu Dec 16, 2021

Emergency Preparedness Committee

San Bruno preparedness committee to elect chair and vice chair

The Community Preparedness Committee is meeting online to handle routine business, including approving the agenda and minutes, and receiving updates from staff and partner organizations. The main items are electing a chair and vice chair, and discussing the City Council's decision on changing the meeting start time.

emergency-preparednesselectionsmeeting-minutespublic-safetyvolunteers
✓ Decided: Committee elects new chair and vice chair for 2022

The Community Preparedness Committee approved its agenda and minutes, and discussed upcoming bylaw changes. It was announced that Ron LaPedis will become the new Chair and Malcolm Robinson the new Vice Chair, taking office in 2022. No new business was discussed, and other bylaw changes were tabled until the January 2022 meeting.

Thu Dec 16, 2021

Architectural Review Committee

Architectural Review Committee meeting cancelled; items moved to January 13, 2021

The December 16, 2021 Architectural Review Committee meeting has been cancelled. The two items originally scheduled for review have been continued to the January 13, 2021 meeting. The agenda is otherwise procedural, including instructions for public comment via email and accessibility accommodations.

meeting-cancellationarchitectural-reviewpublic-commentaccessibility
Wed Dec 15, 2021

Parks & Recreation Commission

Committee discusses Recreation and Aquatic Center construction updates

The Recreation and Aquatic Center Advisory Committee is meeting to review construction progress and schedules for the project. The agenda includes a report on completed work, upcoming tasks, and change orders.

parksconstructionrecreationpublic works
Wed Dec 15, 2021

Parks & Recreation Commission

December 15 Parks & Recreation Commission meeting cancelled

The regularly scheduled meeting of the San Bruno Parks & Recreation Commission for December 15, 2021, has been cancelled. The next meeting is scheduled for Wednesday, January 19, 2022.

san-brunoparks-and-recreationmeeting-cancellation
Tue Dec 14, 2021

City Council

Council to review first quarter finances and approve budget carryovers

The San Bruno City Council is meeting to receive the first quarter financial update for FY2021-22 and vote on budget amendments and carryover of purchase order encumbrances. The agenda also includes several consent calendar items, including adoption of a mandatory organic waste reduction ordinance and a resolution continuing the local emergency declaration for teleconferenced meetings.

budgetfinanceordinancewasteemergencymeeting-calendar
✓ Decided: Council approves consent calendar, including OSR-8 policy, 4-0-1

The City Council held a special closed session on labor negotiations with no reportable action, then a regular meeting. The council approved the consent calendar, excluding item 6.n, unanimously, and then approved item 6.n (Open Space and Recreation Policy OSR-8) with a 4-0-1 vote (Hamilton recused). They also adopted a resolution approving carryover of FY2020-21 encumbrances and FY2021-22 budget amendments unanimously. Several presentations were received, and council members requested future agenda items.

Tue Dec 14, 2021

City Council

San Bruno City Council holds special meeting with closed labor negotiations

This is a special meeting of the San Bruno City Council held electronically due to COVID-19. The agenda consists of a closed session for labor negotiations with multiple employee bargaining units, followed by adjournment. No other substantive items are listed.

city-councillabor-negotiationsclosed-sessionpublic-commentcovid-19
✓ Decided: Council approves consent calendar, including OSR-8 resolution, 4-0-1

The City Council held a special closed session on labor negotiations with no reportable action, then a regular meeting. The council approved the consent calendar excluding item 6.n, and then approved item 6.n (OSR-8 resolution) with a 4-0-1 vote (Hamilton recused). They also unanimously adopted the first quarter financial update and budget amendments. Several presentations were received, and council members requested future presentations and outreach.

Mon Dec 13, 2021

City Council

Council to review draft policies and procedures at special meeting

The San Bruno City Council is holding a special meeting to discuss and review draft City Council policies and procedures. The meeting is conducted electronically due to COVID-19, with no in-person attendance. Public comments are accepted via email before the meeting start time.

city-councilpoliciesproceduresspecial-meeting
✓ Decided: Council reviews draft policies, takes no action

The San Bruno City Council held a special meeting to discuss and review draft City Council Policies and Procedures. No reportable action was taken on the item. The meeting was procedural in nature, with no substantive decisions made.

Thu Dec 9, 2021

Crime Prevention Committee

✓ Decided: Committee elects Chad Keele as chair, Rich Wong as vice-chair

The Citizens' Crime Prevention Committee elected Chad Keele as chair and Rich Wong as vice-chair by unanimous vote. The committee approved the November meeting minutes, with Deanna Robinson abstaining. Officer Rogge introduced his successor, Officer Garrison Sexson, who will start in January. The committee also adopted two crime tips for next month: preventing catalytic converter theft and holiday drunk driving awareness.

Tue Dec 7, 2021

City Council

San Bruno City Council to hold closed session on litigation

This is a special meeting of the San Bruno City Council held electronically. The agenda consists solely of closed session items: one case of anticipated litigation and existing litigation related to the National Prescription Opiate Litigation. No public action or discussion is scheduled.

city-councilclosed-sessionlitigationopioids
✓ Decided: San Bruno council holds closed session, no public action

The San Bruno City Council met in special session on December 7, 2021, and went into closed session to discuss anticipated litigation (one case) and existing litigation (National Prescription Opiate Litigation). No reportable action was taken, and no public comments were made. The meeting adjourned at 5:40 p.m.

Wed Dec 1, 2021

Traffic Safety & Parking Committee

Committee reviews traffic calming survey for Cunningham Way

The Traffic Safety and Parking Committee is discussing traffic calming tools for Cunningham Way and reviewing speed thresholds for residential streets. The body is also coordinating a stakeholder group for the Local Roadway Safety Plan.

traffic-safetyparkingroad-safetyinfrastructure
Wed Dec 1, 2021

San Bruno Community Foundation

Foundation board to review audit, Tanforan memorial, and elect 2022 officers

The San Bruno Community Foundation Board of Directors will hold a regular meeting via Zoom. They will consider adopting a resolution to continue remote meetings under AB 361, approve the treasurer's report, and hear reports on the audited financial statements, the Tanforan Memorial project, and other strategic initiatives. The board will also elect officers for 2022.

auditbudgetcommunity-foundationmemorialpublic-safetyteleconference
Tue Nov 23, 2021

City Council

San Bruno City Council meeting cancelled for Nov 23, 2021

The regularly scheduled City Council meeting for November 23, 2021 has been cancelled. The next regular meeting will be held virtually on December 14, 2021, with Zoom details to be posted on the agenda.

cancellationcity-councilmeeting
✓ Decided: San Bruno City Council meeting cancelled for Nov. 23, 2021

The City Council's regular meeting scheduled for Tuesday, November 23, 2021, was cancelled. The next regular meeting will be held on December 14, 2021, virtually, with Zoom details on the posted agenda. No decisions were made at this cancelled meeting.

Thu Nov 18, 2021

Culture & Arts Commission

Commission considers $2,600 for Chinese New Year event and approves 2022 calendar

The Culture and Arts Commission is reviewing a recommendation to fund a Chinese New Year program at the Senior Center. The Commission is also considering the approval of the 2022 working calendar.

cultureartsbudgetcommunity-eventssan-bruno
✓ Decided: Commission approves $2,600 city art fund request for Chinese New Year event

The Culture and Arts Commission voted 5-0 to recommend that the City Council fund up to $2,600 from the City Art Fund to sponsor a Community Services Department Chinese New Year event, tentatively set for January 20, 2022, with lion dancers and traditional music. The commission also approved the draft 2022 working calendar by a 5-0 vote. Minutes from October 21, 2021 were accepted 4-0-1. No other substantive decisions were made.

Thu Nov 18, 2021

Emergency Preparedness Committee

Committee to elect chair, plan CERT refresher

The San Bruno Community Preparedness Committee is meeting online to discuss routine business, including electing a Chair and Vice-Chair in December, developing a short CERT refresher course, and possibly changing the meeting start time. The agenda is mostly procedural with updates from staff and ex-officio members.

emergency-preparednesscertmeeting-logisticselections
✓ Decided: Committee tables October minutes, approves CERT refresher course

The committee tabled approval of the October meeting minutes to the December meeting after discussion. It approved the Fire Department's proposal for a CERT refresher course, including firefighter rehab information, with a date to be set in early 2022. Members also agreed to petition the City Council to change the meeting start time from 6:15 pm to 6:30 pm. Nominations for 2022 Chair and Vice Chair were made for a December vote.

Thu Nov 18, 2021

Architectural Review Committee

Pre-application review for a new 3-unit residential project at 820 El Camino Real

The Architectural Review Committee is meeting to conduct a pre-application review for a proposed 3-unit residential development. The committee will also receive a monthly staff report regarding approved sign locations.

zoninghousingdevelopmentsan-brunoarchitectural-review
Wed Nov 17, 2021

Parks & Recreation Commission

Recreation & Aquatic Center construction update and pool expansion review

The Recreation and Aquatic Center Advisory Committee is meeting to receive a construction update and look-ahead schedule for the Recreation and Aquatic Center project, including a change order report and public outreach update. The committee will also discuss pool expansion impacts on operations, programming, and facility design. The agenda includes acceptance of the October 20, 2021 minutes. No action items are listed beyond receiving these updates.

recreationaquatic-centerconstructionpool-expansionpublic-outreach
Wed Nov 17, 2021

Parks & Recreation Commission

San Bruno Parks Commission reviews community award ads and 2022 meeting dates

The Parks and Recreation Commission is reviewing the advertisement for the 2022 Community Services Recognition Award and the upcoming 2022 meeting schedule. Staff also provided updates regarding holiday events including Jingle Around the Block.

parkscommunity-awardspublic-eventsgovernment-meetings
✓ Decided: Parks commission reviews 2022 recognition award ad and meeting dates

The Parks and Recreation Commission reviewed the advertisement for the 2022 Community Services Recognition Award, which now includes a years-of-service line and is PDF-writable, with applications due by February 28, 2022. The commission also reviewed the 2022 meeting dates. No formal votes were taken on these items; the meeting was largely informational and procedural.

Wed Nov 17, 2021

Crime Prevention Committee

Crime Prevention Committee to discuss Neighborhood Watch and outreach

The Citizens’ Crime Prevention Committee will meet via Zoom to discuss Neighborhood Watch requests, committee outreach strategies, and potential updates to the 2021 calendar. The meeting also includes a review of ways to recognize active block captains and provide training for committee members.

crime preventionneighborhood watchpublic safetycommunity outreach
Tue Nov 16, 2021

Planning Commission

Planning Commission meeting with agenda and packet

This is a procedural agenda for the San Bruno Planning Commission meeting on November 16, 2021. It lists only the agenda item and references the agenda and packet documents, with no specific decisions or discussions detailed.

planning-commissionmeetingprocedural
Tue Nov 16, 2021

Senior Advisory Board

San Bruno Senior Advisory Board to hold elections for five board positions

The Board will receive updates on the upcoming election process for all five at-large seats. The meeting also includes a verbal report regarding the parking lot and trash enclosure.

senior-citizenselectionscommunity-servicessan-bruno
✓ Decided: Senior Advisory Board sets election plan for five at-large seats

The board received and filed monthly attendance and nutrition reports, noting low bridge participation and adjusted historical numbers due to no Thursday bingo. Staff outlined the upcoming election for all five at-large seats, with terms of two or one year, advertised in December, with nominations from the floor in January and a possible election in February. Updates were given on the parking lot/trash enclosure project, with contracts being negotiated for work in early 2022.

Thu Nov 11, 2021

Architectural Review Committee

San Bruno Architectural Review Committee meeting cancelled for Nov 11

The regularly scheduled Architectural Review Committee meeting for November 11, 2021 has been cancelled. The committee instead held a special meeting on November 4th, and the next regular meeting is scheduled for December 16, 2021 at 6:00 p.m., conducted virtually via Zoom.

meeting-cancellationarchitectural-reviewsan-brunopublic-meeting
Thu Nov 11, 2021

Crime Prevention Committee

November 11 Crime Prevention Committee meeting cancelled

The regularly scheduled meeting of the Citizens Crime Prevention Committee for November 11, 2021, has been cancelled. A special meeting is instead scheduled for Wednesday, November 17, 2021, at 7:00 p.m.

crime-preventionmeeting-cancellationsan-bruno
Wed Nov 10, 2021

Bicycle & Pedestrian Advisory Committee

BPAC to elect officers, hear safety plan and bike lane updates

The San Bruno Bicycle & Pedestrian Advisory Committee is meeting via Zoom to elect a Chair and Vice Chair, and to hear staff updates on the Local Roadway Safety Plan, a Safe Routes to School grant, the Huntington Avenue cycle track, the Bayhill Specific Plan, and a Caltrans bike highway study. The agenda is mostly informational with no consent calendar items or public hearings.

bicyclepedestriansafetytransportationplanningelections
Tue Nov 9, 2021

City Council

Council to vote on $699,865 vehicle purchase and Recology rate review contract

The San Bruno City Council will hold a regular meeting with several consent items, including a $699,865 vehicle purchase, a $111,355 pump evaluation contract, and a $375,000 park improvement appropriation. The main business item is a contract with R3 Consulting Group to review Recology San Bruno's performance and rates. The council will also consider appointments to the Community Foundation board and approve the 2021 San Mateo County Hazard Mitigation Plan.

budgetcontractsparkspublic-safetywaste-management
✓ Decided: Council approves Recology rate review contract and other items

The San Bruno City Council approved a contract with R3 Consulting Group to conduct a performance and rate review of Recology San Bruno and support negotiations. The council also approved appointments to the San Bruno Community Foundation Board, with a 3-1-1 vote, and adopted the 2021 San Mateo County Multijurisdictional Local Hazard Mitigation Plan. The consent calendar, including vehicle purchases, a pump evaluation agreement, and a patrol rifle purchase, was approved unanimously.

Mon Nov 8, 2021

City Council

Council to review draft policies and procedures for its own operations

The San Bruno City Council will hold a study session to discuss and review a draft of the City Council Policies and Procedures manual. The draft incorporates previous council comments and covers meeting conduct, duties of the mayor and councilmembers, and public participation. No fiscal or environmental impact is noted. The council may direct staff to finalize the draft or amend it for further review.

city-councilpoliciesproceduresgovernancemeeting
✓ Decided: Council reviews and edits draft policies and procedures

The City Council discussed and made edits to the Draft City Council Policies & Procedures document, based on majority consensus for each edit. No final decision was made; the council will continue the discussion at a future special meeting. The meeting was procedural, with no substantive decisions or votes recorded.

Fri Nov 5, 2021

City Council

City Council holds special meeting with closed labor negotiations

The San Bruno City Council is holding a special meeting on November 5, 2021, primarily to enter closed session for labor negotiations with multiple employee groups. The agenda includes public comments for non-agenda items, but no other substantive business is listed. The meeting is conducted via Zoom due to COVID-19 precautions.

city-councillabor-negotiationsclosed-sessionspecial-meeting
✓ Decided: San Bruno City Council holds special meeting, no public action

The San Bruno City Council met in a special session on November 5, 2021, but took no reportable action. The only item was a closed session with labor negotiators, and no decisions were made publicly. The meeting adjourned at 6:10 p.m.

Thu Nov 4, 2021

Architectural Review Committee

Architectural Review Committee to consider two home additions in San Bruno

The Architectural Review Committee will hold a public hearing on two residential projects: a large addition at 1261 Claremont Drive and a new home at 326 Hazel Avenue. The committee will also receive a staff report on sign approvals. The meeting will be conducted via Zoom due to COVID-19 restrictions.

architectural-reviewzoningresidentialuse-permitpublic-hearing
Wed Nov 3, 2021

Traffic Safety & Parking Committee

Committee approves findings for five residential street traffic calming requests

The Traffic Safety and Parking Committee reviewed petitions for traffic calming on several residential streets. The committee approved staff recommendations regarding the findings while noting a need to review existing guidelines following upcoming speed surveys.

traffic-safetyresidential-streetsspeedingpublic-workstransportation
Wed Nov 3, 2021

San Bruno Community Foundation

San Bruno Community Foundation meeting with agenda and packet only

This is a procedural agenda for the San Bruno Community Foundation meeting on November 3, 2021. The agenda lists only the agenda and meeting materials (an agenda packet PDF), with no specific action items or discussion topics provided. The meeting appears to be routine with no substantive decisions or proposals detailed.

community-foundationmeetingprocedural
Tue Oct 26, 2021

City Council

Council to get first quarterly update on strategic initiatives, including 2022 ballot measures

The San Bruno City Council is holding a special meeting to receive the first quarterly update on its FY 2021-22 strategic initiatives, with a focus on initiatives related to city ballot measures for the November 2022 general election. The meeting is conducted via Zoom due to COVID-19 precautions under AB361. Public comments can be made orally or by email.

city-councilstrategic-initiativesballot-measurespublic-commentzoom
✓ Decided: Council directs staff to prep ballot measures for Nov 2022 election

The City Council received the first quarterly update on FY 2021-22 strategic initiatives, focusing on potential ballot measures for the November 2022 election. Council directed staff to proceed with preparing information on a City Charter and Commercial Tax measure, and to gather information on potential measures for Stormwater, Gambling Club Table Tax, Rotating Mayor, and Campaign Finance Reform. No formal votes were taken; the actions were directions to staff.

Tue Oct 26, 2021

City Council

Council to adopt water management plan and approve sidewalk repair contract

The San Bruno City Council is meeting to consider routine consent items, including approving a $489,589.50 sidewalk repair contract and a $349,528 parking lot overlay project, as well as holding a public hearing to adopt the 2020 Urban Water Management Plan and Water Shortage Contingency Plan. The agenda also includes presentations from the Peninsula Humane Society, the Culture & Arts Commission, and the Bicycle & Pedestrian Advisory Committee, plus a written update on COVID-19 response efforts.

water-managementsidewalk-repairparking-lotcovid-19public-hearingbudget
✓ Decided: Council adopts 2020 Urban Water Management Plan and contingency update

The City Council unanimously adopted the 2020 Urban Water Management Plan and the Water Shortage Contingency Plan Update, directing staff to submit them to the Department of Water Resources. The consent calendar was approved unanimously, including contracts for sidewalk repair and senior center parking lot overlay. Council also directed staff to research lowering speed limits to 15 mph near schools and the senior center.

Thu Oct 21, 2021

Culture & Arts Commission

Culture & Arts Commission to review annual report, hear museum presentation

The San Bruno Culture and Arts Commission will review the draft 2020/2021 Annual Report to City Council, receive a presentation from the Peninsula Art Museum, and consider cancelling its December 16, 2021 meeting. The meeting will be held via Zoom due to COVID-19 restrictions.

cultureartsannual-reportmuseummeeting-cancellation
✓ Decided: Commission cancels December 16 meeting, hears museum update

The Culture and Arts Commission voted 5-0 to cancel its December 16, 2021 meeting, following tradition. They also accepted the September 16, 2021 minutes and received a presentation from the Peninsula Art Museum, which is seeking volunteers and funding. No other substantive decisions were made.

Thu Oct 21, 2021

Emergency Preparedness Committee

San Bruno Community Preparedness Committee meeting agenda

The committee will discuss social media usage and review the Lowes Fire Safety Event held on October 9, 2021. Members will also discuss bylaws regarding committee membership size and emergency resource maintenance.

emergency-preparednesspublic-safetybylawscommunity-safety
✓ Decided: Committee discusses social media outreach, Lowes event, and bylaw changes

The Community Preparedness Committee approved the agenda and September minutes, then discussed using social media to publicize meetings and coordinating with the Fire Department on PSAs. They reviewed the upcoming Lowes event and ways to improve it, and discussed bylaw changes, including clarifying Municipal Code vs. Bylaws and changing the meeting time, with the City Attorney's help. Staff reports covered fire mitigation, police issues, and Red Cross updates, but no formal votes were taken.

Wed Oct 20, 2021

City Council

Recreation and Aquatic Center project update

The Recreation and Aquatic Center Advisory Committee is meeting to receive an update on the Recreation and Aquatic Center Project. The agenda includes only this update and standard procedural items; no decisions or votes are listed.

recreationaquatic-centerproject-update
Wed Oct 20, 2021

Parks & Recreation Commission

Recreation and Aquatic Center project update

The Recreation and Aquatic Center Advisory Committee is meeting to receive an update on the Recreation and Aquatic Center Project. The agenda includes only this new business item, along with standard procedural items. No decisions are listed.

recreationaquatic-centerproject-update
✓ Decided: Recreation and Aquatic Center project update received, no action taken

The Recreation and Aquatic Center Advisory Committee received updates from city staff on the Recreation and Aquatic Center project, including construction schedule, working groups, and public communication. No formal decisions were made; the meeting was informational only.

Wed Oct 20, 2021

Parks & Recreation Commission

Commission to consider canceling December 15 meeting

The Parks and Recreation Commission will meet via Zoom to discuss a verbal report on the draft annual report to City Council and consider a staff recommendation to cancel the December 15, 2021 meeting. The agenda is otherwise routine, with public comment and consent items.

parksrecreationannual-reportmeeting-cancellationpublic-comment
✓ Decided: Commission cancels December 2021 meeting, approves annual report presentation

The Parks and Recreation Commission unanimously voted to cancel the December 15, 2021 meeting due to holiday proximity. They also accepted the minutes from September 15, 2021, and discussed the upcoming annual report presentation to the City Council on November 9, 2021, which Chair Palmer will deliver. No other substantive decisions were made.

Tue Oct 19, 2021

Planning Commission

No substantive agenda items listed for the October 19, 2021 meeting

The provided documents contain only the meeting agenda and no specific discussion topics or decisions. There are no substantive items listed for review in the available text.

procedural
Tue Oct 19, 2021

City Council

✓ Decided: Council hears district-based election options, gives staff direction

The City Council held a public hearing on transitioning to district-based elections but took no formal action. Council directed staff to provide information on two options: four council districts with a directly elected mayor, and five council districts with a rotational mayor. The item was informational only, and no motion was required.

Tue Oct 19, 2021

Senior Advisory Board

Senior Advisory Board to review September attendance and nutrition reports

The San Bruno Senior Citizens Advisory Board is meeting to accept minutes, receive monthly class attendance and nutrition site reports, and discuss senior center operations. The agenda is largely procedural, with the main substantive item being the review of September 2021 data on class attendance, meal service, and front desk sign-ins.

senior-servicesnutritionattendancereportsmeeting
✓ Decided: Senior Board accepts minutes, discusses trash enclosure and compost

The Senior Citizens Advisory Board accepted the minutes of the September 21, 2021 meeting. No substantive decisions were made; the meeting focused on reports and discussions, including meal delivery ending, compost bin plans, and the sold-out Halloween party.

Mon Oct 18, 2021

City Council

City Council discusses new state housing laws and a development proposal

The City Council will receive a report regarding recently adopted statewide housing laws, including Senate Bill 9 and Senate Bill 10. The Council will also receive a report regarding an SB 35 and Density Bonus development proposal located at 732 – 740 El Camino Real.

housingzoningdevelopmentlegislation
✓ Decided: Council hears reports on new housing laws and El Camino Real project

The City Council received two informational reports: one on recently adopted state housing laws and another on a proposed SB35 and density bonus development at 732-740 El Camino Real. No motions were taken, and no decisions were made; the items were for information only.

Fri Oct 15, 2021

San Bruno Community Foundation

San Bruno Community Foundation Audit Committee special meeting scheduled

The San Bruno Community Foundation is holding a special meeting of its Audit Committee. The provided agenda contains no specific discussion items or proposed actions.

auditgovernment-oversight
Thu Oct 14, 2021

Architectural Review Committee

Architectural Review Committee to consider residential addition at 3800 Fleetwood Drive

The committee will review a permit request for a residential addition that would increase the total floor area of a single-family home to over 3,000 square feet. The meeting also includes a monthly report from the Director regarding approved sign locations.

zoninghousingarchitectural-reviewsan-bruno
Thu Oct 14, 2021

Crime Prevention Committee

San Bruno Crime Prevention Committee to discuss Neighborhood Watch and outreach

The committee will review updates on Neighborhood Watch requests, community outreach strategies, and the 2021 calendar. The meeting includes a listening campaign by Chief Johansen and staff reports from SBPD Officer Rogge.

crime-preventionneighborhood-watchpublic-safetycommunity-outreachsan-bruno
Wed Oct 13, 2021

San Bruno Community Foundation

San Bruno Community Foundation nomination committee special meeting

This is a special meeting of the San Bruno Community Foundation Board Nomination Ad Hoc Committee. The agenda is limited to procedural items, with no specific decisions or discussions listed.

community-foundationnominationspecial-meeting
Wed Oct 13, 2021

City Council

Committee to interview and select applicants for San Bruno Community Foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to interview applicants for the foundation's board of directors and to discuss and select a slate of applicants to recommend to the San Bruno City Council for appointment. The agenda includes public comments, approval of prior meeting minutes, and the main business of interviews and selection.

appointmentscommunity-foundationcity-councilinterviews
Tue Oct 12, 2021

City Council

Council to vote on Bayhill/Google development ordinances and hate crime resolution

The San Bruno City Council is meeting to consider consent items including contracts, project completions, and grant acceptances, plus a resolution denouncing hate crimes. The most significant action is the second reading and adoption of ordinances related to the Bayhill Specific Plan and Google LLC's Phase 1 development, which would establish zoning and a development agreement. The council will also receive a report on the Safe & Equitable Policing Review and make mayoral appointments for 2021.

zoningdevelopmentpolicebudgetpublic-safetyhousing
✓ Decided: Council adopts Bayhill Specific Plan ordinances for Google Phase 1 development

The City Council approved the consent calendar, including ordinances establishing the Bayhill Specific Plan and a development agreement with Google LLC for Phase 1 in the Bayhill Office Park. They also adopted a resolution denouncing hate crimes and made appointments to fill 2021 mayoral appointments. Mayor Medina recused from voting on item 5.1 and the appointments due to potential conflicts of interest.

Tue Oct 12, 2021

City Council

Council to adopt Bayhill Specific Plan ordinances and Google development agreement

The San Bruno City Council is meeting to consider consent items including the adoption of ordinances for the Bayhill Specific Plan and a development agreement with Google LLC for Phase 1 in the Bayhill Office Park. The council will also receive a report on the Safe & Equitable Policing Review, consider a resolution denouncing hate crimes, and discuss a possible alternative election method. The meeting is held via Zoom due to COVID-19.

zoningdevelopmentpolicebudgetgrantstrafficpublic-safety
✓ Decided: Council adopts Bayhill Specific Plan ordinances and Google development agreement

The City Council approved the consent calendar, including ordinances establishing the Bayhill Specific Plan and a development agreement with Google LLC for Phase 1 of the Bayhill Office Park project. The council also adopted a resolution denouncing hate crimes and made appointments to various committees. No substantive decisions were made during the special meeting, which only received presentations.

Mon Oct 11, 2021

City Council

Council to hold closed session on property purchase with school district

The San Bruno City Council is holding a special meeting on October 11, 2021, at 5:00 p.m. via Zoom. The main item is a closed session to discuss the price and terms of payment for a property (APN 020-351-430) with the San Bruno Parks School District. Public comments are limited to items not on the agenda, and the next regular meeting is scheduled for October 12.

city-councilclosed-sessionpropertyschool-districtzoom
✓ Decided: Council directs staff to prioritize interviews for commissions losing quorum

The City Council held a special meeting to discuss the interview and appointment process for advisory commissions, boards, and committees. They unanimously directed staff to schedule interviews first for those bodies that would lose a quorum when terms expire at the end of October, with other interviews to be scheduled in November. No public comments were made, and no other substantive decisions were taken.

Wed Oct 6, 2021

Traffic Safety & Parking Committee

Traffic Safety & Parking Committee meeting cancelled

The regularly scheduled meeting for October 6, 2021, has been cancelled. The next meeting is scheduled for November 3, 2021.

traffic-safetyparking
Wed Oct 6, 2021

San Bruno Community Foundation

San Bruno Community Foundation October meeting cancelled

The San Bruno Community Foundation's regularly scheduled meeting for Wednesday, October 6, 2021, has been cancelled. The next regular meeting is scheduled for Wednesday, November 3, 2021, at 7:00 p.m. This notice is procedural only, with no agenda items to discuss.

meeting-cancellationcommunity-foundation
Mon Oct 4, 2021

City Council

Committee to interview San Bruno Community Foundation board applicants

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to interview applicants for the board of directors. The committee will also discuss the next steps in the nomination process.

community-foundationboard-appointmentsnominations
✓ Decided: Committee interviews six applicants for foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee met and interviewed six applicants for the Board of Directors. The committee also discussed next steps, including concluding interviews and deliberating on a slate to recommend to the City Council. No final decisions were made; the process continues at the next meeting on October 13.

Mon Oct 4, 2021

San Bruno Community Foundation

San Bruno Community Foundation board nomination committee meets

This is a special meeting of the San Bruno Community Foundation Board Nomination Ad Hoc Committee. The agenda lists no specific discussion items, only references to the agenda, minutes, and meeting packet documents. The meeting appears to be procedural, with no substantive decisions or discussions detailed in the agenda text.

community-foundationboard-nominationsmeeting
Mon Oct 4, 2021

San Bruno Community Foundation

Foundation board nomination committee special meeting

This is a special meeting of the San Bruno Community Foundation Board's Nomination Ad Hoc Committee. The agenda contains only the single item 'Agenda' with a linked PDF document. No substantive decisions or discussions are listed.

foundationcommitteemeeting
Tue Sep 28, 2021

City Council

San Bruno holds public hearing on transition to district-based elections

The City Council is conducting a public hearing to receive input on creating district boundaries and discussing the potential formation of a districting commission. This is part of a transition from an at-large election system to a by-district system for the November 2022 General Municipal Election.

electionsdistrictinggovernmentpublic-hearing
✓ Decided: Council adopts Bayhill Specific Plan and approves Google Phase 1 development

The City Council unanimously approved the Bayhill Specific Plan and related environmental and zoning actions, and approved Google LLC's Phase 1 development in the Bayhill Office Park, including a subdivision map, development agreement, and architectural review permit. Mayor Rico Medina recused himself from these items due to a potential conflict of interest. The council also approved the consent calendar and chose to have the council itself adopt district boundaries for the districting process.

Tue Sep 28, 2021

City Council

City Council to consider Bayhill Specific Plan and Google Phase 1 development

The City Council will hold public hearings to adopt the Bayhill Specific Plan and approve Phase 1 of Google LLC's development in the Bayhill Office Park. The body will also consider several contracts for CityNet Services and a salary range adjustment for the Public Works Director.

zoningdevelopmentgooglecontractsbayhillbudget
✓ Decided: Council adopts Bayhill Specific Plan and Google Phase 1 project

The City Council held public hearings and unanimously approved the Bayhill Specific Plan, including the water supply assessment, environmental impact report, general plan amendment, and zoning changes. It also approved Google LLC's Phase 1 development, including a tentative tract map, development agreement, architectural review permit, and curb marking changes. Mayor Rico Medina recused himself from these votes due to a potential conflict of interest. Earlier, the council chose to have the council itself adopt district boundaries rather than form a commission.

Mon Sep 27, 2021

City Council

Committee to interview applicants for San Bruno Community Foundation Board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to interview candidates for the Board of Directors. The committee will also discuss next steps in the nomination process and provide direction to staff.

community-foundationboard-appointmentsinterviews
✓ Decided: Committee interviews 4 board applicants, schedules remaining interviews

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee interviewed four applicants for the Board of Directors. They directed staff to try scheduling all remaining interviews for October 4 and decided not to call references for any applicants. The meeting was procedural, with no final selections made.

Mon Sep 27, 2021

San Bruno Community Foundation

Committee to interview 12 applicants for Community Foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to interview applicants for the Foundation's Board of Directors and to discuss next steps. The committee previously reviewed 12 applications and agreed to interview all of them. This meeting is part of the recruitment process to recommend four applicants to the City Council for appointment.

community foundationboard nominationinterviewsappointments
✓ Decided: Committee interviews 4 board applicants, schedules remaining interviews

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee interviewed four applicants for the Board of Directors. The committee directed staff to schedule all remaining interviews for October 4 and decided not to call references for any applicants. The meeting was procedural, with no final appointments made.

Thu Sep 23, 2021

Emergency Preparedness Committee

Committee to discuss Lowes fire safety event and bylaws

The San Bruno Community Preparedness Committee is meeting to discuss a fire safety event at Lowes on October 2, 2021, and to consider changes to its membership and bylaws. The agenda includes public comments and reports from staff and subcommittees.

emergency-preparednessfire-safetybylawscommunity-event
✓ Decided: Committee plans Oct 2 fire safety event, tables bylaws discussion

The Community Preparedness Committee approved the agenda and August minutes, and discussed logistics for the Oct 2 fire safety event at Lowe's parking lot. Bylaws discussion was tabled to the October meeting. Staff reported on fire department activities, including road closures and new hires.

Tue Sep 21, 2021

Planning Commission

San Bruno Planning Commission meeting agenda, no substantive items listed

This agenda contains only the agenda item itself and attached PDF documents, with no listed decisions, discussions, or public hearings. It appears to be procedural boilerplate.

agendaplanning-commissionprocedural
Tue Sep 21, 2021

Senior Advisory Board

Senior Advisory Board to review Senior Center reopening update and annual report

The San Bruno Senior Citizens Advisory Board is meeting to receive updates on the Senior Center's reopening, including class attendance and nutrition reports, and to review a draft presentation for the annual City Council report. The meeting is being held via Zoom due to COVID-19 restrictions.

senior-servicesreopeningcovid-19recreationpublic-comment
✓ Decided: Senior Advisory Board accepts July minutes, reviews reports

The Senior Citizens Advisory Board accepted the minutes from the July 20, 2021 meeting. Staff provided updates on class attendance, nutrition site reports, and the Senior Center reopening, including discussions about meal delivery funding and bingo schedules. The board reviewed a draft presentation for the annual City Council report scheduled for October 12, 2021.

Mon Sep 20, 2021

City Council

San Bruno Community Foundation Board Nomination Committee meeting

The Ad-Hoc Committee will meet to review applications for the San Bruno Community Foundation Board. The committee intends to select applicants for interviews and establish an interview schedule.

community-foundationgovernment-appointmentssan-bruno
✓ Decided: Committee will interview all 12 applicants for San Bruno Community Foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee reviewed 12 applications received by the City Clerk's office, including two submitted after the deadline, and agreed to interview all 12 applicants. The Committee directed staff to prepare a list of interview questions and agreed to conduct 25-minute interviews using a ranking system, aiming for consensus on a slate of four applicants. Interviews are scheduled for September 27, October 4, and October 13, 2021.

Mon Sep 20, 2021

San Bruno Community Foundation

Committee to review SBCF board applications and select interviewees

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to review applications received for the SBCF Board and select applicants to be interviewed. They will also discuss the interview process and schedule, and provide direction to staff. Public comments are limited to items not on the agenda.

community-foundationboard-nominationspublic-meeting
✓ Decided: Committee to interview all 12 applicants for community foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee reviewed 12 applications received by the City Clerk's office, including two submitted after the deadline, and agreed to interview all 12 applicants. The Committee directed staff to prepare a list of interview questions and agreed to conduct 25-minute interviews using a ranking system, aiming for consensus on a slate of four applicants. Interviews were scheduled for September 27, October 4, and October 13, 2021. No applicants were selected or denied at this meeting.

Fri Sep 17, 2021

City Council

City Council to discuss investigation findings regarding Mayor Rico E. Medina

The City Council is meeting to review an independent investigation into allegations of misconduct by Mayor Rico E. Medina. The Council may consider actions including censure, restricting city-paid travel, or removing the Mayor from appointed committees.

city-councilmayorethics-investigationgovernment-conduct
✓ Decided: Council censures Mayor Medina, removes him from committees until Sept 2022

The San Bruno City Council held a special meeting to discuss an investigation involving Mayor Rico E. Medina. Mayor Medina read a prepared statement and then recused himself from the discussion. The council voted 3-1-1 to adopt a resolution censuring the Mayor and removing him from all committee appointments and liaison positions within the city until September 3, 2022. Councilmember Salazar opposed the motion, and Mayor Medina was recused.

Thu Sep 16, 2021

Culture & Arts Commission

Commission to discuss annual report and recommend $2,600 for Dia de los Muertos

The San Bruno Culture and Arts Commission will discuss its 2020/21 annual report to the City Council and consider recommending up to $2,600 from the City Art Fund to sponsor a Dia de los Muertos event. The meeting is held via Zoom due to COVID-19 restrictions.

cultureartsannual-reportfundingevent
✓ Decided: Commission recommends $2,600 for Día de los Muertos event

The Culture and Arts Commission voted 4-0 to recommend spending up to $2,600 to sponsor a Día de los Muertos event, moving it to the Senior Center with a band. They also discussed the annual report to City Council, with Commissioner Tobin volunteering to present it on October 26. No other substantive decisions were made.

Thu Sep 16, 2021

City Council

Heart Committee reviews resolution on hate crimes and United Against Hate Week

The Heart Committee is reviewing a draft resolution to recommend to the City Council regarding solidarity with the Black and Brown community. The committee is also discussing proposed activities for United Against Hate Week scheduled for November 14-20, 2021.

communitysocial justicepublic safetydiversity
Thu Sep 16, 2021

Emergency Preparedness Committee

San Bruno Emergency Preparedness Committee meeting canceled

The regular September 16, 2021 meeting of the San Bruno Emergency Preparedness Committee has been canceled. The agenda includes routine items such as approval of minutes and updates from police, fire, Radio Club, CERT, and Red Cross, but no substantive decisions are scheduled.

emergency-preparednessmeeting-cancellationpublic-safetyvolunteer-updates
Thu Sep 16, 2021

Architectural Review Committee

San Bruno committee to review two residential additions, including continued Fleetwood Drive project

The Architectural Review Committee will hold a public hearing on two residential addition proposals in single-family zones, one of which was continued from August. The committee will also receive the director's monthly report on sign approvals. The meeting will be held via Zoom due to COVID-19 restrictions.

zoningresidentialarchitectural-reviewpublic-hearinguse-permit
Wed Sep 15, 2021

Parks & Recreation Commission

Commission to review Concerts in the Park and plan fall/winter programs

The San Bruno Parks and Recreation Commission will receive a report on the 2021 Concerts in the Park program and upcoming fall and winter programs, and discuss its 2020-21 annual report to be presented to the City Council. The meeting is held via Zoom due to COVID-19 restrictions.

parksrecreationeventsannual-reportcovid-19
✓ Decided: Parks and Recreation Commission hears fall program report, plans annual report

The Commission received a report on the successful Concerts in the Park program and upcoming fall/winter activities, including Movies in the Park, a family overnight, and a new intergenerational bocce tournament. They also discussed the 2020-21 annual report, which will be presented to the City Council on November 9th, with a draft to be reviewed at the next meeting. No formal decisions were made; the meeting was informational and planning-focused.

Tue Sep 14, 2021

City Council

San Bruno City Council to consider disposable food service ware ordinance

The City Council will discuss a new ordinance regarding disposable food service ware and a potential parklet program. The body is also deciding on a human resources software contract and appointments for a Downtown Ad Hoc Committee.

environmentsoftwarezoningdowntownpublic-works
✓ Decided: Council approves $222,718 NEOGOV contract for HR software services

The City Council unanimously approved a resolution authorizing the City Manager to execute a 36-month contract with GovernmentJobs.com (NEOGOV) for human resources software services, not to exceed $222,718, with an annual renewal option. Councilmembers Marty Medina and Tom Hamilton were appointed to the Downtown Ad Hoc Committee. The council also tabled consent item 5.c (approval of August 24 meeting minutes) to September 28, 2021, and issued a proclamation declaring October 3-9, 2021 as Fire Prevention Week.

Thu Sep 9, 2021

Crime Prevention Committee

Crime Prevention Committee to discuss Neighborhood Watch and outreach

The Citizens' Crime Prevention Committee is meeting to discuss routine business, including approving minutes, receiving updates on Neighborhood Watch, and planning outreach efforts. The agenda includes discussions on crime tips, social media use, and benefits for active block captains. The meeting is held via Zoom due to COVID-19 restrictions.

crime-preventionneighborhood-watchoutreachpublic-safetymeeting
Wed Sep 8, 2021

Bicycle & Pedestrian Advisory Committee

Bicycle & Pedestrian Advisory Committee to discuss Huntington Avenue cycle track

The committee is meeting to receive staff updates on local infrastructure and planning projects. The session includes introductions of new members and updates on sub-committee activities.

bikingpedestrian-safetyplanninginfrastructure
Wed Sep 8, 2021

Revenue Measure Oversight Committee

Committee to review Measure G funds, road projects, $300K allocation

The San Bruno Citizens Revenue Measure Oversight Committee will meet to receive updates on Measure G revenue projections and remaining fund balance, hear a presentation on citywide road projects and discuss Measure G roadway funding, and discuss allocating $300,000 of Measure G funds to landscape architectural services. The meeting is held virtually due to COVID-19 restrictions.

measure-gbudgetroadslandscapeoversight-committee
Tue Sep 7, 2021

Planning Commission

Planning Commission to review 271 El Camino Real project

The San Bruno Planning Commission is meeting to consider an item related to 271 El Camino Real, as detailed in the meeting packet. The agenda contains only this one substantive item, with the rest being procedural materials.

planning-commissionel-camino-realdevelopment-review
Wed Sep 1, 2021

San Bruno Community Foundation

Board to consider strategic plan, investment report, and program updates

The San Bruno Community Foundation Board of Directors will hold a regular meeting via Zoom on September 1, 2021, at 7:00 p.m. The agenda includes receiving reports on the investment portfolio, the Small Business Recovery and Assistance Program, and other programs, as well as discussing the strategic planning process and upcoming officer elections. The board will also consider resolutions to cancel the October meeting and approve the Treasurer's Report.

foundationinvestmentstrategic-plangrantscovid-19-reliefboard-meeting
Wed Sep 1, 2021

San Bruno Community Foundation

SBCF Board to review investments, strategic plan, and COVID-19 relief grants

The San Bruno Community Foundation Board of Directors will meet via Zoom to receive reports on the investment portfolio, the Small Business Recovery and Assistance Program, and other programs, and to consider adopting a new strategic plan. The board will also vote on canceling the October meeting and approving the treasurer's report. Public comments can be submitted by email.

investmentsstrategic-plancovid-19-reliefgrantsboard-meeting
Wed Sep 1, 2021

Traffic Safety & Parking Committee

Committee reviews traffic calming requests for five residential streets

The Traffic Safety and Parking Committee is discussing traffic calming requests for five residential streets based on resident petitions and speed surveys. Staff reports indicate that Walnut Street does not meet the speed threshold required for traffic calming measures.

traffic-safetyparkingroadstraffic-calming
Tue Aug 24, 2021

City Council

City Council to vote on Recology rate increase and Huntington Avenue project

The City Council will consider a 1.87% rate increase for Recology garbage and recycling services. The body is also reviewing several infrastructure contracts and a new disposable food service ware ordinance.

waste-managementinfrastructurecontractsordinancesbudget
✓ Decided: Council adopts 1.87% garbage rate increase, introduces food ware ordinance

The San Bruno City Council held a special meeting and a regular meeting on August 24, 2021. In the regular meeting, the council approved the consent calendar, including a $916,945 contract for Huntington Avenue design (4-1, Salazar opposed), and adopted a 1.87% Recology garbage rate increase effective October 1, 2021 (4-1, Mason opposed). The council also introduced a disposable food service ware ordinance. No substantive actions were taken in the special meetings, which included a closed session and a study session on strategic initiatives.

Thu Aug 19, 2021

Emergency Preparedness Committee

San Bruno Community Preparedness Committee meeting on August 19, 2021

The committee will discuss bylaw updates and select monthly PSA topics. Staff reports from the Police and Fire departments and reports from the Red Cross, CERT, and Radio Club are also scheduled.

emergency-preparednesspublic-safetycommunity-programssan-bruno
✓ Decided: Committee approves minutes, plans bylaws review for September

The San Bruno Community Preparedness Committee met on August 19, 2021, and approved the agenda and prior meeting minutes as written. No new business was discussed, but the committee scheduled a discussion and clarification of its bylaws for the September 16 meeting. Staff reports covered fire and police updates, including the cancellation of Preparedness Day due to COVID-19 and ongoing wildfire mitigation efforts.

Thu Aug 19, 2021

Culture & Arts Commission

Commission to approve $800 prize budget for new downtown holiday window art contest

The Culture and Arts Commission will discuss a proposal to host a holiday window painting contest in downtown San Bruno, involving local businesses, schools, and community groups. Staff requests approval for prizes not exceeding $800, noting that the traditional tree lighting event is moving to Centennial Plaza due to construction at City Park. The meeting also includes a discussion on inviting local arts organizations to present at future sessions.

artscommunity-eventsdowntownbudget
✓ Decided: Commission approves $800 for Holiday Window Art Contest

The Culture and Arts Commission voted to move forward with a Holiday Window Art Contest for downtown San Bruno businesses, allocating $800 for prizes and logistics. A subcommittee of Commissioners George and Monaghan will advise staff. The commission also discussed inviting local arts organizations to present at future meetings, with staff to develop a calendar and contact groups.

Wed Aug 18, 2021

San Bruno Community Foundation

Investment Committee to review portfolio, RAC cash flow, and strategy

The San Bruno Community Foundation Investment Committee will hold its regular quarterly meeting via Zoom. They will receive an investment outlook and portfolio performance report from Sand Hill Global Advisors, discuss future cash flow strategies for funding the Recreation and Aquatics Center project, and consider an investment strategy proposal from the Board. The agenda also includes public comment, approval of minutes, and the Executive Director's report.

investmentfinancerecreationaquatics-centerfoundation
Wed Aug 18, 2021

Parks & Recreation Commission

Commission reviews spring/summer programming recap and introduces new members

The San Bruno Parks and Recreation Commission met via Zoom on August 18, 2021, to review the spring and summer programming recap. The agenda included the introduction of newly appointed commissioners and the acceptance of minutes from June 16, 2021. No specific contracts, ordinances, or fee changes were listed in the provided text.

parksrecreationprogrammingmeetings
✓ Decided: Parks commission hears summer programs recap, welcomes new members

The Parks and Recreation Commission received a report on spring and summer programming, including 46 classes, 49 camps, and adult softball leagues. No formal decisions were made; the meeting was informational, with commissioners welcoming two new members and discussing park operations.

Tue Aug 17, 2021

Planning Commission

San Bruno Planning Commission meeting cancelled

The Planning Commission meeting scheduled for August 17, 2021, has been cancelled. The provided documents consist of a notice of meeting cancellation and related agenda files.

san-brunoplanning-commissionmeeting-cancellation
Tue Aug 17, 2021

City Council

City Council to consider 1.87% rate increase for Recology garbage services

The City Council is holding a public hearing to discuss and introduce an ordinance for a 1.87% rate increase for Recology San Bruno garbage and recycling services. If approved, the new rates would take effect on September 1, 2021. The increase is based on the Consumer Price Index and landfill disposal costs.

waste-managementfeespublic-hearingrecology
✓ Decided: Council introduces 1.87% garbage rate increase for Oct 1

The City Council held a public hearing and introduced an ordinance to enact a 1.87% rate increase for Recology San Bruno garbage and recycling service, effective October 1, 2021. The motion passed 4-0, with Councilmember Salazar absent. No public comments were made during the hearing.

Tue Aug 17, 2021

Senior Advisory Board

San Bruno Senior Advisory Board August meeting cancelled

The Senior Citizens Advisory Board's regularly scheduled meeting for August 17, 2021 has been cancelled. The next meeting is scheduled for September 21, 2021 at 9:00 a.m., conducted virtually via Zoom. This notice is procedural only; no agenda items are listed.

meeting-cancellationsenior-advisory-boardsan-bruno
Thu Aug 12, 2021

Crime Prevention Committee

San Bruno Crime Prevention Committee to discuss Neighborhood Watch and outreach

The committee will review updates for Neighborhood Watch communities, including results from National Night Out in Merimont, Shelter Creek, and Sea Cliff. Members will also discuss crime prevention tips and potential new roles for Block Captains.

crime preventionneighborhood watchpublic safetycommunity outreachsan bruno
✓ Decided: Committee approves June minutes with corrections, discusses crime updates

The Citizens' Crime Prevention Committee approved the June meeting minutes with corrections, and discussed various crime prevention topics including National Night Out results, Neighborhood Watch updates, and crime tips. No major policy decisions were made; the meeting was largely informational and procedural.

Thu Aug 12, 2021

Architectural Review Committee

Project at 2230 Fleetwood Drive requested continuance

The Architectural Review Committee met on August 12, 2021. The primary item regarding a residential addition at 2230 Fleetwood Drive was postponed by the applicant until the September 16, 2021 meeting.

architectural-reviewresidential-additionzoningsan-bruno
Wed Aug 11, 2021

City Council

Committee to nominate San Bruno Community Foundation board members

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee is meeting to organize its leadership and recruitment process. The body will select a chairperson and review the recruitment timeline and announcement.

community-foundationappointmentsboard-nominations
✓ Decided: Committee selects chair, sets recruitment timeline for foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee selected Councilmember Tom Hamilton as Chair and reviewed a draft recruitment announcement and application, directing staff to incorporate minor edits. The committee agreed to a recruitment schedule with a September 17 application deadline, a September 20 meeting to review applications, and interviews starting the week of September 27. No other substantive decisions were made.

Wed Aug 11, 2021

San Bruno Community Foundation

Committee to select chair and approve recruitment plan

This is a special meeting of the San Bruno Community Foundation Board Nomination Ad-Hoc Committee. The committee will select a chairperson and review and approve a draft recruitment announcement and timeline for board nominations. Public comments are limited to items not on the agenda.

community-foundationboard-nominationrecruitmentmeeting
✓ Decided: Committee selects chair, sets Sept. 17 application deadline for foundation board

The San Bruno Community Foundation Board Nomination Ad-Hoc Committee held a special meeting and selected City Councilmember Tom Hamilton as Chair. The committee reviewed and approved a draft recruitment announcement and application, directing staff to incorporate minor edits. They also agreed on a recruitment timeline with a September 17 application deadline, a September 20 meeting to review applications, and interviews starting the week of September 27.

Tue Aug 10, 2021

City Council

San Bruno City Council meeting for August 10, 2021, cancelled

The regularly scheduled City Council meeting for August 10, 2021, has been cancelled. The next regular meeting is scheduled for August 24, 2021.

city-councilmeeting-cancellation
Wed Aug 4, 2021

Traffic Safety & Parking Committee

San Bruno traffic safety and parking committee meets Aug. 4

This is a regular meeting of the San Bruno Traffic Safety & Parking Committee. The agenda includes only the agenda and meeting materials documents, with no specific items listed, indicating a procedural or administrative session.

trafficparkingmeeting
Wed Jul 28, 2021

San Bruno Community Foundation

Special meeting agenda with no listed action items

This is a special meeting of the San Bruno Community Foundation with an agenda containing only the agenda itself and a reference to meeting materials. No specific decisions, discussions, or action items are listed, so the agenda is purely procedural boilerplate.

community-foundationspecial-meetingprocedural
Tue Jul 27, 2021

City Council

San Bruno City Council to consider water system and website contracts

The City Council will discuss several service contracts, including water system repairs and a website redesign. The body is also reviewing curb and stop sign changes and an update to the municipal code regarding vehicles and traffic.

contractsroadswater-systemwebsitetraffic
✓ Decided: Council approves consent calendar, Tanforan fact sheet, traffic code update

The San Bruno City Council approved the consent calendar, including contracts for water system repairs, a roadway safety plan, and a website redesign. It authorized the release of a Reimagining Tanforan land use fact sheet (4-0-1, mayor recused) and introduced an ordinance amending Title 7 (Vehicles and Traffic). Two councilmembers were appointed to a nomination ad hoc committee.

Wed Jul 21, 2021

Parks & Recreation Commission

San Bruno Parks & Recreation Commission meeting cancelled

The Parks & Recreation Commission meeting scheduled for July 21, 2021, has been cancelled. The next meeting is set for August 18, 2021, at 6:30 p.m., conducted virtually via Zoom.

parksrecreationmeeting-cancellationsan-bruno
Tue Jul 20, 2021

Planning Commission

Planning Commission to review agenda and packet for July 20 meeting

This is a procedural agenda with no substantive items listed. The commission will consider the amended agenda and the meeting packet.

planning-commissionprocedural
Tue Jul 20, 2021

Senior Advisory Board

San Bruno senior board to discuss reopening Senior Center July 26

The Senior Citizens Advisory Board is meeting via Zoom to handle routine business, including accepting June minutes and receiving monthly meal totals. The main discussion item is the planned reopening of the Senior Center on July 26, 2021, following COVID-19 closures.

senior-servicescovid-19reopeningmealspublic-comment
✓ Decided: San Bruno Senior Center to reopen July 26 with mask mandate

The Senior Citizens Advisory Board received and filed monthly meal totals and discussed the upcoming reopening of the Senior Center on July 26, 2021. Staff confirmed that masks will be required indoors for all, per city mandate, and that the center will open gradually with modified services, including ending grab-and-go and delivery programs by September due to funding limits. The board also discussed seating arrangements, bakery sales, and the return of activities like pedro and mahjong.

Thu Jul 15, 2021

Emergency Preparedness Committee

Committee to discuss wildfire safety, social media outreach, and bylaws

The San Bruno Community Preparedness Committee is meeting online to discuss community preparedness topics. They will review updates on social media outreach, choose the August public service announcement topic (wildfire safety and PSPS), and receive reports from police, fire, and volunteer groups. The committee will also discuss its bylaws and how meeting minutes are posted.

emergency-preparednesswildfirepublic-safetysocial-mediabylaws
✓ Decided: Committee tables bylaw changes pending city attorney review

The Community Preparedness Committee met and approved the April minutes as amended and May minutes as read. A motion was passed to table discussion of the committee's changed bylaws until next month, pending clarification from the City Attorney. Staff reports covered fire and police updates, including the Bootleg fire response and a fentanyl arrest.

Thu Jul 15, 2021

Architectural Review Committee

San Bruno committee to review two residential additions requiring permits

The San Bruno Architectural Review Committee will hold a public hearing on two residential addition proposals, each requiring a Use Permit and one also needing an Architectural Review Permit. The meeting will be conducted via Zoom due to COVID-19 restrictions, with public comments accepted by email. Staff will also provide a monthly report on sign approvals.

architectural-reviewuse-permitresidential-additionpublic-hearingzoning
Thu Jul 15, 2021

Culture & Arts Commission

San Bruno Commission to select Movies-in-the-Park and discuss holiday contest

The Culture and Arts Commission will review public voting results to select four movies for the September 'Movies-in-the-Park' series. The meeting also includes discussions regarding a new downtown holiday window painting contest and potential presentations from local arts organizations.

cultureartscommunity-eventssan-brunopublic-voting
Wed Jul 14, 2021

Bicycle & Pedestrian Advisory Committee

Bicycle & Pedestrian Advisory Committee discusses Huntington Avenue cycle track

The committee met to receive staff updates on Public Works projects and grant progress. Discussions included intersection improvements and bicycle infrastructure updates.

bikingpedestriansroadspublic-worksinfrastructure
Tue Jul 13, 2021

City Council

San Bruno Council to authorize $112,000 for small business grants

The City Council will consider authorizing up to $112,000 in American Rescue Act Funds to support small businesses. The body will also discuss the Storm Drainage and Flood Protection Fee election and fill vacancies on several city commissions.

small-businessbudgetstorm-drainageappointmentslitigation
✓ Decided: Council directs staff to analyze storm drainage fee election ballots

The City Council received an oral report on the Storm Drainage and Flood Protection Fee Election and directed staff to draft a plan to hire a vendor to analyze returned ballots and to participate in a possible future regional effort. The Council also approved the consent calendar, including using up to $112,000 in ARPA funds for small business micro-grants, and made appointments to several commissions and committees.

Thu Jul 8, 2021

Crime Prevention Committee

San Bruno crime prevention meeting cancelled for July 8

The Citizens Crime Prevention Committee's regular July 8, 2021 meeting is cancelled. The next scheduled meeting is August 12, 2021 at 7:00 p.m. This notice is procedural only, with no agenda items to report.

crime-preventionmeeting-cancellationsan-bruno
Wed Jul 7, 2021

San Bruno Community Foundation

Board to discuss investment strategy and grant priorities

The San Bruno Community Foundation Board of Directors will hold a regular meeting via Zoom. The main business item is a strategic planning discussion on investment strategy, recommendations from the Community Listening Campaign 2.0, the process for annual program budget allocations, and how to evaluate and select priorities for strategic grants. The board will also consider routine items including canceling the August 4, 2021 meeting and approving the May 2021 Treasurer's Report.

foundationgrantsinvestmentstrategic-planningpublic-meeting
Wed Jul 7, 2021

San Bruno Community Foundation

Board to discuss investment strategy, grant priorities, and budget process

The San Bruno Community Foundation Board will hold a strategic planning discussion on investment strategy, recommendations from the Community Listening Campaign 2.0, the process for annual program budget allocations, and how to evaluate and select priorities for strategic grants. The board will also consider routine items including canceling the August 4, 2021 regular meeting and approving the May 2021 Treasurer's Report. Public comments are accepted via Zoom or email.

budgetgrantsinvestmentstrategic-planningcommunity-foundation
Wed Jul 7, 2021

Traffic Safety & Parking Committee

San Bruno traffic safety committee meets with agenda packet only

This is a procedural agenda for the San Bruno Traffic Safety & Parking Committee meeting on July 7, 2021. The agenda lists only the agenda and meeting materials documents, with no specific items for decision or discussion provided in the text.

traffic-safetyparkingmeetingprocedural
Tue Jul 6, 2021

City Council

City Council to review draft policies and procedures

The San Bruno City Council is holding a special meeting to conduct a study session. The body will discuss and review draft City Council Policies & Procedures.

city-governmentpolicyprocedures
✓ Decided: Council authorizes opposition letter to RHNA 6 housing allocation

The City Council unanimously authorized the City Manager to forward an opposition letter, with suggested edits, regarding the City of San Bruno's final draft Regional Housing Needs Allocation (RHNA) 6 Allocation. The council also discussed and edited the Draft City Council Policies & Procedures, with a future special meeting to be scheduled to continue the work.

Wed Jun 23, 2021

San Bruno Community Foundation

Board discusses investment strategy for post-RAC future

The San Bruno Community Foundation Board is holding a special meeting to continue strategic planning discussions, focusing on the Foundation's role, community needs, and investment strategy after it disburses $50 million for a new Recreation and Aquatic Center. The board will review community feedback and consider options for spending remaining funds, including a quasi-endowment or a 25-year spend-down. No formal decisions are expected at this session; a final decision is planned for the July 7 regular meeting.

strategic-planninginvestmentcommunity-foundationbudgetpublic-comment
Wed Jun 23, 2021

San Bruno Community Foundation

Board to discuss investment strategy for post-RAC future

The San Bruno Community Foundation Board will hold a study session to discuss its investment strategy, including whether to spend funds over 25 years or maintain a quasi-endowment. The discussion follows a community listening campaign and will inform a formal decision at the July 7 meeting. The agenda is otherwise procedural, with public comment and board comments.

strategic-planninginvestmentcommunity-foundationbudgetpublic-comment
Tue Jun 22, 2021

City Council

City Council to certify rejection of proposed Storm Drainage and Flood Protection Fee

The City Council is meeting to adopt a resolution certifying the results of a June 15, 2021, mail-ballot election. Because property owners rejected the proposed Storm Drainage and Flood Protection Fee, the city will abandon proceedings to impose it.

feesstorm-drainageelectioninfrastructure
✓ Decided: Council adopts FY2021-22 budget, capital plan, and fee schedule

The San Bruno City Council held a special meeting to certify the June 15 mail-ballot election results for a proposed storm drainage fee, which failed, and abandoned the proceedings. At the regular meeting, the council approved the consent calendar, including several construction contracts and appointments, and held a public hearing to adopt the FY2021-22 operating budget, FY2021-26 capital improvement program, Gann limit, and cost recovery policy. The budget was approved 4-1 with Councilmember Salazar opposed, and the council directed staff not to use Measure G funds for Downtown Streetscape, referring the matter to the Citizens Revenue Measure Oversight Committee.

Tue Jun 22, 2021

City Council

San Bruno City Council discusses budget approvals and infrastructure projects

The City Council will review the FY2021-22 operating and capital improvement budgets. The agenda includes several construction contracts for street and intersection improvements, as well as a presentation on 4th of July safety.

budgetinfrastructurepublic safetyroadsconstruction
✓ Decided: Council adopts FY2021-22 budget, capital plan, and fee schedule

The City Council held a public hearing and adopted the FY2021-22 operating budget, FY2021-26 capital improvement program budget, the Gann appropriations limit, and the cost recovery policy and user fee schedule. The budget was approved 4-1 with Councilmember Salazar opposed. The Council also directed staff not to use Measure G funds for the Downtown Streetscape and to refer the matter to the Citizens Revenue Measure Oversight Committee.

Fri Jun 18, 2021

Revenue Measure Oversight Committee

San Bruno revenue measure oversight committee meets June 18

The Revenue Measure Oversight Committee is holding a regular meeting with an agenda, presentation, and staff report. The agenda contains only procedural items with no listed decisions or discussions.

revenueoversightcommitteemeeting
Thu Jun 17, 2021

Emergency Preparedness Committee

San Bruno emergency committee to discuss wildfire safety, social media outreach

The San Bruno Community Preparedness Committee is meeting online to discuss unfinished business including social media outreach and monthly PSA topics, with wildfire safety and PSPS as the next topic. Staff reports cover police, fire, and a wildfire abatement process update, and the committee will discuss bylaws and posting of minutes.

emergency-preparednesswildfire-safetypublic-safetysocial-mediabylaws
Thu Jun 17, 2021

Culture & Arts Commission

San Bruno arts panel to pick 10 movies for public vote, plan local group presentations

The Culture and Arts Commission will narrow a list of 16 movies to 10 for community voting on the September Movies in the Park series, and will discuss inviting local arts and culture organizations to present at future meetings. The meeting is held remotely via Zoom due to COVID-19 health orders.

culture-and-arts-commissionmovies-in-the-parkpublic-votingcommunity-organizationszoom-meetingsan-bruno
Wed Jun 16, 2021

Parks & Recreation Commission

Parks commission to hear reports on recreation center contract and Lara Field project

The San Bruno Parks and Recreation Commission will receive reports on the award of a contract for the Recreation and Aquatics Center and on the completion of the Lara Field Grandstands and Concession Stand project. The meeting is held via Zoom due to COVID-19 restrictions, and public comments are accepted by email.

parksrecreationcontractscapital-projectspublic-comment
✓ Decided: Parks Commission hears $43M Recreation and Aquatics Center contract update

The Parks and Recreation Commission received a presentation on the Recreation and Aquatics Center project, including the City Council's award of a $43 million construction contract to Lathrop Construction. The project is fully funded, with groundbreaking expected in August and completion in early 2023. The Commission also received a report on the completed Lara Field grandstands and concession stand project, funded by a $150,000 Measure K grant and other sources.

Tue Jun 15, 2021

Planning Commission

San Bruno Planning Commission cancels June 15 meeting

The San Bruno Planning Commission has cancelled its regularly scheduled meeting for June 15, 2021. The next meeting is set for July 20, 2021 at 7:00 p.m., to be held virtually via Zoom and televised on CityNet Services Channel 1.

planning-commissionmeeting-cancellationsan-bruno
Tue Jun 15, 2021

San Bruno Community Foundation

Board to vote on $40.46M grant for San Bruno Recreation and Aquatic Center

The San Bruno Community Foundation Board of Directors is holding a special meeting to consider a strategic grant to the City of San Bruno for construction of the Recreation and Aquatic Center. The proposed grant amount is not to exceed $40,464,454.15. The board will receive a report on the project and vote on a resolution approving the grant.

grantrecreationaquatic-centerbudgetpublic-comment
Tue Jun 15, 2021

Senior Advisory Board

Senior Advisory Board to review trust funds, meal totals, 35th anniversary ideas

The Senior Citizens Advisory Board will meet via Zoom to receive and file monthly meal totals, review financial reports for the Senior Trust and Bequest Funds, and discuss ideas for the Senior Center's 35th anniversary celebration in January 2022. The agenda includes routine items like minutes approval and public comment, with no new business listed.

senior-servicesmealstrust-fundanniversarybudget
✓ Decided: Senior Center plans July reopening with meals, bingo, classes

The Senior Citizens Advisory Board accepted the May 18, 2021 minutes and received reports on meal totals and trust fund finances. Staff announced plans to reopen the Senior Center in July for lunch, bingo, and classes, with a postcard mailing before July 1. No formal votes were taken; the meeting was informational and planning-focused.

Fri Jun 11, 2021

City Council

City Council to discuss property negotiations for 201 Balboa Way

The San Bruno City Council is holding a special meeting via Zoom. A closed session will include a conference with a real property negotiator regarding price and terms of payment for the property at 201 Balboa Way.

real estategovernment-negotiationsparks-and-recreation
✓ Decided: Council holds closed session on Balboa Way property, no action

The San Bruno City Council met in special session and held a closed session to discuss the price and terms of payment for the property at 201 Balboa Way with the San Bruno Parks School District. No reportable action was taken during the closed session. The meeting was otherwise procedural, with no public comments and no substantive decisions made.

Thu Jun 10, 2021

Crime Prevention Committee

Crime Prevention Committee to discuss Neighborhood Watch incentives and outreach

The Citizens' Crime Prevention Committee is meeting to discuss routine business, including approving previous minutes, public comments, and updates on Neighborhood Watch and outreach. They will consider incentives for active block captains, such as certificates, gift certificates, and ride-alongs, and plan crime prevention topics for social media. The meeting is held via Zoom due to COVID-19.

crime-preventionneighborhood-watchoutreachpublic-safetycovid-19volunteers
Thu Jun 10, 2021

Architectural Review Committee

San Bruno Architectural Review Committee meeting cancelled

The Architectural Review Committee's regular meeting scheduled for June 10, 2021, has been cancelled. The next meeting will be held virtually via Zoom on July 15, 2021, at 6:00 p.m. This notice is procedural only; no agenda items are listed.

cancellationarchitectural-reviewmeetingsan-bruno
Wed Jun 9, 2021

City Council

City Council to review San Bruno Community Foundation FY2021-22 budget

The City Council is holding a special meeting to adopt a resolution approving the San Bruno Community Foundation's budget for fiscal year 2021-22. The Council will also receive the City Manager's proposed operating and capital budget for the same period.

budgetgrantsscholarshipsrecreationcommunity-foundation
✓ Decided: Council hears budget reports, takes no action

The San Bruno City Council held a special meeting on June 9, 2021, to receive reports on the San Bruno Community Foundation FY2021-22 Budget and the City Manager's Proposed Operating and Capital Budget for FY2021-22. Both items were discussion-only, and no motions were taken. The meeting adjourned at 9:37 p.m.

Tue Jun 8, 2021

City Council

City Council to review proposed 2021-22 budget and election districting

The City Council will receive the proposed budget for Fiscal Year 2021-22 and discuss transitioning to a by-district method for city elections. The body will also consider several contracts for transportation planning and engineering services.

budgetelectionsroadstransportationpublic-safety
✓ Decided: Council approves $43M Recreation and Aquatics Center construction contract

The City Council unanimously approved a resolution authorizing the design and construction of the Recreation and Aquatics Center, including a $43,031,000 contract with Lathrop Construction, Inc., a $4,687,046 contingency, and a total project budget of $59,980,228. The council also approved a $45,000 contract with National Demographics Corporation for districting services to transition to by-district elections. The proposed FY 2021-22 budget was received as a discussion item only, with no motion taken.

Thu Jun 3, 2021

City Council

City Council to interview applicants for commission and board vacancies

The San Bruno City Council is holding a special meeting to conduct interviews with applicants seeking to fill vacancies on various city boards and committees. The meeting will be held via Zoom due to health directives.

governmentappointmentspublic-meetings
✓ Decided: Council interviews commission applicants; appointments deferred

The San Bruno City Council held a special meeting to interview applicants for vacancies on various commissions, boards, and committees. No appointments were made during the meeting; the council will decide appointments at a future meeting. The meeting was otherwise procedural, with no other substantive decisions.

Wed Jun 2, 2021

San Bruno Community Foundation

San Bruno Community Foundation meeting with agenda and packet

This is a regular meeting of the San Bruno Community Foundation. The agenda includes only the agenda and meeting materials; no specific action items are listed.

community-foundationmeeting
Wed Jun 2, 2021

Traffic Safety & Parking Committee

San Bruno traffic safety committee meeting agenda posted

This is a procedural agenda for the San Bruno Traffic Safety & Parking Committee meeting on June 2, 2021. The agenda lists only the agenda and meeting materials documents, with no specific discussion items or decisions detailed.

traffic-safetyparkingmeeting-agenda
Tue Jun 1, 2021

City Council

City Council to review proposed FY 2021-2022 Operating and Capital Improvement Budget

The City Council is holding a special study session to review the City Manager's proposed budget for the 2021-2022 fiscal year. This includes the Operating budget and the Capital Improvement Program (CIP).

budgetpolicepublic-safetyhuman-resourcesfinance
✓ Decided: Council reviews proposed FY 2021-2022 budget, no action taken

The City Council held a study session to review the City Manager's proposed Fiscal Year 2021-2022 Operating and Capital Improvement Program (CIP) Budget. The presentation was given by City Manager Jovan Grogan and Finance Director Qianyu Sun. This was a discussion item only, and no motion was taken. The meeting adjourned at 9:32 p.m.

Tue May 25, 2021

City Council

San Bruno City Council to discuss budget amendments and plaza improvements

The City Council will review a third-quarter financial update and budget amendment for FY2020-21. The body is also considering several resolutions related to affordable housing fees, animal control services, and city infrastructure agreements.

budgetaffordable-housinganimal-controlinfrastructurepublic-works
✓ Decided: Council approves $150K Centennial Plaza activation plan, 4-1

The City Council approved the consent calendar, including a resolution to activate Centennial Plaza with improvements, increasing the budget from $80K to $150K, with remaining funds returned to the Park-in-Lieu Fund (4-1, Salazar opposed). The Council also approved a five-year animal control agreement with San Mateo County, the third-quarter budget amendment, and a resolution authorizing the City Manager to vote in a storm drainage fee mail ballot election, all unanimously. A discussion on moving to a rotating mayor model was tabled pending cost information from the County Elections Division.

Thu May 20, 2021

Culture & Arts Commission

San Bruno Culture & Arts Commission to select movies for September program

The Commission is reviewing selected artists for the Library Community Art Gallery and preparing movie selections for the annual Movies-in-the-Park series. Staff also proposed a new process for local arts organizations to present at future meetings.

cultureartslibrarycommunity-eventssan-bruno
✓ Decided: Commission selects artists for gallery exhibit

The Culture and Arts Commission accepted the April minutes and announced the selected artists for the Community Gallery exhibit: Ellen Silva, Chuba Oyolu, and Tony Williams. The commission discussed narrowing a list of 16 movies to 10 for community voting on the Movies-in-the-Park series, with final selection to occur at the next meeting. No formal votes were taken on these items.

Thu May 20, 2021

Emergency Preparedness Committee

San Bruno emergency committee to discuss social media and July 4th safety

The Community Preparedness Committee is meeting online to discuss routine updates on social media outreach, choose a monthly public service announcement topic (July 4th safety), and receive reports from police, fire, and community groups. The agenda is largely procedural with no major decisions or public hearings.

emergency-preparednesspublic-safetysocial-mediapublic-service-announcement
✓ Decided: Committee agrees to staff table at annual Preparedness Day on Sept. 18

The San Bruno Community Preparedness Committee met on May 20, 2021, and approved the agenda. No minutes were reviewed, and no substantive decisions were made. The committee agreed to have a table at the annual Preparedness Day on September 18, and staff will look into the Wildfire Ambassador Program. Reports covered social media outreach, a wildfire mitigation plan for Crestmoor Canyon, and police DUI enforcement.

Wed May 19, 2021

Parks & Recreation Commission

Parks Commission to honor Brian Hafter, hear Unity Memorial update

The San Bruno Parks and Recreation Commission is meeting via Zoom on May 19, 2021. The agenda includes presenting the 2021 Community Recognition Award to Brian Hafter and receiving a report on the Unity Memorial Sculpture and Reflections Seating Area. The meeting also covers routine items like approving April 21 minutes and public comment.

parksrecreationawardspublic-artmemorial
✓ Decided: Parks Commission honors Brian Hafter with 2021 Community Recognition Award

The Parks and Recreation Commission presented the 2021 Community Recognition Award to Brian Hafter for his dedicated service to San Bruno youth, particularly soccer. The commission also received a report on the Unity Memorial Sculpture and Reflections Seating Area, clarifying the sculpture's name and discussing plaque nomination processes. No formal decisions were made; the meeting was primarily informational and ceremonial.

Tue May 18, 2021

Planning Commission

Planning Commission meeting with agenda documents only

This is a procedural agenda for the San Bruno Planning Commission meeting on May 18, 2021. The agenda lists only the agenda item itself and provides links to three PDF documents (agenda, agenda packet, and a combined agenda). No specific decisions, discussions, or action items are listed in the provided text.

planning-commissionmeeting-agendaprocedural
Tue May 18, 2021

Senior Advisory Board

Senior Advisory Board to discuss 35th anniversary of Senior Center

The San Bruno Senior Citizens Advisory Board is meeting via Zoom to handle routine business, including accepting minutes and receiving monthly meal totals. The main discussion items are planning the 35-year celebration of the San Bruno Senior Center and receiving a report on completed bocce court maintenance. Public comments are accepted via email due to COVID-19 restrictions.

senior-servicescommunity-eventsparksmeeting
✓ Decided: Senior Advisory Board discusses 35th anniversary, bocce maintenance, parking lot repairs

The Senior Citizens Advisory Board accepted the April 20, 2021 minutes and received a report on monthly meal totals. They discussed ideas for the Senior Center's 35th anniversary celebration, to be planned next year, and received an update on bocce court maintenance, with leagues starting June 6th. Board members expressed frustration over delayed parking lot repaving and trash enclosure projects, requesting escalation to the proper department or City Council. Staff provided updates on Senior Center reopening plans, including nutrition and transportation guidelines, and announced an in-person Father's Day dance party.

Thu May 13, 2021

Crime Prevention Committee

Crime Prevention Committee to discuss Neighborhood Watch incentives and outreach

The Citizens' Crime Prevention Committee is meeting via Zoom to handle routine business: approving minutes, hearing public comments, and discussing Neighborhood Watch updates, including new requests, outreach to block captains, and National Night Out. They will also consider a list of incentives for active block captains, such as certificates, gift certificates, and ride-alongs, and review the 2021 calendar. The meeting is largely procedural with no major decisions or financial items on the agenda.

crime-preventionneighborhood-watchpublic-safetyoutreachcovid-19
✓ Decided: Committee approves crime prevention tips, advances Neighborhood Watch outreach

The San Bruno Citizens' Crime Prevention Committee approved two crime prevention tips for CityNet and social media, one about Social Security scams and one about keeping front entrances visible. The committee also discussed a new Neighborhood Watch group in the east Huntington area, with plans to provide flyers and hold future meetings via Zoom. No other substantive decisions were made; the meeting was largely procedural.

Thu May 13, 2021

Architectural Review Committee

San Bruno ARC to review home addition and carport replacement

The Architectural Review Committee will hold a virtual meeting to consider two new business items: a use permit for a 969-square-foot addition to a single-family home at 3111 Summit Road, and an architectural review permit to replace three wood carports with steel ones at 2000 Crystal Springs Road. The agenda also includes the director's monthly report on sign approvals. The meeting is conducted via Zoom due to COVID-19 restrictions.

zoninguse-permitarchitectural-reviewcarportsresidential-addition
Wed May 12, 2021

Bicycle & Pedestrian Advisory Committee

Bicycle & Pedestrian Advisory Committee to hear Commute.org presentation

The committee will receive a presentation from Commute.org and updates on Public Works Department projects and grants. Members will also review existing sub-committees and recruitment for new members.

bicyclingpedestrianspublic-workstransportation
Wed May 12, 2021

San Bruno Community Foundation

Foundation to review strategic plan, scholarship increase

The San Bruno Community Foundation Board is holding a special meeting via Zoom. They will hear a presentation on the Community Listening Campaign 2.0 report and quasi-endowment scenarios, and consider consent items including a resolution to increase the Crestmoor Neighborhood Memorial Scholarship allocation to $195,000.

foundationstrategic-planningscholarshipbudgetpublic-comment
Tue May 11, 2021

City Council

City Council considers $610,000 Acappella Well Replacement Project design

The San Bruno City Council is meeting to discuss infrastructure projects, including downtown trash receptacles and well replacement. The body will also appoint a resident to the Planning Commission and receive updates on COVID-19 and storm drain fee elections.

infrastructureplanning-commissionbudgetpublic-workscovid-19
✓ Decided: Council approves $130K downtown trash receptacle project

The City Council approved the purchase of downtown trash receptacle units, allocating $130,000 from the Solid Waste/Recycling Fund, with an amendment to include 7 additional units not on San Mateo Ave. The council also approved a $610,000 design agreement for the Acappella Well Replacement Project and appointed Marco Durazo to the Planning Commission. All other items on the consent calendar were approved unanimously.

Wed May 5, 2021

Traffic Safety & Parking Committee

Committee to discuss loading zone changes for Bayhill Specific Plan and Allen Elementary

The Traffic Safety and Parking Committee is meeting to discuss modifying loading zones for the YouTube Phase 1 Development and the Allen Elementary School Replacement Project. The body will also review minutes from the March 3, 2021 meeting.

parkingtraffic-safetyloading-zonesbayhill-specific-planschools
Wed May 5, 2021

San Bruno Community Foundation

San Bruno Community Foundation May 5 meeting cancelled; special meeting set for May 12

This agenda is a notice of cancellation for the San Bruno Community Foundation's regular meeting originally scheduled for May 5, 2021. The meeting has been cancelled and replaced with a special meeting on May 12, 2021 at 6:30 p.m., to be held virtually via Zoom. No agenda items are listed in this notice.

meeting-cancellationcommunity-foundationspecial-meetingvirtual-meeting
Mon May 3, 2021

City Council

City Council to discuss property negotiations for 201 Balboa Way

The City Council is holding a special meeting to conduct a closed session. The body will meet with a real property negotiator to discuss the price and payment terms for a specific property.

real-estateproperty-negotiationclosed-session
✓ Decided: Council holds closed session on Balboa Way property, no action

The San Bruno City Council met in special session and entered closed session to discuss the potential acquisition of 201 Balboa Way from the San Bruno Parks School District. No reportable action was taken during the closed session. The meeting adjourned at 8:30 p.m.

Thu Apr 29, 2021

City Council

Council reviews proposed reductions to city user fees

The City Council is reviewing updated recommendations for various user fees as part of a Comprehensive Fiscal Sustainability Project. Staff has modified previous fee proposals to include reductions for certain items following earlier council input regarding economic impacts.

budgetfeesgovernment-operations
✓ Decided: Council directs staff on fee changes, no formal votes

The San Bruno City Council held a study session and provided direction to staff on proposed fee reductions, but took no formal votes. They agreed not to raise appeal fees, to change film permits to actual costs, and to move wireless activity review to full cost recovery. The organizational review report was discussed only, with no action taken.

Tue Apr 27, 2021

City Council

City Council considers construction contracts and property sales

The San Bruno City Council will review several items including a parking lot rehabilitation project, business license administration, and a property sale. The meeting also includes updates on COVID-19 response efforts and community announcements.

zoningbudgetconstructionbusinesspublic-works
✓ Decided: Council interviews four applicants for Planning Commission vacancy

The City Council held a special meeting to interview four applicants for one vacancy on the Planning Commission. No appointment was made during this meeting; the decision is scheduled for the regular meeting on May 11, 2021. The meeting was procedural, with no other substantive decisions.

Tue Apr 27, 2021

City Council

City Council to vote on Lara Field parking lot project and property sale

The City Council will consider a construction contract for parking lot rehabilitation and the sale of The Crossing property. The body will also discuss business license administration and COVID-19 response efforts.

parkingreal-estatecontractstransportationpublic-works
✓ Decided: Council approves sale of The Crossing property and $853K Lara Field parking contract

The City Council unanimously approved a resolution authorizing the City Manager to execute a purchase and sale agreement for The Crossing property, with all necessary documents to close escrow. They also approved a three-year contract with Hinderliter De Llamas and Associates for business license administration. The consent calendar, including a $853,438 construction contract for the Lara Field Parking Lot Rehabilitation Project, was approved unanimously. Council directed staff to bring a resolution for displaying the LGBTQ Pride Flag at City Hall in June and to discuss creating an ad-hoc committee for fireworks stand applications at the May 11 meeting.

Mon Apr 26, 2021

City Council

City Council to review draft policies and procedures

The City Council is holding a special meeting to conduct a study session. The body will discuss and review draft City Council Policies & Procedures.

city-governmentpolicyprocedures
✓ Decided: Council reviews draft policies, schedules fifth special meeting

The City Council held a study session to review the draft City Council Policies & Procedures, making edits based on majority consensus. No final decisions were made; the council will continue discussion at a future special meeting. The meeting was procedural and adjourned without substantive action.

Sat Apr 24, 2021

City Council

City Council to conduct strategic planning and goal setting session

The San Bruno City Council is holding a special meeting via Zoom. The primary agenda item is a study session regarding strategic planning and goal setting for Fiscal Year 2021/22.

government-operationsstrategic-planningfiscal-year-2021-22
✓ Decided: Council holds strategic planning retreat for FY 2021/22, no decisions made

The San Bruno City Council held a special meeting on April 24, 2021, as a study session for strategic planning and goal setting for Fiscal Year 2021/22. The meeting was facilitated by the City Manager and The Mejorando Group, with public comments on topics like cannabis businesses and revenue enhancement. No formal motions or decisions were made; it was a discussion-only item.

Thu Apr 22, 2021

City Council

San Bruno City Council to hold special meeting for employee evaluations

The City Council is holding a special meeting to conduct closed session performance evaluations. The meeting is being held electronically due to COVID-19 health directives.

personnelcity-managementpublic-employees
✓ Decided: Special meeting held; no reportable actions taken

The San Bruno City Council held a special meeting on April 22, 2020, with all members present. No public comment was made, and closed session items regarding performance evaluations for the City Clerk and City Manager resulted in no reportable actions. The meeting adjourned to the regular meeting on April 28, 2020.

Wed Apr 21, 2021

City Council

Council to discuss downtown landscaping and personnel board transitions

The City Council is holding a special meeting to receive a presentation and provide direction on downtown streetscape greening. The body will also discuss transitioning Personnel Board functions to the City Manager’s Office and Human Resources.

landscapingdowntowncity-managementpersonnel
✓ Decided: Council directs $330K for downtown, Centennial Park greening

The City Council held a special meeting and provided direction on two study sessions. They unanimously approved $250,000 for downtown streetscape greening and landscaping, and $80,000 for Centennial Park. They also selected Option 4 for Posy Park improvements and unanimously directed the transition of Personnel Board functions to the City Manager's Office and Human Resources.

Wed Apr 21, 2021

Parks & Recreation Commission

Commission to vote on 2021 Community Recognition Award nominee

The San Bruno Parks and Recreation Commission is meeting via Zoom to handle routine business, including accepting minutes and receiving reports. The main action item is a vote on the nomination for the 2021 Community Recognition Award. Other reports cover the Winter Spring Activity Wrap Up and the Tom Lara Parking Lot Rehabilitation Project.

parksrecreationawardsparking-lotpublic-comment
✓ Decided: Commission selects Brian Hafter for 2021 Community Recognition Award

The Parks and Recreation Commission unanimously selected Brian Hafter for the 2021 Community Recognition Award from nine nominations. The award will be presented at the May meeting. The commission also received reports on the winter/spring activity wrap-up and the Tom Lara Parking Lot Rehabilitation Project, which is set for council bid award on April 27.

Tue Apr 20, 2021

Senior Advisory Board

Senior Advisory Board to review meal totals, virtual programs, HVAC report

The San Bruno Senior Citizens Advisory Board is meeting via Zoom to handle routine business, including accepting minutes, receiving monthly meal totals, a report on virtual senior programming, and an update on the Senior Center HVAC system. The agenda is largely procedural with no major decisions or public hearings listed.

senior-servicesmeetingzoomhvacmeals
✓ Decided: Senior Advisory Board accepts March minutes, hears updates on meals, programs, HVAC

The Senior Citizens Advisory Board accepted the minutes from the March 16, 2021 meeting. Staff provided updates on monthly meal totals, virtual senior programming, and the Senior Center's HVAC system. No formal decisions were made; the meeting was informational.

Tue Apr 20, 2021

Planning Commission

San Bruno Planning Commission meeting with no listed substantive items

This agenda contains only the agenda itself and links to PDF packets, with no listed substantive items. The meeting appears to be procedural, with no specific decisions or discussions detailed in the provided text.

planning-commissionagendaprocedural
Thu Apr 15, 2021

Culture & Arts Commission

Commission to review art gallery submissions and select artists

The San Bruno Culture and Arts Commission is meeting remotely via Zoom due to COVID-19 restrictions. The main business is reviewing submissions for the Community Art Gallery Program and selecting artists. The commission will also hear updates on library reopening and SWA Gallery activities.

artsculturegallerylibrarypublic-comment
✓ Decided: Commission allows Ellen Silva to show art again after COVID interruption

The Culture and Arts Commission voted unanimously to allow artist Ellen Silva to display her work again after her 2019/2020 exhibition was cut short by COVID-19. The commission also reviewed seven submissions for the Community Art Gallery Program and ranked them, with results to be reported at the next meeting. The library reopening plan was announced, including limited in-person hours and curbside service.

Thu Apr 15, 2021

Architectural Review Committee

Hotel, home additions, and new house up for review

The San Bruno Architectural Review Committee will hold a virtual meeting to review three development proposals: a 28-room hotel at 160 El Camino Real, a home addition at 510 Angus Avenue E., and a new house at 482 Garden Ave. The committee will also hear a staff report on sign approvals. Public comments are accepted via email due to COVID-19 restrictions.

zoninghotelhousingarchitectural-reviewceqa
Thu Apr 15, 2021

Emergency Preparedness Committee

San Bruno emergency committee to discuss outreach, PSA topics, website

The Community Preparedness Committee is meeting online to discuss routine business, including social media outreach, monthly public service announcement topics, and a proposed website addition. The agenda is largely procedural, with no major decisions or financial items listed.

emergency-preparednesspublic-safetyoutreachwebsitecommittee-meeting
✓ Decided: San Bruno preparedness committee approves city graphics for channel one

The San Bruno Community Preparedness Committee approved city-made graphics to be posted on channel one during appropriate months. The committee also approved the agenda and minutes with grammar amendments. No other substantive decisions were made; the meeting included reports from staff and committee liaisons.

Tue Apr 13, 2021

City Council

Council to consider $290K in grants for pandemic-hit businesses

The San Bruno City Council will consider supporting local businesses that qualified for the San Mateo County Strong Restaurant, Brewery, and Winery Relief Program by appropriating up to $290,000 from the Emergency Reserve Fund for individual grants up to $10,000. The council will also consider readopting an urgency ordinance that temporarily halts evictions of small business commercial tenants for non-payment of rent due to COVID-19. The agenda includes routine consent items, a COVID-19 update, and announcements about a community cleanup and BART garage closure.

business-grantscovid-19eviction-moratoriumbudgetpublic-safetycommunity-event
✓ Decided: Council approves $290K in grants for local restaurants, breweries, wineries

The City Council unanimously approved a resolution to provide up to $290,000 in individual grants of up to $10,000 to San Bruno businesses that qualified for the San Mateo County Strong Restaurant, Brewery, and Winery Relief Program, funded from the Emergency Reserve Fund and replenished with American Rescue Act funds. The Council also unanimously re-adopted an urgency ordinance establishing a temporary moratorium on evictions for non-payment of rent by small business commercial tenants directly affected by the COVID-19 pandemic. The consent calendar was approved unanimously, including acceptance of accounts payable, payroll, and a $200,000 EPA grant agreement with San Mateo County. No reportable action was taken during the closed session.

Thu Apr 8, 2021

Crime Prevention Committee

San Bruno crime prevention committee meets via Zoom, discusses Neighborhood Watch and outreach

The Citizens' Crime Prevention Committee is holding its regular meeting via Zoom due to COVID-19. The agenda includes routine items like approving minutes and public comment, plus discussions on Neighborhood Watch updates, outreach efforts, and the 2021 calendar. No major decisions or new proposals are listed.

crime-preventionneighborhood-watchoutreachpublic-safetymeeting
Wed Apr 7, 2021

Traffic Safety & Parking Committee

April 7 Traffic Safety & Parking Committee meeting cancelled

The regularly scheduled meeting of the Traffic Safety & Parking Committee for April 7, 2021, has been cancelled. The next meeting is scheduled for May 5, 2021, at 7:00 p.m. via Zoom.

meeting-cancellationsan-bruno
Wed Apr 7, 2021

San Bruno Community Foundation

Foundation to consider $1.12M grant for Tom Lara Field parking lot

The San Bruno Community Foundation Board will meet virtually to consider a strategic grant of up to $1,123,438 to the City of San Bruno for renovations to the Tom Lara Field parking lot related to the Recreation and Aquatic Center project. The board will also receive a report on the project's business plan and a report from the Ad Hoc Committee on Strategic Planning. The agenda includes routine items such as approving minutes, a treasurer's report, and canceling the May 5 meeting.

grantsrecreationaquatic-centerparking-lotstrategic-planningbudget
Tue Apr 6, 2021

City Council

Council considers storm drainage and flood protection fee

The City Council is holding a continued public hearing regarding a proposed Storm Drainage and Flood Protection Fee. The council will consider testimony and written protests before deciding whether to submit the fee to a property owner mail ballot election.

stormwaterfloodingfeespublic-hearinginfrastructure
✓ Decided: Council sends storm drainage fee to property owner mail ballot

The City Council held a continued public hearing on the proposed Storm Drainage and Flood Protection Fee, hearing support and opposition from residents. After closing the hearing, the Council unanimously adopted a resolution to submit the fee to a property owner mailed ballot election.

Tue Mar 30, 2021

City Council

City Council to review traffic study for Huntington Avenue Cycle Track Project

The City Council will receive a traffic study report regarding the installation of a protected bike lane on Huntington Avenue. The body will provide direction on whether to proceed with a design that removes a vehicle travel lane or one that maintains existing lanes.

roadsbikingtrafficinfrastructuregrants
✓ Decided: Council directs staff to proceed with Option 3 for Huntington Avenue cycle track

The City Council held a study session to receive a report on the traffic study for the Huntington Avenue Cycle Track Project. After public comment, the Council directed staff to proceed with Option 3 as presented in the staff report. This was a discussion item only, with no formal motion taken.

Tue Mar 23, 2021

City Council

San Bruno City Council to consider garbage rate increase

The City Council will discuss a proposed garbage rate increase from Recology San Bruno for FY 2021-22. The body will also hold a public hearing regarding storm drainage and flood protection fees and review a traffic study for the Huntington Avenue Cycle Track Project.

waste-managementfeestransportationpolicehousingbudget
✓ Decided: Council approves Recology garbage rate increase for FY 2021-22

The City Council approved a resolution enacting a garbage rate increase proposed by Recology San Bruno for FY 2021-22, and scheduled the property owner notice and protest process required by Proposition 218. The motion also included implementing an Abandoned Waste Pilot Program starting in July 2021. The vote was 4-1, with Councilmember Mason opposed. The council also continued the public hearing on the Storm Drainage and Flood Protection Fee to April 6, 2021.

Thu Mar 18, 2021

City Council

City Council to review draft policies and procedures

The City Council is holding a special meeting to conduct a study session. The body will discuss and review draft City Council Policies & Procedures.

city-governmentpolicyprocedures
✓ Decided: Council edits draft policies, schedules fourth special meeting to continue

The City Council held a study session to review the Draft City Council Policies & Procedures. Council members discussed various sections and made edits throughout the document based on majority consensus for each edit. No final decision was made; the council will meet in a fourth special meeting, with a date to be determined, to continue the discussion and editing.

Thu Mar 18, 2021

Emergency Preparedness Committee

San Bruno Community Preparedness Committee holds online meeting to review staff and committee reports

The San Bruno Community Preparedness Committee met via Zoom on March 18, 2021, to conduct routine business. The agenda included roll call, approval of minutes, and public comments. Staff from Police and Fire, along with reports from the Radio Club, CERT, and Red Cross, were presented. No specific decisions, contracts, or ordinances were listed on the agenda.

emergency-preparednesspolicefirecommunityprocedural
✓ Decided: San Bruno preparedness committee discusses social media, Channel 1 outreach

The committee approved the agenda and prior minutes, but made no substantive decisions. Members discussed using social media, Channel 1, and websites like sf72.org to promote preparedness, and Zidane Mili will report on a conversation with the mayor about platforms. Staff reports covered fire, police, and Red Cross updates, but no formal actions were taken.

Thu Mar 18, 2021

Culture & Arts Commission

San Bruno Culture & Arts Commission March 18 meeting cancelled

The Culture & Arts Commission's regularly scheduled meeting for March 18, 2021, has been cancelled. The next meeting is scheduled for April 15, 2021, at 6:30 p.m. This notice is procedural only, with no agenda items discussed.

meeting-cancellationculture-arts-commissionsan-bruno
Wed Mar 17, 2021

Parks & Recreation Commission

Parks Commission to review recreation fee schedule changes

The San Bruno Parks and Recreation Commission is meeting via Zoom to discuss and potentially act on several items, including a presentation on the Recreation and Aquatics Center project status, establishing a subcommittee for community recognition award nominations, and reviewing proposed changes to the Master Fee Schedule for the Recreation Division. The meeting is held remotely due to COVID-19 restrictions, with public comments accepted via email.

parks-and-recreationfeesaquatics-centercommunity-recognitionzoom-meeting
✓ Decided: Commission reviews fee schedule changes, moves to cost recovery model

The Commission heard a presentation on proposed changes to the Recreation Division's master fee schedule, including simplifying rates from five to three and moving to a cost recovery model. No formal action was taken on the fee changes. The Commission also received a project update on the Recreation and Aquatics Center, noting bids are due March 23rd and groundbreaking is expected in July.

Tue Mar 16, 2021

Planning Commission

Planning Commission meeting with agenda documents only

This is a procedural agenda for the San Bruno Planning Commission meeting on March 16, 2021. The agenda lists only the agenda item itself and provides links to three PDF documents (agenda, agenda packet, and a separate agenda PDF). No specific decisions, discussions, or action items are listed in the provided text.

planning-commissionagendaprocedural
✓ Decided: Planning Commission approves 185 Acacia Ave addition and use permit

The San Bruno Planning Commission unanimously approved an Architectural Review Permit and Use Permit for a residential addition at 185 Acacia Avenue, allowing the single-family home to exceed floor area limits. The project was found categorically exempt from environmental review. The commission also selected volunteers for the April 15 ARC meeting.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] UP20-004, AR20-008 Assistant Planner Brandon Wofford-Asuncion Presented Staff Report Motioned to close public hearing: Commissioner Morgan / Lethin VOTE: 5-0
5 yea
Biasotti yea · Harman yea · Lethin yea · Madden yea · Morgan yea
to approve Use Permit UP20-004 and AR 20-008 based on Findings and Conditions of Approval. Commissioner Morgan / Harman VOTE: 5-0
5 yea
Biasotti yea · Harman yea · Lethin yea · Madden yea · Morgan yea
Tue Mar 16, 2021

Senior Advisory Board

Senior Advisory Board to hear police chief, review meal totals and programs

The San Bruno Senior Citizens Advisory Board is meeting via Zoom to handle routine business, including accepting minutes, receiving updates on meal totals, parking lot restriping, virtual senior programming, and the AARP tax program, and hearing a presentation from Police Chief Ryan Johansen. The meeting is largely informational with no major decisions on the agenda.

senior-servicespolicemealsparkingvirtual-programmingtax-help
✓ Decided: Senior Advisory Board hears police chief, parking lot update

The Senior Citizens Advisory Board accepted the January 19, 2021 minutes and received updates on meal totals, parking lot restriping, virtual programming, and the AARP tax program. Police Chief Ryan Johansen introduced himself and his vision. No formal decisions were made; all items were informational.

Sat Mar 13, 2021

City Council

City Council holds strategic planning session to define future goals

The City Council is conducting a two-day strategic planning advance meeting facilitated by The Mejorando Group. The body is discussing the city's vision statement, governing roles, and priority focus areas to develop a draft strategic plan.

strategic-planningeconomic-developmentinfrastructurecity-governancepublic-safety
✓ Decided: Council holds strategic planning study session, no action taken

The San Bruno City Council held a special meeting on March 13, 2021, as a study session for a strategic planning advance. The session was facilitated by Patrick Ibarra of the Mejorando Group and was for discussion only. No motions were made or decisions taken. The meeting adjourned at 12:13 p.m.

Fri Mar 12, 2021

City Council

City Council holds strategic planning sessions for city goals and vision

The City Council is conducting a two-day strategic planning advance meeting facilitated by The Mejorando Group. The body is discussing governing roles, reviewing the city's vision statement, and sketching goals for priority focus areas.

strategic-planningeconomic-developmentinfrastructurecity-governancepublic-safety
✓ Decided: Council holds strategic planning study session, no action taken

The San Bruno City Council met in a special meeting for a strategic planning advance facilitated by Patrick Ibarra of Mejorando Group. The session was a discussion item only, with no motions or formal decisions made. The meeting adjourned at 6:58 p.m.

Thu Mar 11, 2021

Crime Prevention Committee

Crime Prevention Committee to review Neighborhood Watch and approve crime tips

The San Bruno Citizens' Crime Prevention Committee is meeting via Zoom to handle routine business, including approving previous minutes and discussing Neighborhood Watch updates. They will also vote on approving two crime tips in English and Spanish for public posting, and discuss outreach strategies and CERT partnership. The meeting is largely procedural with several action items carried over from prior sessions.

crime-preventionneighborhood-watchoutreachpublic-safetycovid-19cert
Thu Mar 11, 2021

Architectural Review Committee

March 11 Architectural Review Committee meeting cancelled

The regularly scheduled meeting of the Architectural Review Committee for March 11, 2021, has been cancelled. The next meeting is scheduled for April 15, 2021.

meeting-cancellationarchitectural-review
Wed Mar 10, 2021

Bicycle & Pedestrian Advisory Committee

Committee to review Bayhill Specific Plan bike and pedestrian improvements

The Bicycle & Pedestrian Advisory Committee will meet to receive updates on Public Works projects and grants. The body will also receive a presentation on bike and pedestrian improvements for the Bayhill Specific Plan.

bikingpedestriansplanningbayhill-specific-plan
✓ Decided: Committee approves January minutes; hears Bayhill bike/pedestrian plan updates

The Bicycle & Pedestrian Advisory Committee approved the January 13, 2021 meeting minutes unanimously. No other formal decisions were made. Staff provided informational updates on two city projects (PG&E gas relocation on Angus Ave West and the Cycle Track Project on Huntington and San Mateo Ave), the Bayhill Specific Plan's proposed bike and pedestrian improvements and shuttle service, and a new associate planner hire. The committee also discussed sub-committee updates, including a PSA about blocking sidewalks.

Tue Mar 9, 2021

City Council

San Bruno City Council to vote on major zoning code amendments

The City Council will consider updating the municipal zoning code and the city zoning map. The body will also review a stormwater capture project agreement and discuss curb striping on San Mateo and Angus Avenues.

zoningstormwaterinfrastructurebudgetparking
✓ Decided: Council approves stormwater project consultant contract up to $996,240.58

The City Council approved a resolution authorizing the City Manager to execute a consultant services agreement with WRECO for pre-design support on the Regional Stormwater Capture Project at I-280 and I-380, with a contract amount not to exceed $996,240.58, and to execute a Caltrans Cooperative Agreement for the project initiation document phase. The council also approved a resolution for curb striping changes on San Mateo and Angus Avenues, with amendments converting some proposed yellow zones to green zones. The consent calendar was approved, excluding item 5.e, which was moved to conduct of business. The meeting included presentations on the San Bruno Community Foundation Listening Campaign, the Planning Commission annual report, and a COVID-19 response update.

Wed Mar 3, 2021

Traffic Safety & Parking Committee

San Bruno traffic committee meets with agenda and packet only

This is a procedural agenda for the San Bruno Traffic Safety & Parking Committee meeting on March 3, 2021. The agenda lists only the agenda and meeting materials documents, with no specific discussion or action items provided.

trafficparkingmeeting
Tue Mar 2, 2021

City Council

Council to review draft user fee update and cost recovery policy

The San Bruno City Council is holding a study session to receive a presentation on a draft user fee update and cost recovery policy, with proposed changes set to take effect July 1, 2021. The update includes 288 fee increases, 13 decreases, and 86 new fees, and is part of the city's Comprehensive Fiscal Sustainability Project. The council will provide direction to staff on the draft policy and fees.

user-feesbudgetcost-recoveryfacility-rentalscity-council
Tue Mar 2, 2021

San Bruno Community Foundation

San Bruno Community Foundation meeting agenda and packet for March 2021

This is a procedural agenda for the San Bruno Community Foundation meeting on March 3, 2021. It lists only the agenda and meeting materials, with no specific decisions or discussion items detailed.

meetingagendacommunity-foundation
Wed Feb 24, 2021

City Council

San Bruno City Council special meeting cancelled

The City Council special meeting scheduled for February 24, 2021, at 5:30 p.m. has been cancelled. No business will be conducted at this meeting.

meeting-cancellationcity-council
Tue Feb 23, 2021

City Council

Council to consider major zoning code overhaul and mid-year budget amendment

The San Bruno City Council will hold a public hearing on a comprehensive update to the city's zoning code, covering many chapters including affordable housing, accessory dwelling units, and mixed-use districts. The council will also receive a mid-year financial update and vote on a second-quarter budget amendment for FY2020-21, along with routine consent items and a COVID-19 response update.

zoningbudgethousingordinancefinancial-reportcovid-19
✓ Decided: Council introduces major zoning code overhaul

The City Council held a public hearing and voted unanimously to introduce a comprehensive ordinance amending the zoning code, including changes to definitions, districts, parking, and affordable housing, and to rescind and replace chapters on accessory dwelling units and density bonuses. The council also accepted the Comprehensive Annual Financial Report and approved a second-quarter budget amendment for FY2020-21. No reportable action was taken in the closed session.

Thu Feb 18, 2021

Emergency Preparedness Committee

San Bruno committee to set 2021 goals, discuss social media outreach

The Community Preparedness Committee will meet online to discuss unfinished business, including social media outreach, and set goals for 2021. Staff and committee reports from police, fire, radio club, CERT, and Red Cross are also on the agenda.

emergency-preparednesssocial-mediagoalscommittee-reports
✓ Decided: San Bruno committee discusses fire mitigation, COVID vaccines, crime rise

The Community Preparedness Committee met and reviewed reports on fire department grants, COVID testing and vaccination sites, and a rise in car and package thefts. No formal decisions were made; the committee approved the agenda and prior minutes, and discussed using social media for preparedness information, pending a city policy.

Thu Feb 18, 2021

Culture & Arts Commission

Commission to hear winter reading and arts program update

The Culture and Arts Commission is meeting remotely via Zoom. The main agenda item is an update from the Library Services Manager on the Winter Reading and the Arts program, which the Commission sponsored for $3,400. The agenda also includes routine items like accepting minutes and public comment.

cultureartslibrarywinter-readingcovid-19public-comment
✓ Decided: Commission accepts January minutes, hears library arts update

The Culture and Arts Commission accepted the January 21, 2021 minutes (3-0-4) and received an update from Library Services Manager Barbara Bruxvoort on the Winter Reading and Arts Program, which included several virtual events and workshops. No substantive decisions were made; the meeting was informational.

Wed Feb 17, 2021

Parks & Recreation Commission

Commission to discuss youth sports return-to-play procedures

The Parks and Recreation Commission is meeting via Zoom to elect officers for 2021 and discuss return-to-play procedures for youth sports organizations. The agenda also includes routine items like minutes approval and public comment, with no major decisions or contracts listed.

parksrecreationyouth-sportscovid-19elections
✓ Decided: Commission reelects Palmer as chair, Gonzales as vice chair

The Parks and Recreation Commission unanimously reelected Chair Palmer and Vice Chair Gonzales for 2021. Staff reported that all grass and school district fields are planned to reopen March 1, weather permitting, and discussed return-to-play procedures for youth sports. No other substantive decisions were made.

Wed Feb 17, 2021

San Bruno Community Foundation

Investment Committee to review portfolio and discuss Recreation and Aquatics Center funding

The San Bruno Community Foundation Investment Committee is meeting to review its investment portfolio performance and discuss future cash flow strategies for funding the Recreation and Aquatics Center project. The meeting will be held via Zoom due to COVID-19 restrictions, with public comments accepted by email.

investmentcommunity-foundationrecreation-centerbudgetcovid-19
Tue Feb 16, 2021

Planning Commission

Planning Commission meeting with agenda only, no details

This is a procedural agenda for the San Bruno Planning Commission meeting on February 16, 2021. The agenda lists only the agenda item itself and provides links to PDF documents, with no specific decisions, discussions, or action items described. The meeting appears to be routine or the substantive content is contained in the attached packet.

planning-commissionmeetingprocedural
✓ Decided: Planning Commission closes public hearing on Bayhill Specific Plan Draft EIR

The Planning Commission closed the public hearing on the Draft Environmental Impact Report (EIR) for the Bayhill Specific Plan including the YouTube Phase I Development, with a 3-0-2 vote (two members recused). The Commission also approved a Temporary Use Permit (TUP21-001) for a construction staging area in a City parking lot, with a 4-0-1 vote (one member recused). No other substantive decisions were made.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] Community and Economic Development Director Pamela Wu Presented Staff Report Motioned to close public hearing: Commissioner Lethin / Madden VOTE: 3-0-2
3 yea · 2 recused
Biasotti yea · Lethin yea · Madden yea · Harman recused · Morgan recused
to approve Temporary Use Permit TUP21-001 based on Findings and Conditions of Approval. Commissioner Lethin / Morgan VOTE: 4-0-1
4 yea · 1 recused
Biasotti yea · Lethin yea · Madden yea · Morgan yea · Harman recused
Tue Feb 16, 2021

Senior Advisory Board

San Bruno Senior Advisory Committee meeting cancelled

The February 16, 2021 meeting of the Senior Citizens Advisory Committee has been cancelled. The next meeting is scheduled for March 16, 2021 at 9:00 a.m. This notice is procedural only, with no agenda items to report.

meeting-cancellationsenior-advisorysan-bruno
Thu Feb 11, 2021

Crime Prevention Committee

Crime Prevention Committee to discuss RV parking, Neighborhood Watch updates

The San Bruno Citizens' Crime Prevention Committee is meeting via Zoom due to COVID-19. The agenda includes follow-up on an RV parking situation, updates on Neighborhood Watch programs, and planning for outreach and crime tips. The committee will also review its 2021 calendar and discuss a CERT partnership.

crime-preventionneighborhood-watchrv-parkingoutreachcertcovid-19
Thu Feb 11, 2021

City Council

Council to discuss draft policies and procedures in study session

The San Bruno City Council is holding a special meeting with a closed session on real property negotiations and a study session to discuss draft City Council policies and procedures. The meeting is conducted remotely due to COVID-19 restrictions.

city-councilpoliciesreal-estateclosed-sessionstudy-session
✓ Decided: Council reviews draft policies, no formal action taken

The San Bruno City Council held a special meeting on February 11, 2021, with two sessions. In the first session, the council entered closed session to discuss real property negotiations with Mid-Peninsula Housing, but no reportable action was taken. In the second session, the council held a study session to review and edit the draft City Council Policies & Procedures, making edits by majority consensus, but no formal motion was made. The council will continue the discussion at a future special meeting.

Tue Feb 9, 2021

City Council

Council to cancel FY 2021-22 water and wastewater rate increase

The San Bruno City Council will consider cancelling the previously approved water and wastewater rate increase for fiscal year 2021-22, and will also introduce an ordinance amending Title 6 of the municipal code. The agenda includes routine consent items, including accepting financial reports, approving payroll, and adopting resolutions for project completion and a city manager contract amendment.

water-rateswastewaterordinancegeneral-plancity-managerbudget
Wed Feb 3, 2021

Traffic Safety & Parking Committee

Committee discusses marked crosswalk installation

The Traffic Safety & Parking Committee will review the agenda and approve minutes from the January 6, 2021 meeting. Regular business includes a discussion regarding the installation of a marked crosswalk at Whitman Way, Jenevein Avenue, and Shelter Creek Lane.

traffic-safetyparkingcrosswalksinfrastructure
Wed Feb 3, 2021

San Bruno Community Foundation

Board to hear COVID-19 small business grant report and DEI study session

The San Bruno Community Foundation Board of Directors will receive a report on the Small Business Recovery and Assistance Program, a COVID-19 relief grant, and hold a study session on diversity, equity, and inclusion. The board will also approve the December 2020 financial statements and minutes from the January meeting. The meeting is conducted via Zoom due to the COVID-19 pandemic.

covid-19-reliefsmall-businessdiversity-equity-inclusionfinancial-reportcommunity-foundation
Wed Feb 3, 2021

San Bruno Community Foundation

San Bruno Community Foundation special and regular meeting agenda

This agenda covers a special closed-session meeting and a regular meeting of the San Bruno Community Foundation. The provided text lists only the agenda and meeting materials documents, with no specific items, decisions, or discussion topics detailed. The meeting appears to be procedural, with substantive content contained in the linked PDF packets.

meeting-agendacommunity-foundationclosed-session
Tue Feb 2, 2021

Planning Commission

Planning Commission to review zoning code update

The San Bruno Planning Commission is meeting to discuss a zoning code update, as detailed in the staff report. The agenda includes the item for discussion, but no specific decisions or proposals are listed in the provided text.

zoningplanning
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] Contract Senior Planner Kelly Beggs Presented Staff Report Motioned to close public hearing: Commissioner Harman / Lethin VOTE: 6-0
6 yea
Biasotti yea · Harman yea · Johnson yea · Lethin yea · Morgan yea · Madden yea
to adopt the zoning code and zoning map amemendment. Commissioner Harman / Morgan VOTE: 6-0
5 yea
Biasotti yea · Harman yea · Johnson yea · Lethin Madden yea · Morgan yea
Fri Jan 29, 2021

City Council

Council to review draft policies and procedures in study session

The San Bruno City Council is holding a special meeting via Zoom to discuss and review draft City Council policies and procedures. This is a study session, so no final decisions are expected; the next regular meeting is scheduled for February 9, 2021.

city-councilpoliciesproceduresstudy-sessioncovid-19
✓ Decided: Council reviews draft policies, schedules third meeting

The City Council held a study session to discuss and edit the Draft City Council Policies & Procedures, making edits based on majority consensus. No formal motion was taken, and the discussion will continue at a third special meeting with a date to be determined. The next regular meeting is scheduled for February 9, 2021.

Tue Jan 26, 2021

City Council

Council to approve $1.58M fire truck purchase and discuss housing plan

The San Bruno City Council will hold a special meeting at 6:00 p.m. and a regular meeting at 7:00 p.m. on January 26, 2021. The regular meeting includes a closed session to evaluate the City Manager's performance, followed by public items including a $1.58 million contract for two fire engines, a $84,370 contract for water plan updates, and a study session on the Regional Housing Needs Allocation (RHNA) for the 2023-2031 Housing Element. The council will also consider requests to defer 2021 fee increases and ask Recology to forgo a garbage rate increase due to COVID-19 impacts.

fire-truckswater-planhousingcovid-19budgetpublic-safety
✓ Decided: Council reviews draft policies, schedules third meeting

The City Council held a study session to review the Draft City Council Policies & Procedures, making edits throughout the document based on majority consensus. No formal motion was taken, and the discussion will continue at a third special meeting with a date to be determined. The next regular meeting is scheduled for February 9, 2021.

Thu Jan 21, 2021

Emergency Preparedness Committee

San Bruno emergency committee to pick new chair, vice chair

The San Bruno Community Preparedness Committee is meeting online to handle routine business, including approving minutes from November and December 2020. The main items are selecting a new chair and vice chair, appointing a new council liaison, and discussing ways to communicate public service announcements. The committee will also hear staff and committee reports from police, fire, the radio club, CERT, and the Red Cross.

emergency-preparednesscommitteepublic-safetycommunications
Thu Jan 21, 2021

Culture & Arts Commission

Commission to consider $250 stipends for art gallery artists

The Culture and Arts Commission will meet virtually to conduct routine business, including electing officers for 2021, approving the 2021 meeting schedule, and receiving a presentation from the police chief. A notable item is a proposal to pay a $250 stipend to artists selected for the Community Art Gallery, aiming to boost submissions. The meeting also includes accepting minutes and public comment.

cultureartscommissionstipendmeeting-schedulepolice-presentation
Wed Jan 20, 2021

Parks & Recreation Commission

Parks Commission to hear police chief, set 2021 dates

The San Bruno Parks and Recreation Commission is meeting via Zoom to discuss routine business, including a presentation from the police chief, setting 2021 meeting dates, and updates on winter/spring activities and sculpture relocation. The agenda is largely procedural with no major decisions or public hearings.

parksrecreationpolicemeeting-datesawardssculpture
Tue Jan 19, 2021

Planning Commission

Planning Commission meeting with agenda and packet only

This is a regular Planning Commission meeting agenda. The agenda contains only the standard agenda item and references to the meeting video and packet documents. No specific decisions or discussions are listed.

planning-commissionagendaprocedural
✓ Decided: Planning Commission approves two residential additions in San Bruno

The San Bruno Planning Commission approved two Use Permits for residential additions at 2601 Cottonwood Drive and 3041 Fleetwood Drive, both in R-1 zoning. The Cottonwood Drive permit was approved 4-0 with one recusal and one abstention, while the Fleetwood Drive permit was approved 6-0. The commission also approved the October 20, 2020 minutes with amendments to note recusals, and made administrative appointments for future meetings.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] Commissioner Morgan / Johnson VOTE: 6-0
6 yea
Lethin yea · Biasotti yea · Harman yea · Johnson yea · Madden yea · Morgan yea
[context] Senior Planner Michael Smith: Presented Staff Report Motioned to close public hearing: Commissioner Morgan / Harman VOTE: 5-0-1
5 yea · 1 recused
Lethin yea · Biasotti yea · Harman yea · Johnson yea · Morgan yea · Madden recused
to approve Use Permit 20-002 based on Findings and Conditions of Approval. Commissioner Morgan / Johnson VOTE: 4-0
4 yea · 1 recused
Biasotti yea · Harman yea · Johnson yea · Morgan yea · Madden recused
[context] Senior Planner Michael Smith: Presented Staff Report Motioned to close public hearing: Commissioner Morgan / Johnson VOTE: 6-0
6 yea
Biasotti yea · Harman yea · Johnson yea · Lethin yea · Madden yea · Morgan yea
[context] ABSTAIN: 0 Commissioner Harman / Biasotti VOTE: 6-0
6 yea
Lethin yea · Biasotti yea · Harman yea · Johnson yea · Madden yea · Morgan yea
Tue Jan 19, 2021

Senior Advisory Board

Senior Citizens Advisory Board meeting scheduled for January 19, 2021

The Senior Citizens Advisory Board will conduct its regular meeting via Zoom. The agenda includes a presentation from Police Chief Ryan Johansen and updates regarding winter and spring activities.

seniorspublic safetycommunity servicespoliceprograms
✓ Decided: Senior Advisory Board accepts minutes, hears meal program update

The Senior Citizens Advisory Board met and accepted the minutes from the December 15, 2020 meeting. Staff reported that four part-time employees were hired for the meal delivery program, funded by a county grant. A police chief presentation was postponed to the February meeting. No substantive decisions were made beyond routine approvals.

Thu Jan 14, 2021

Crime Prevention Committee

Crime Prevention Committee to vote on crime tips, discuss Neighborhood Watch updates

The San Bruno Citizens' Crime Prevention Committee is meeting via Zoom due to COVID-19. They will vote on approving December minutes, discuss and vote on crime tips for public posting, and receive updates on Neighborhood Watch, CERT partnership, and the 2021 calendar. Public comments are accepted via email.

crime-preventionneighborhood-watchcertpublic-commentzoom-meeting
Thu Jan 14, 2021

City Council

Council to review draft policies and procedures manual

The San Bruno City Council is holding a special meeting to discuss and review a draft City Council Policies and Procedures manual. This is a study session, so no final decisions are expected; the council will review proposed rules covering meeting conduct, councilmember duties, and public participation.

city-councilpoliciesproceduresmeetingspublic-comment
✓ Decided: Council reviews draft policies, no formal action taken

The San Bruno City Council held a special meeting to discuss and edit the Draft City Council Policies & Procedures. Members made edits throughout the document based on majority consensus, but no formal motion was taken. A second special meeting will be scheduled to continue the discussion.

Thu Jan 14, 2021

Architectural Review Committee

Architectural Review Committee to discuss San Mateo Ave trash receptacles, newspaper racks

The San Bruno Architectural Review Committee is meeting via Zoom on January 14, 2021. The agenda includes no new business items; the committee will provide input on replacing trash receptacles and adding newspaper rack enclosures along San Mateo Avenue, and hear the director's monthly report on sign approvals.

architectural-reviewsan-mateo-avenuetrash-receptaclesnewspaper-rackssignspublic-comment
Wed Jan 13, 2021

Bicycle & Pedestrian Advisory Committee

Bicycle & Pedestrian Advisory Committee meets January 13

The committee is meeting to receive staff updates on public works projects and department staffing. The agenda includes introductions of the Police Chief and a presentation on regional advisory committee functions.

pedestrian-safetybicyclespublic-worksinfrastructure
Wed Jan 13, 2021

Revenue Measure Oversight Committee

San Bruno revenue oversight committee meets with agenda and packet

This is a procedural meeting of the Revenue Measure Oversight Committee with no substantive items listed. The agenda includes only the agenda document and a meeting materials packet, indicating no decisions or discussions are scheduled.

meetingproceduralrevenueoversight
Tue Jan 12, 2021

City Council

Council to consider revised storm drainage and flood protection fee

The San Bruno City Council will hold a regular meeting on January 12, 2021, conducted electronically due to COVID-19. The main business item is a resolution to initiate proceedings for a revised storm drainage and flood protection fee. The council will also receive updates on COVID-19 response and a presentation from HIP Housing, along with several routine consent calendar items.

storm-drainageflood-protectioncontractscovid-19housingpublic-safety
✓ Decided: Council adopts storm drainage fee resolution, defers 5th-year rate hike

The City Council adopted a resolution to initiate proceedings for a revised storm drainage and flood protection fee, with an amendment to delay or defer the fifth-year rate increase for water and sewer. A prior motion to adopt the resolution failed for lack of a second, but a subsequent motion carried unanimously. The council also approved a five-year generator maintenance contract with Odyssey Power, removing a $40,000 General Fund appropriation after an initial motion failed.

Mon Jan 11, 2021

Oversight Board

Oversight board approves San Bruno RDA successor's $1.21M payment schedule and $15,474 budget

The San Mateo County Countywide Oversight Board is approving the Successor Agency to the former San Bruno Redevelopment Agency's Recognized Obligation Payment Schedule (ROPS) for fiscal year 2021-22, totaling $1,210,624 in enforceable obligations, and its administrative budget of $15,474. The resolution also directs the Successor Agency to submit the ROPS to the State Department of Finance. The vote was unanimous, with one member absent.

redevelopmentbudgethousingbondsoversight-boardsan-bruno
Wed Jan 6, 2021

Traffic Safety & Parking Committee

San Bruno Traffic Safety & Parking Committee meeting agenda

This is the agenda for the San Bruno Traffic Safety & Parking Committee meeting on January 6, 2021. The agenda lists only the agenda and meeting materials, with no specific items for discussion or decision. It appears to be procedural boilerplate.

traffic-safetyparkingmeeting-agenda
Wed Jan 6, 2021

San Bruno Community Foundation

San Bruno Community Foundation meeting agenda and packet only

This agenda contains only the agenda document and a meeting materials packet, with no listed action items, discussions, or decisions. The meeting appears to be procedural with no substantive items specified.

meetingproceduralcommunity-foundation
Mon Jan 4, 2021

City Council

City Council to hold closed session evaluating City Manager performance

The San Bruno City Council is holding a special meeting on January 4, 2021, at 5:00 p.m. The only substantive item is a closed session to conduct a performance evaluation of the City Manager, as permitted under Government Code § 54957. Public comments are accepted via email due to COVID-19 restrictions. The next regular meeting is scheduled for January 12, 2021.

city-councilclosed-sessioncity-managerperformance-evaluationcovid-19
✓ Decided: Special meeting held; no reportable action taken

The San Bruno City Council held a special meeting on January 4, 2021, with all members present. The only agenda item was a closed session for a public employee performance evaluation of the City Manager, with no reportable action taken. The meeting adjourned at 6:30 p.m., and no substantive decisions were made.