The Boring PartsFederalLocal · USLocal · Canada
McKinney, TX

McKinney public meetings in 2025

232 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 29, 2025 · 12:00 PM

Animal Service Facilities Advisory Committee

Animal committee to discuss staffing, ordinance updates, and county shelter stats

This committee will discuss Animal Services 2025 staffing updates, activity, and ordinance amendments, as well as Collin County Animal Shelter operations and statistics for McKinney animals. No formal action will be taken, as the agenda states a quorum may be present but no board or council action will occur.

animal-servicesstaffingordinance-amendmentsanimal-sheltercollin-countystatistics
McKinney City Hall 401 E. Virginia Street McKinney, Texas 75069
Mon Dec 22, 2025 · 12:00 PM

Animal Service Facilities Advisory Committee

Animal Service Committee to review 2025 highlights

The Animal Service Facilities Advisory Committee will meet to discuss 2025 highlights and approve minutes from April 2025. The meeting includes a public comment period and an executive session.

animal-servicescommitteepublic-hearingagendamckinney
McKinney City Hall 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3515 — Approved
20 present
Moka Anderson present · Hannah Golden present · Cheryl Darveaux present · Sarah Husstwit present · Jeanne Kelly present · Moka Anderson present · Hannah Golden present · Cheryl Darveaux present · Sarah Husstwit present · Jeanne Kelly present · Moka Anderson present · Hannah Golden present · Cheryl Darveaux present · Sarah Husstwit present · Jeanne Kelly present · Moka Anderson present · Hannah Golden present · Cheryl Darveaux present · Sarah Husstwit present · Jeanne Kelly present
25-3516 — Approved and Referred
5 present
Moka Anderson present · Hannah Golden present · Cheryl Darveaux present · Sarah Husstwit present · Jeanne Kelly present
Thu Dec 18, 2025 · 8:00 AM

McKinney Community Development Corporation

MCDC to consider 14 event grant applications and loan extension

The McKinney Community Development Corporation will review multiple grant applications for 2026 community events and promotional activities. The board will also discuss infrastructure funding and a loan term extension for a villa development project.

grantseconomic-developmentinfrastructurecommunity-eventsloans
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Approved
6 yea · 1 absent
Joy Booth absent · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Deborah Bradford yea · George Fuller yea
25-3494 — Approved and Referred
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Deborah Bradford yea · George Fuller yea
25-3513 — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Deborah Bradford yea · George Fuller yea
Tue Dec 16, 2025 · 5:00 PM

Reinvestment Zone Number One

TIRZ #1 board to discuss downtown fire sprinkler project funding

The Reinvestment Zone Number One board will review minutes from November and consider funding for the McKinney Downtown Fire Sprinkler Project and a small area plan along State Highway 5.

tirzfire-safetydowntownfundinghighway-5planning
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
7 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea
25-3458 — Approved
7 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea
25-3459 — Approved
7 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea
25-3457 — Approved and Referred
7 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea
Tue Dec 16, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC to discuss transportation infrastructure and economic development program

The McKinney Economic Development Corporation will review October 2025 financials and a presentation on transportation infrastructure. The board will also consider Chamber of Commerce awards and hold an executive session to discuss real property and specific economic development projects.

economic-developmenttransportationreal-estatefinance
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Amended
16 present
Kurt Kuehn present · Mark Denissen present · Brian Loughmiller present · Chantelle Kadala present · Robert Hamilton present · Julie Williams present · Scott Woodruff present · Thad Helsley present · Kurt Kuehn present · Mark Denissen present · Brian Loughmiller present · Chantelle Kadala present · Robert Hamilton present · Julie Williams present · Scott Woodruff present · Thad Helsley present
ADJOURN — Adjourn
8 present
Kurt Kuehn present · Mark Denissen present · Brian Loughmiller present · Chantelle Kadala present · Robert Hamilton present · Julie Williams present · Scott Woodruff present · Thad Helsley present
25-3491 — Approved
7 yea · 1 absent
Kurt Kuehn yea · Mark Denissen absent · Brian Loughmiller yea · Chantelle Kadala yea · Robert Hamilton yea · Julie Williams yea · Scott Woodruff yea · Thad Helsley yea
25-3488 — Approved and Referred
7 yea · 1 absent
Kurt Kuehn yea · Mark Denissen absent · Brian Loughmiller yea · Chantelle Kadala yea · Robert Hamilton yea · Julie Williams yea · Scott Woodruff yea · Thad Helsley yea
25-3493 — Approved
7 yea · 1 absent
Kurt Kuehn yea · Mark Denissen absent · Brian Loughmiller yea · Chantelle Kadala yea · Robert Hamilton yea · Julie Williams yea · Scott Woodruff yea · Thad Helsley yea
Tue Dec 16, 2025 · 3:00 PM

City Council Work Session

Council discusses Parkland Dedication Ordinance and capital improvement funding

The McKinney City Council holds a work session to discuss several items, including the Parkland Dedication Ordinance, capital improvement projects eligible for funding under the Transportation Infrastructure Initiative and Economic Development Program using sales tax revenues, and the Capital Improvements Advisory Committee related to impact fees. Presentations include the FY 2024-2025 Strategic Goals End of Year Report and the New Neighborhood Cup Initiative. The meeting also includes an executive session on real property and economic development matters.

city-councilwork-sessionparkland-dedicationcapital-improvementseconomic-developmentimpact-feesbudgetpublic-safety
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Dec 16, 2025 · 6:00 PM

City Council Regular Meeting

Council to approve budget and contracts for McKinney Airport Eastside Development

The City Council will consider an ordinance amending the FY 2025‑2026 budget and the 2026‑2030 Capital Improvements Program to fund the McKinney National Airport Eastside Development and Infrastructure Project (AI2250). The Council will also vote on resolutions authorizing contracts with Terracon Consultants, Garver LLC, and Mario Sinacola & Sons Excavating for testing, design, and construction services related to the same airport project. Additional items include an ordinance to modify Chapter 70 penalties and resolutions for a roadway impact fee study and a downtown fire sprinkler project.

budgetairportinfrastructurecontractsdevelopmentengineering
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Dec 16, 2025 · 4:30 PM

McKinney Arts Commission

McKinney Arts Commission to vote on public art murals

The McKinney Arts Commission will review the minutes from its October meeting and consider authorizing public art murals for Hugs Café and McKinney Green Gardens. The body will also discuss updates for the Roy and Helen Hall Library and the Art in the Hall project.

artscommissionpublic-artmuralcultural-districtlibrarymeeting
McKinney Performing Arts Center 111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-3480 — Approved and Referred
8 present
Amber Douzart present · Tamara Mader present · John Magnuson present · Matt Anderson present · Kimberlie Page present · Jackie Brewer present · Nicole Harris present · Nick Kagal present
25-3481 — Approved
8 present
Amber Douzart present · Tamara Mader present · John Magnuson present · Matt Anderson present · Kimberlie Page present · Jackie Brewer present · Nicole Harris present · Nick Kagal present
25-3482 — Approved
8 present
Amber Douzart present · Tamara Mader present · John Magnuson present · Matt Anderson present · Kimberlie Page present · Jackie Brewer present · Nicole Harris present · Nick Kagal present
ADJOURN — Adjourn
8 present
Amber Douzart present · Tamara Mader present · John Magnuson present · Matt Anderson present · Kimberlie Page present · Jackie Brewer present · Nicole Harris present · Nick Kagal present
Thu Dec 11, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board to select Main Street Partner of the Year

The McKinney Main Street Board will meet to discuss financial reports and upcoming events. The board is scheduled to take action on selecting the Main Street Partner of the Year.

main-streetcommunity-eventsawardsfinancial-reports
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
11 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Onel Perez present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
25-3447 — Approved
11 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Onel Perez present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
25-3445 — Approved and Referred
11 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Onel Perez present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
Thu Dec 11, 2025 · 5:30 PM

Parks, Recreation, and Open Space Advisory Board

Board to discuss engineering contract for Towne Lake Park

The Parks, Recreation, and Open Space Advisory Board will meet to discuss a recommendation for a professional services contract with LJA Engineering for Towne Lake Park. The meeting includes consent items and public comments.

parksengineeringtowne-lake-parkcontractadvisory-board
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3438 — Approved and Referred
6 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Osiola Henderson present · James Jenkins present · David Clarke present
25-3440 — Approved
6 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Osiola Henderson present · James Jenkins present · David Clarke present
ADJOURN — Adjourn
6 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Osiola Henderson present · James Jenkins present · David Clarke present
Tue Dec 9, 2025 · 6:00 PM

Planning & Zoning Commission

Planning & Zoning Commission to hear design exceptions for two sites

The McKinney Planning & Zoning Commission will hold a public hearing to consider design exceptions for a site plan at 2765 Virginia Parkway and a site plan at the East End Lumber Yard. The meeting is a recreation of the originally posted agenda with no changes.

planningzoningpublic-hearingdesign-exceptionvirginia-parkwaymckinney
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Dec 4, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to review historic marker and demolition requests

The Historic Preservation Advisory Board will consider requests for a historic marker at 618 W Louisiana and demolition permits for structures at 408 Oak Street and 1505 W. Louisiana. The board will also discuss the 2026 Historic Home Recognition Calendar.

historic-preservationdemolitiontax-exemptionzoninghistoric-markerboard-meeting
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Wed Dec 3, 2025 · 6:00 PM

Board of Adjustment

Board of Adjustment work session on legal operations

This is a work session only; no official action will be taken. The board will discuss a legal overview and analysis regarding the operation of the Board of Adjustment and related legal issues.

board-of-adjustmentwork-sessionlegalmckinney
McKinney City Hall 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3338 — Approved Closing Public Hearing
6 present
Jon N Prevost present · Tonya Dangerfield present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
ADJOURN — Adjourn
6 present
Jon N Prevost present · Tonya Dangerfield present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
Wed Dec 3, 2025 · 7:00 PM

Board of Adjustment

Board to hear fence height and setback appeals

The McKinney Board of Adjustment will hold a public hearing to consider two appeals regarding fence height and property setbacks. The body will also approve the minutes from a previous meeting.

zoningappealsbuildingfencessetbacks
McKinney City Hall 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3433 — Approved
5 present
Tonya Dangerfield present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
25-3434 — Approved
5 present
Tonya Dangerfield present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
25-3432 — Approved and Referred
5 present
Tonya Dangerfield present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
Wed Dec 3, 2025 · 6:30 PM

Community Grants Advisory Commission

Public hearing and deliberations on FY 2026 Opioid Settlement Fund grants

The Community Grants Advisory Commission will hold a public hearing and then deliberate on grant applications for the FY 2026 Opioid Settlement Fund. No other substantive business is listed on the agenda. The meeting also includes standard procedural items such as public comments and board manager comments.

grantsopioid-settlement-fundpublic-hearingmckinney
McKinney City Hall - Virginia Conference Room 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Dec 2, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider eminent domain for Laud Howell Parkway project

The McKinney City Council will hold public hearings on several rezoning and annexation requests, including a large annexation at US 75 and Spur 195 for multi-family and industrial uses. The council will also consider a resolution authorizing eminent domain to acquire property for the Laud Howell Parkway project. Consent agenda items include a contract for drone and pyrotechnic display services and adoption of guiding principles for a Destination Sports Park.

council-meetingeminent-domainzoningpublic-hearingannexationtransportationparksdrones
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0013A/25-0132Z — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0014SUP2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0083Z2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0103Z2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0108Z2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0133Z2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3149 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3269 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3274 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3343 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3429 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3426 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3423 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3425 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3427 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3428 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3424 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3346 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Tue Dec 2, 2025 · 3:00 PM

City Council Work Session

McKinney City Council to discuss sports park principles and impact fees

The City Council will hold a work session to discuss several planning and operational items. The body is considering guiding principles for the Destination Sports Park and reviewing impact fees related to Senate Bill 1883.

sports-parkimpact-feeszoninganimal-controleventscity-planning
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adopted
7 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Nov 25, 2025 · 8:00 AM

Visit McKinney

Visit McKinney to discuss FY26 advertising plan and tourism partner award

The Visit McKinney board will consider and discuss the FY26 advertising plan, a tourism partner award recipient for the Chamber Awards, and a presentation from the McKinney Chupacabras. The agenda also includes consent approval of prior meeting minutes and multiple staff and liaison reports. No city council or commission action will be taken at this meeting.

tourismmarketingadvertisingawardsboard-meetingmckinney
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-3400 — Approved
4 yea · 2 nay · 2 absent
Brian Medina yea · Juanita Pena yea · Keith Gall yea · Jill Thompson Barnes nay · Katie Scott yea · Patrick McGuire absent · Carol Sullivan nay · Taryn Bolton absent
The other 2 items passed by unanimous or near-unanimous consent.
Thu Nov 20, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider loan extension for Hamm's Meat Market and grant guideline changes

The McKinney Community Development Corporation will consider extending a loan agreement for Hester Eats, LLC (dba Hamm's Meat Market) for a fire suppression system and site improvements at 307 W. Louisiana Street to December 1, 2025. The board will also discuss amending the Retail Development Infrastructure Grant Guidelines for FY26. Consent items include approval of minutes from prior meetings, and the board will receive reports from liaisons and the president.

community-developmenteconomic-developmentgrantsloansfire-suppressionretail-developmentmckinney
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Markus Lloyd yea · George Fuller yea
ADJOURN — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Markus Lloyd yea · George Fuller yea
25-3414 — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Markus Lloyd yea · George Fuller yea
25-3413 — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · AJ Micheletto yea · Markus Lloyd yea · George Fuller yea
Thu Nov 20, 2025 · 5:00 PM

Library Advisory Board

Library board to discuss renovation update, holds locker, and December meeting

The Library Advisory Board will hold a mostly discussion-oriented meeting covering an update on the library renovation, a proposed holds locker at City Hall, and whether to cancel the December meeting. Members also will onboard a new board member and hear the director's report, which includes a furniture presentation. No votes on major policy or spending items are expected.

librarycity-hallrenovationboard-meetingmckinneyadministrationholds-lockerstaff-development
McKinney City Hall City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3403 — Approved and Referred
8 yea
Beth Beck yea · Catherine Kelly yea · Michelle Buggs yea · Connie Gibson yea · Stacy Ridenour yea · Courtney Hugghins yea · Lisa Harris yea · Larry Pereira yea
25-3408 — Approved
8 yea
Beth Beck yea · Catherine Kelly yea · Michelle Buggs yea · Connie Gibson yea · Stacy Ridenour yea · Courtney Hugghins yea · Lisa Harris yea · Larry Pereira yea
ADJOURN — Adjourn
8 yea
Beth Beck yea · Catherine Kelly yea · Michelle Buggs yea · Connie Gibson yea · Stacy Ridenour yea · Courtney Hugghins yea · Lisa Harris yea · Larry Pereira yea
Tue Nov 18, 2025 · 5:00 PM

Reinvestment Zone Number One

Board to vote on budget amendment for UB33 McKinney LLC project at 308 W Virginia St

The Reinvestment Zone Number One board will consider approving minutes from October and then vote on an ordinance to amend the FY2025-2026 budget to fund a Chapter 380 economic development agreement with UB33 McKinney LLC for a vacant or underutilized project at 308 W Virginia Street. The board may also enter executive session for attorney consultation.

tax-increment-financingeconomic-developmentbudgetmckinneychapter-380reinvestment-zone
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3377 — Approved
8 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
8 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
25-3376 — Approved and Referred
8 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Nov 18, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider annexation and zoning for light industrial use

The City Council will hold public hearings on annexation, zoning for light industrial use, and a specific use permit for a 7-Eleven. The body will also discuss budget amendments for downtown demolition and technology purchases.

zoningannexationbudgeteconomic-developmentpublic-safetyinfrastructure
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
7 present
Justin Beller present · Patrick Cloutier present · Gere Feltus present · Rick Franklin present · Michael Jones present · Bill Cox present · Ernest Lynch present
25-0009A/25-0102Z — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0009SUP3 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0105Z2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3241 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3257 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3306 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3313 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3322 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3381 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3388 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3389 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3390 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3386 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3383 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3385 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3387 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3392 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3382 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Tue Nov 18, 2025 · 3:00 PM

City Council Work Session

Council discusses implementing 2040 plan along Highway 5

This is a work session where the McKinney City Council will discuss several items in preparation for the regular meeting later that evening. Topics include an update on homelessness, downtown parking strategies, implementation of the ONE McKinney 2040 Comprehensive Plan along State Highway 5, and an update on parks capital projects. The council will also hold an executive session to consult with attorneys, discuss real property, and consider economic development matters involving Venu Holding Corporation.

homelessnessdowntown-parkingcomprehensive-planparkseconomic-developmentreal-propertycity-council
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
7 present
Patrick Cloutier present · Rick Franklin present · Michael Jones present · Gere Feltus present · Justin Beller present · Bill Cox present · Ernest Lynch present
Mon Nov 17, 2025 · 6:30 PM

Community Grants Advisory Commission

Community Grants Advisory Commission to elect officers and receive grant updates

This meeting covers routine administrative business: board member onboarding on parliamentary procedure and conflict of interest, approval of minutes from July 10, 2025, election of officers, and updates on grants and programs. No specific funding amounts or project decisions are listed on the agenda.

community-grantsadvisory-commissionboard-onboardingelection-of-officersgrant-updatesmckinney
McKinney City Hall 401 E. Virginia Street McKinney, Texas 75069
Fri Nov 14, 2025 · 8:00 AM

McKinney Housing Finance Corporation

Board to consider authorizing special warranty deed from city to housing corp

The McKinney Housing Finance Corporation will consider a resolution authorizing the execution of a Special Warranty Deed from the City of McKinney to the Corporation. The board will also elect officers and hear an overview of the Corporation's roles, housing bonds, and partnerships. Prior meeting minutes are scheduled for approval.

housing-financeproperty-transferresolutionmunicipal-bondsmckinney
McKinney City Hall - Virginia Conference Room 401 E. Virginia Street McKinney, Texas 75069
Notable items
Thu Nov 13, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Board to recommend firms for park design projects

The Parks, Recreation, and Open Space Advisory Board will discuss a recommendation for City Council approval of firms to provide landscape architectural services for various parks projects. The meeting also includes the approval of minutes from the October 9, 2025, meeting and a director's report.

parksrecreationcity-councildesignadvisory-board
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3346 — Approved and Referred
5 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Leslie Warren present · Lauren Halsey present
25-3348 — Approved
5 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Leslie Warren present · Lauren Halsey present
ADJOURN — Adjourn
5 present
Mohammed Elhindi present · Todd Burton present · Bruce Mead present · Leslie Warren present · Lauren Halsey present
Thu Nov 13, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board meets to discuss downtown priorities and parking

The McKinney Main Street Board will convene to review financial reports, discuss downtown development priorities, and consider a parking update. The meeting includes reports from liaison, director, and subcommittee updates.

downtownparkingdevelopmenteventsboard-meeting
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
CALL TO ORDER — Approved and Referred
10 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
25-3356 — Approved and Referred
10 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
REGULAR AGENDA ITEMS — Approved and Referred
10 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
ADJOURN — Adjourn
10 present
Mike Buchanan present · Lauren F. Smith present · Kim Black present · Whitney Nash present · Preston Schwalls present · Daniel Stampfel present · Kate McAnally present · Kenneth Holladay present · Heather Lowry present · Karina Velez present
Wed Nov 12, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to review Veterans Day ceremony and approve October meeting minutes

The McKinney Armed Services Memorial Board will review the 2025 Veterans Day ceremony and approve the minutes from its October 8, 2025 meeting. The meeting is a discussion-only session with no official action scheduled.

veteransmemorialcouncilpublic-commentsminutes
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3343 — Approved and Referred
7 present
Guy Green present · Paul Hoch present · Jerry Blow present · Colin Kimball present · Mark Hunt present · Shane Ousey present · Paul Reed present
ADJOURN — Adjourn
7 present
Guy Green present · Paul Hoch present · Jerry Blow present · Colin Kimball present · Mark Hunt present · Shane Ousey present · Paul Reed present
Tue Nov 11, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to hear a specific use permit for a major vehicle repair facility

The Planning & Zoning Commission will hold public hearings on several development proposals. Items include a specific use permit for Classic Collision at the northwest corner of Redbud Boulevard and Wilmeth Road, and multiple rezoning requests within Planned Development Districts. Each item will be discussed and acted upon according to the agenda. No city council action will be taken at this meeting.

zoningdevelopmentplanningpublic-hearingrezoningspecific-use
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Mon Nov 10, 2025 · 4:00 PM

Building and Standards Commission

Commission to hear restoration option for 708 Finch Ave, civil penalties for 1508 Pecan Point Dr

The Building and Standards Commission will hold public hearings on two properties: one to consider restoring a structure at 708 Finch Avenue, and another to consider assessing civil penalties against the property at 1508 Pecan Point Drive. The meeting also includes an election of officers and public comment periods. No City Council action will be taken, though a quorum may be present.

building-standardspublic-hearingproperty-restorationcivil-penaltieselection-of-officers
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Thu Nov 6, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to review historic tax exemptions and a demolition request

The Historic Preservation Advisory Board will consider three requests for Level II tax exemptions under the Historic Neighborhood Improvement Zone Program. The board will also act on a request for a Certificate of Appropriateness to demolish a residence.

historic-preservationtax-exemptionsdemolitionzoning
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
HP2025-0074 — Approved Denial
6 yea · 1 nay
James West yea · Kari Kennedy yea · Betty Petkovsek yea · Lisa Hammett yea · Maegan Escamilla yea · Marsha Prior-Robertson yea · Kimberly Wolfe nay
The other 6 items passed by unanimous or near-unanimous consent.
Wed Nov 5, 2025 · 7:00 PM

Board of Adjustment

Board hears appeal over artificial turf in front yard at 904 Finch Avenue

The Board of Adjustment will hear a legal overview on its operations, then hold a public hearing on an appeal of a building official's decision prohibiting artificial turf in the front yard of a single-family home at 904 Finch Avenue. The homeowner requests permission to keep the already-installed artificial turf. The board may decide to uphold or overturn the violation.

board-of-adjustmentzoningartificial-turfappealenforcementsingle-family-dwellingfinch-avenue
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Nov 4, 2025 · 4:00 PM

City Council Work Session

Council to get update on ONE McKinney 2040 Comprehensive Plan

The City Council will receive an update on the ONE McKinney 2040 Comprehensive Plan and development process. They will also consider a proclamation for Arbor Day, hear liaison updates from boards and commissions, and may enter executive session to discuss legal, real property, and economic development matters involving Venu Holding Corporation. This work session precedes the regular council meeting at 6 p.m.

comprehensive-planeconomic-developmentarbor-dayexecutive-sessioncity-councilmckinney
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Nov 4, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider specific use permit for DentRX USA

The City Council will hold a public hearing regarding a specific use permit for auto, motorcycle, truck, or boat rental or sales for DentRX USA. The body will also consider several contracts for roadway illumination, traffic counts, and park expansion.

zoningroadsparkseconomic-developmentcontracts
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Mon Nov 3, 2025 · 4:00 PM

Building and Standards Commission

Commission to elect officers and hear legal brief on operations

The Building and Standards Commission will hold officer elections and receive a legal overview and analysis regarding the commission's operation and related legal issues. No rezonings, contracts, or fee changes are on this agenda. No other substantive public hearings or decisions are scheduled.

building-standardslegalelectioncity-of-mckinney
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Tue Oct 28, 2025 · 8:00 AM

Visit McKinney

Visit McKinney board to elect officers and appoint committees

The Visit McKinney board will elect a chair, vice chair, and treasurer, and appoint members to the Finance and Marketing Committees as well as a liaison to the Parks & Recreation Advisory Board. The board will also receive reports on finance, marketing, short-term rentals, and occupancy, along with an assistant director's report. A regular agenda item recognizes winners of the 2025 Texas Travel Awards: Bingham Estate (Unique Lodging) and Tupps Brewery (Best Brewery). The meeting is largely organizational and procedural.

tourismboardelectionscommitteesawardsmckinneytexas
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3322 — Approved and Referred
5 yea
Brian Medina yea · Keith Gall yea · Katie Scott yea · Carol Sullivan yea · Taryne Bolton yea
25-3319 — Approved
5 present
Brian Medina present · Keith Gall present · Katie Scott present · Carol Sullivan present · Taryne Bolton present
ADJOURN — Adjourn
5 present
Brian Medina present · Keith Gall present · Katie Scott present · Carol Sullivan present · Taryne Bolton present
Tue Oct 28, 2025 · 4:00 PM

Joint Meeting

Joint meeting to discuss major land acquisitions and development projects

The McKinney City Council and the McKinney Economic Development Corporation will hold a joint meeting. Items include deliberations on the acquisition of approximately 42.5 acres in the George Fitzhugh Survey and 183.6 acres in the R.H. Locke Survey. The meeting will also review four economic development projects: Durant, Mirage, Terrigen, and Semper Fi.

real-estateeconomic-developmentcity-counciljoint-meetingland-acquisition
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Oct 28, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to consider zoning to light industrial district near Old Mill Road and FM 546

The Planning & Zoning Commission will hold public hearings on five items: a design exception for a warehouse, two specific use permits (auto rental/sales and fuel sales), a request to zone property to Light Industrial (I1) near Old Mill Road and FM 546, and a rezoning to Planned Development for religious assembly. Consent items include approval of previous meeting minutes. No final decisions are made at this meeting; recommendations go to the City Council.

zoningpublic-hearingspecific-use-permitwarehouseindustrialreligious-assembly7-elevendesign-exception
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Oct 23, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider extending loan for Venezia Sapori restaurant project

The McKinney Community Development Corporation board will administer oaths for new and reappointed members and elect officers. It will approve minutes from the September 25, 2025 meeting and review the September financial report. The board will discuss extending the loan term for Project RI24-07, Venezia Sapori at 1820 Eldorado Parkway to December 31, 2025. An executive session will address economic development projects including TUPPS Brewery & Entertainment Destination and Project Hemispheres.

economic-developmentfinanceboard-operationsloansrestaurants
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · George Fuller yea · Deborah Bradford yea · AJ Micheletto yea
25-3313 — Approved and Referred
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · George Fuller yea · Deborah Bradford yea · AJ Micheletto yea
25-3314 — Tabled to Another Meeting
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · George Fuller yea · Deborah Bradford yea · AJ Micheletto yea
25-3318 — Approved
7 yea
Joy Booth yea · David Riche yea · Chris Wilkes yea · Angela Richardson-Woods yea · George Fuller yea · Deborah Bradford yea · AJ Micheletto yea
Tue Oct 21, 2025 · 8:00 AM

McKinney Economic Development Corporation

McKinney Economic Development Corporation to elect officers and review financials

The board will elect officers and act on financial reports from July and August 2025. The meeting includes an executive session to discuss real property and several economic development projects.

economic-developmentfinancereal-estategovernment-administration
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
25-3309 — Approved
7 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
ACTION ON EXECUTIVE SESSION — Approved
14 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present · Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
ADJOURN — Adjourn
7 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
25-3310 — Approved
7 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
25-3305 — Approved and Referred
7 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
25-3304 — Approved
21 present
Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present · Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present · Kurt Kuehn present · Mark Denissen present · Julie Williams present · Brian Loughmiller present · Robert Hamilton present · Thad Helsley present · Scott Woodruff present
Tue Oct 21, 2025 · 4:30 PM

Reinvestment Zone Number One

TIRZ board to approve economic development agreements for downtown projects

The Reinvestment Zone Number One Board will consider resolutions to approve Chapter 380 agreements for fire suppression and façade restoration at 110 E Davis Street, fire suppression at 221 Andrews Street, and environmental and maintenance work at 308 W Virginia Street.

tirzeconomic-developmentdowntownfire-suppressionenvironmental-remediationfaçade-restorationchapter-380
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
25-3286 — Approved
6 yea · 3 nay
Rick Franklin yea · Patrick Cloutier nay · Michael Jones yea · Darrell Hale yea · Steve Lebo nay · Gere Feltus nay · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
25-3285 — Approved
8 yea · 1 nay
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Darrell Hale yea · Steve Lebo yea · Gere Feltus yea · Justin Beller nay · Bill Cox yea · Ernest Lynch yea
25-3284 — Approved
9 yea · 7 nay · 2 abstain
Rick Franklin yea · Patrick Cloutier nay · Michael Jones abstain · Darrell Hale nay · Steve Lebo nay · Gere Feltus yea · Justin Beller nay · Bill Cox yea · Ernest Lynch yea · Rick Franklin nay · Patrick Cloutier yea · Michael Jones abstain · Darrell Hale yea · Steve Lebo yea · Gere Feltus nay · Justin Beller yea · Bill Cox yea · Ernest Lynch nay
The other 3 items passed by unanimous or near-unanimous consent.
Tue Oct 21, 2025 · 3:00 PM

City Council Work Session

Work session to discuss downtown parking and Stronger Together Initiative

The City Council will hold a work session to discuss items for the regular meeting, including downtown parking, the new Street Outreach Ambassador Resource (SOAR) program, and the proposed Stronger Together Initiative. An executive session is scheduled to discuss legal, real property, and economic development matters, including Project Hemispheres and Venu Holding Corporation.

downtown-parkinghomeless-outreachcommunity-initiativeeconomic-developmentexecutive-sessioncity-councilwork-session
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Oct 21, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider camping ban, downtown public space rules, and multifamily rezoning

The McKinney City Council will vote on ordinances banning camping in parks and regulating physical occupancy of downtown public spaces. It will also hold public hearings on three rezoning requests, including one for multifamily residential near McKinney Ranch Parkway. The consent agenda includes a budget amendment for the Sunset Amphitheatre project, a contract for the Gabe Nesbitt Park softball expansion, and a resolution opposing ONCOR Electric Delivery Company's proposed rate increase.

campingdowntown-public-spaceszoningmultifamily-housingbudgetparkspublic-safetyoncor
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Oct 16, 2025 · 5:00 PM

Library Advisory Board

Library Advisory Board to discuss downtown traffic flow

The Library Advisory Board will meet to elect officers and review the September 18, 2025, meeting minutes. The board will also discuss a presentation regarding downtown traffic flow and review the FY25 Annual Report.

librarytrafficgovernment-administration
McKinney City Hall City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3269 — Approved and Referred
6 present
Beth Beck present · Michelle Buggs present · Connie Gibson present · Courtney Hugghins present · Lisa Harris present · Larry Pereira present
25-3268 — Approved
6 present
Beth Beck present · Michelle Buggs present · Connie Gibson present · Courtney Hugghins present · Lisa Harris present · Larry Pereira present
ADJOURN — Adjourn
6 present
Beth Beck present · Michelle Buggs present · Connie Gibson present · Courtney Hugghins present · Lisa Harris present · Larry Pereira present
Thu Oct 16, 2025 · 4:30 PM

McKinney Arts Commission

Election of officers and subcommittee actions on Arts Commission agenda

The McKinney Arts Commission will meet to elect officers for the coming term, receive a director's update, approve minutes from August, and discuss or act on two subcommittee items: Art in the Hall and the Roy and Helen Hall Library Juried Art Subcommittee. Public comments will be accepted on agenda items. No City Council action will be taken at this meeting.

artscommissionelectionofficerssubcommitteeslibrarypublic-artmckinney
McKinney Performing Arts Center 111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
25-3274 — Approved and Referred
3 present
Amber Douzart present · Tamara Mader present · John Magnuson present
25-3272 — Approved
6 present
Amber Douzart present · Tamara Mader present · John Magnuson present · Amber Douzart present · Tamara Mader present · John Magnuson present
25-3275 — Approved
3 present
Amber Douzart present · Tamara Mader present · John Magnuson present
25-3276 — Approved
3 present
Amber Douzart present · Tamara Mader present · John Magnuson present
ADJOURN — Adjourn
3 present
Amber Douzart present · Tamara Mader present · John Magnuson present
Wed Oct 15, 2025 · 6:00 PM

Board of Adjustment

Board hears appeal to reduce rear setback from 20 to 14 ft at 10316 Flat Creek Trail

The Board of Adjustment will conduct public hearings on three appeals of building official decisions regarding zoning violations. They will consider reducing a required rear setback, exceeding maximum fence height, and reducing accessory building setbacks. Consent items include approval of the September 24, 2025 meeting minutes.

board-of-adjustmentzoningsetback-variancefence-heightaccessory-buildingsmckinney-texasappeals
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
25-3261 — Approved
6 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
25-3262 — Approved
6 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
25-3263 — Approved
6 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
CONSENT ITEMS — Approved
3 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present
ADJOURN — Adjourn
6 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
25-3264 — Approved and Referred
6 present
Jon N Prevost present · Deanna Kuykendall present · Randall Wilder present · Larry Jagours present · Samuel Franklin present · Elmer Corbin present
Tue Oct 14, 2025 · 6:00 PM

Planning & Zoning Commission

Rezoning request from AG to R6 near North Virginia Parkway and Joplin Drive.

The Planning & Zoning Commission will elect a chair and vice-chair, then hold public hearings on three specific use permits and one rezoning request. One 7-Eleven fuel sales permit at Bloomdale Road and US 75 is requested to be tabled. The consent agenda includes approval of prior meeting minutes.

planning-and-zoning-commissionzoningpublic-hearingrezoningspecific-use-permitfuel-salesauto-rentalresidential-development
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Oct 9, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Advisory Board to vote on Gabe Nesbitt Softball Project contract

The Parks, Recreation, and Open Space Advisory Board will consider and potentially vote on a recommendation to the City Council to authorize a construction contract for the Gabe Nesbitt Softball Project. The board will also elect officers for the coming term, receive a Director's Report and an update on Parks and Trails Directories, and approve the minutes from its September 11, 2025 meeting.

parksrecreationsoftballconstructionelectionsadvisory-board
McKinney City Hall 401 E. Virginia Street Virginia Conference Room McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-3249 — Approved
12 yea
Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea · David Clarke yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea · David Clarke yea · Osiola Henderson yea
25-3250 — Approved
6 yea
Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea · David Clarke yea · Osiola Henderson yea
25-3246 — Approved and Referred
6 yea
Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea · David Clarke yea · Osiola Henderson yea
ADJOURN — Adjourn
6 yea
Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea · David Clarke yea · Osiola Henderson yea
Thu Oct 9, 2025 · 8:30 AM

McKinney Main Street Board

Board will consider adding new member as signatory on Main Street bank account

The McKinney Main Street Board will elect officers and discuss adding a newly elected board member as a signatory on the Main Street bank account. The board will also review the September 11, 2025 meeting minutes, financial reports, and a recap of Oktoberfest 2025. Additional discussion will cover upcoming events and routine reports from the city liaison, the “M” Group, the director, and subcommittees.

governancefinanceeventsreportsboard
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-3257 — Approved and Referred
4 present
Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present
25-3251 — Approved
12 present
Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present · Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present · Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present
25-3252 — Approved
4 present
Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present
ADJOURN — Adjourn
4 present
Mike Buchanan present · Heather Lowry present · Lauren F. Smith present · Kim Black present
Thu Oct 9, 2025 · 6:00 PM

Administration

Council and boards to receive open government training

This is an administrative meeting consisting of mandatory open government training for elected and appointed officials, covering the Open Meetings Act and Public Information Act. No formal city council, board, or commission action will be taken at this session.

trainingopen-governmentopen-meetings-actpublic-information-actadministration
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Wed Oct 8, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to elect officers and discuss 2025 Veterans Day ceremony

The McKinney Armed Services Memorial Board will hold a routine meeting with consent items, including approval of minutes from September 10. Discussion items include planning for the 2025 Veterans Day ceremony (no action taken). The board will also elect officers. No other substantive decisions are scheduled.

memorialveteransboardelectionsceremonyminutes
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3241 — Approved and Referred
7 yea
Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea
25-3244 — Approved
28 yea
Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea · Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea · Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea · Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea
ADJOURN — Approved Withdrawal of Motion
7 yea
Guy Green yea · Paul Hoch yea · Shane Ousey yea · Colin Kimball yea · Paul Reed yea · Mark Hunt yea · Jerry Blow yea
Mon Oct 6, 2025 · 4:00 PM

McKinney Urban Transit District Board

MUTD board to discuss transit policy and DART agreement renewal

The McKinney Urban Transit District Board will discuss an amendment to its cost-sharing policy and approve a renewal of its interlocal agreement with DART Mobility Services. The meeting includes a presentation on regional transit study highlights and a public comment period.

transitdartpolicyagreementpublic-hearingmckinney
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Mon Oct 6, 2025 · 3:00 PM

City Council Work Session

Council to consider electioneering ordinance changes, TNR program

The McKinney City Council will discuss potential changes to the electioneering ordinance, a trap-neuter-release program for feral cats, an update on the Safe Streets McKinney project, and a facility use policy for City Hall conference rooms. A proclamation for Community Planning Month will be presented. The council will also enter executive session for legal consultations and discussions on real property and economic development with Venu Holding Corporation.

city-councilwork-sessionelectioneering-ordinancetrap-neuter-releasesafe-streetsfacility-use-policyexecutive-session
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Approved Withdrawal of Motion
6 yea · 1 absent
Patrick Cloutier absent · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Mon Oct 6, 2025 · 6:00 PM

City Council Regular Meeting

City Council to approve budget and contracts for pump station and DART

The McKinney City Council will consider approving the Fiscal Year 2025-2026 budget and capital improvements, including funds for the Redbud Pump Station. The body will also vote on contracts for DART mobility services, a golf tournament agreement, and a new aircraft towing vehicle.

budgetparkstransportationcontractsinfrastructuredowntown
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3238 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3240 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3235 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3239 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3237 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Wed Oct 1, 2025 · 6:00 PM

Board of Adjustment

Board of Adjustment holds a test meeting with no official action.

The McKinney Board of Adjustment is holding a test meeting for procedural purposes only, with no official action scheduled. The agenda includes discussion items and executive sessions, but no public hearings or final votes are expected.

test-meetingboard-of-adjustmentvarianceexecutive-sessionprocedural
McKinney City Hall 222 N. Tennessee Street McKinney. Texas 75069
Notable items
Tue Sep 30, 2025 · 8:00 AM

Visit McKinney

Discussion of liaison and hotel updates for Fairfield Inn & Suites

The council will consider consent items, including approval of minutes from the Visit McKinney meeting on August 26, 2025, and several board and liaison reports. The only regular agenda item is a liaison update on the Fairfield Inn & Suites hotel and local attractions. No formal actions or votes are scheduled during this meeting.

city-councilpublic-hearingreportshoteltourism
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3207 — Approved and Referred
7 yea · 1 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
ADJOURN — Adjourn
7 yea · 1 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Thu Sep 25, 2025 · 8:00 AM

McKinney Community Development Corporation

Grant for NeighborHub project increased by $1.2 million to $1,717,192

The McKinney Community Development Corporation will hold a public hearing to consider amending Project 4B24-15, adding Catholic Charities of Dallas as a grant recipient and raising the grant award from $517,192.00 to $1,717,192.00 for infrastructure at 2000 W. White Avenue. The board will also review two retail development infrastructure grant applications: $50,000.00 for 380 Marketplace LLC at 2414 W. University Drive and $27,458.92 for The Cotton Mill at 610 Elm Street. Additional agenda items include the August 2025 financial report and various board liaison reports.

grantsinfrastructureeconomic-developmentcommunity-developmentretail
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
ACTION ON EXECUTIVE SESSION — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
ADJOURN — Adjourn
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3200 — Approved and Referred
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3204 — Approved Closing Public Hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3205 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3206 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3204 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
Wed Sep 24, 2025 · 6:00 PM

Board of Adjustment

Board to hear four appeals of building official decisions on turf, setback, and tree rules

This meeting of the Board of Adjustment will consider four public hearings on appeals of building official decisions. Items include appeals to keep artificial turf in front yards at 907 and 909 West Virginia Street, to keep a carport with a reduced side-yard setback at 1005 W Hunt St, and to omit required canopy trees at 4305 Brookridge Ave. The consent agenda includes approval of minutes from the previous meeting.

board-of-adjustmentpublic-hearingzoningartificial-turfsetbackcanopy-treesappealsmckinney-texas
McKinney City Hall 401 E Virginia Street McKinney. Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-3195 — Denied
3 yea · 2 nay
Eric Roberts yea · Larry Jagours nay · Tonya Dangerfield yea · Deanna Kuykendall nay · Randall Wilder yea
The other 6 items passed by unanimous or near-unanimous consent.
Tue Sep 23, 2025 · 3:00 PM

City Council Special Meeting

Council to consider annexation and rezoning for residential development near Trinity Falls

The City Council will hold a public hearing on a petition to annex and zone approximately 140 feet south of Saffira Way as a Planned Development District for single-family and multi-family residential uses. The council will also discuss appointments to the Main Street Board, the restaurant inspection program, and disbursements of opioid funds for public safety projects and nonprofit grants. An executive session will address real property matters including a license agreement for Gray Branch Park and municipal facilities.

annexationzoningplanned-developmentresidentialpublic-safetyopioid-fundsrestaurant-inspectionreal-property
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-0035Z/25-0001A — Close the public hearing
5 yea · 2 absent
Patrick Cloutier absent · Rick Franklin yea · Michael Jones absent · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
5 yea · 2 absent
Patrick Cloutier absent · Rick Franklin yea · Michael Jones absent · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
25-3190 — Approved
5 yea · 2 absent
Patrick Cloutier absent · Rick Franklin yea · Michael Jones absent · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
25-0035Z/25-0001A — Approved
5 yea · 2 absent
Patrick Cloutier absent · Rick Franklin yea · Michael Jones absent · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Sep 23, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to consider three rezoning requests for residential and hangar uses

The Planning & Zoning Commission will hold public hearings to consider three requests to modify Planned Development Districts. These requests involve changing development standards to allow for specific residential and aviation-related uses.

zoninghousingland-usepublic-hearings
McKinney City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Sep 18, 2025 · 5:00 PM

Library Advisory Board

Discussion of construction update for Roy and Helen Hall Library

The Library Advisory Board will approve the minutes from its August 21, 2025 meeting. It will discuss a construction update for the Roy and Helen Hall Library. The board will also hear the Director’s Report. Public comments are permitted on agenda items.

libraryconstructionreportspublic-commentsminutes
McKinney City Hall CH 123 Virginia Conference Room 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3187 — Approved and Referred
6 yea
Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
ADJOURN — Adjourn
6 yea
Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
Tue Sep 16, 2025 · 3:00 PM

City Council Work Session

Council to discuss Lower 5 Plaza, Municipal Court, and police recognition program.

This work session precedes the regular City Council meeting later in the evening. Council will hear presentations on the Police Department Recognition Program, an update on the Municipal Court, and an update on the Lower 5 Plaza project including online survey results. They will also discuss agenda items for the regular meeting and go into executive session for legal advice, real property discussions, and economic development matters related to Project Hemispheres and Venu Holding Corporation. No votes are taken at work sessions.

policemunicipal-courtlower-5-plazaeconomic-developmentreal-propertycity-councilwork-sessionexecutive-session
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Sep 16, 2025 · 6:00 PM

City Council Regular Meeting

Council considers zoning overhaul, downtown public space rules, and panhandling ban

The City Council will hold public hearings on comprehensive amendments to the Unified Development Code, covering zoning and subdivision regulations. It will also consider ordinances restricting physical occupancy in downtown public spaces, prohibiting camping in parks, and banning aggressive panhandling. The consent agenda includes ratifying police and fire union agreements, a contract for Medical Center Drive improvements, and an annexation agreement for 141 acres near US-75 and Spur 195.

zoningpublic-safetyhousingdowntownparkspolicefirepanhandling
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Sep 16, 2025 · 7:00 AM

McKinney Economic Development Corporation

McKinney EDC to discuss economic development projects in executive session

The McKinney Economic Development Corporation will hold a regular meeting with no council action allowed. The body will review monthly reports and hear public comments before entering an executive session to discuss specific economic development projects.

economic-developmentexecutive-sessionprojectspublic-commentsreports
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
In accordance with the Texas Government Code: A. Section 551.071(2) Consultations with Attorney on any Work Session, Special or Regular Session agenda item requiring confidential, attorney/client…
33 yea · 7 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley absent · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
Fri Sep 12, 2025 · 8:00 AM

McKinney Housing Finance Corporation

Board to consider bond applications for Skyway Villas and Forest View Seniors

The McKinney Housing Finance Corporation will hear an update on the Community Land Trust, consider resolutions to apply for private activity bond allocations for two housing projects—Skyway Villas and Forest View Seniors—and discuss assisting low-income elderly households with rental assistance. No city council action will be taken at this meeting.

housingbondssenior-housingrental-assistancecommunity-land-trustlow-income
Council Chambers 401 E Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
5 yea
Gwendolyn Brannon yea · Paul Shirar yea · Kimberly Wolfe yea · Mohamed Kacem yea · Tyler Underwood yea
25-3153 — Approved
5 yea
Gwendolyn Brannon yea · Paul Shirar yea · Kimberly Wolfe yea · Mohamed Kacem yea · Tyler Underwood yea
25-3154 — Approved
5 yea
Gwendolyn Brannon yea · Paul Shirar yea · Kimberly Wolfe yea · Mohamed Kacem yea · Tyler Underwood yea
25-3155 — Approved
5 yea
Gwendolyn Brannon yea · Paul Shirar yea · Kimberly Wolfe yea · Mohamed Kacem yea · Tyler Underwood yea
Thu Sep 11, 2025 · 8:30 AM

McKinney Main Street Board

Main Street Board to discuss downtown construction update

The McKinney Main Street Board will hear reports and discuss financial reports, a downtown construction update, board membership changes, and upcoming events. The agenda includes approval of previous meeting minutes and subcommittee updates. No major votes or ordinances are scheduled.

main-streetdowntownconstructionboardmckinneyfinancial-reportevents
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
10 yea
Onel Perez yea · Preston Schwalls yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
25-3140 — Approved and Referred
10 yea
Onel Perez yea · Preston Schwalls yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Thu Sep 11, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Board to recommend names for two parks

The Parks, Recreation, and Open Space Advisory Board will discuss recommending names for a park on Wilson Creek Parkway and a park at Craig Ranch to the City Council. The meeting will also include approval of previous board minutes and a director's report.

parksnamingcouncilrecreationadvisory-board
City Hall Council Chambers 401 E. Virginia St. McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-3147 — Approved
5 yea
David Clarke yea · Monica Escamilla yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea
25-3148 — Approved
5 yea
David Clarke yea · Monica Escamilla yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea
25-3145 — Approved and Referred
5 yea
David Clarke yea · Monica Escamilla yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea
ADJOURN — Adjourn
5 yea
David Clarke yea · Monica Escamilla yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea
Wed Sep 10, 2025 · 6:00 PM

Board of Adjustment

Board to hear appeal of side-yard setback violation at 1006 S. Tennessee St.

The Board of Adjustment will conduct a public hearing on an appeal of a Building Official's decision regarding a 5-foot side-yard setback violation at 1006 S. Tennessee St. The applicant requests reducing the setback to zero feet to build a detached garage and accessory dwelling unit adjacent to an alley. The board will also consider approving minutes from its August 13 meeting.

board-of-adjustmentzoningsetbackpublic-hearingappealaccessory-dwelling-unitmckinney
McKinney City Hall 401 E Virginia St McKinney. Texas 75069
Notable items
Wed Sep 10, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to discuss Veterans Day ceremony

The McKinney Armed Services Memorial Board will review the minutes from its August meeting and discuss plans for the 2025 Veterans Day ceremony. No official actions are scheduled.

veteransmemorialceremonyboard-meetingpublic-hearing
Council Chambers 401 E. Virginia St. McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3133 — Approved and Referred
6 yea
Shane Ousey yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
6 yea
Shane Ousey yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Tue Sep 9, 2025 · 6:00 PM

Planning & Zoning Commission

Planning & Zoning to consider broad UDC amendment

The commission will hold public hearings and vote on three items: a proposed amendment to the Unified Development Code covering zoning regulations, districts, uses, and definitions; a design exception for a site plan at Custer Road and Laud Howell Parkway; and a rezoning request that is expected to be tabled. Consent items include approval of previous meeting minutes.

zoningplanningunified-development-coderezoningdesign-exceptionpublic-hearing
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Sep 4, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to consider historic tax exemption and demolition permit

The Historic Preservation Advisory Board will hold a public hearing and decide on two regular agenda items: a request for a Level II Historic Neighborhood Improvement Zone tax exemption for a property at 502 W Hunt Street, and a certificate of appropriateness for demolition of a detached shed at 1505 W. Louisiana Street. The board will also consider approving the minutes from the August 7 meeting.

historic-preservationtax-exemptiondemolitioncertificate-of-appropriatenessmckinney
City Hall Council Chambers 401 E. Virginia St. McKinney, Texas 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
HP2025-0005 — Approved
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
HP2025-0063 — Approved
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
ADJOURN — Adjourn
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
25-3130 — Approved
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
25-3130 — Approved and Referred
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
Tue Sep 2, 2025 · 5:30 PM

Reinvestment Zone Number One

Board to vote on Chapter 380 agreement for 209 E Louisiana maintenance project

The Reinvestment Zone Number One Board will consider and possibly approve a resolution authorizing a Chapter 380 Economic Development Agreement and Project Plan Implementation Agreement with 209 Louisiana, LLC for the 209 E Louisiana Critical Maintenance Project located at 209 East Louisiana Street. The board will also approve minutes from its June 3, 2025 meeting.

tax-increment-reinvestment-zoneeconomic-developmentchapter-380maintenancemckinney
Council Chambers 401 E. Virginia Street McKinney, Texas
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3111 — Approved
9 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Darrell Hale yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
25-3110 — Approved and Referred
7 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Darrell Hale yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea
ADJOURN — Adjourn
9 yea
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Darrell Hale yea · Steve Lebo yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Sep 2, 2025 · 5:00 PM

McKinney Public Facility Corporation Regular Meeting

McKinney Public Facility Corporation to vote on officer elections and bylaws

The McKinney Public Facility Corporation will meet to elect officers and consider approving the first amended and restated bylaws. The body will also review meeting minutes from December 19, 2023.

governancebylawselectionspublic-facilities
City Hall Building Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-3107 — Adjourn
20 yea · 1 nay
Patrick Cloutier nay · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Gere Feltus yea · Ernest Lynch yea · Justin Beller yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Gere Feltus yea · Ernest Lynch yea · Justin Beller yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Gere Feltus yea · Ernest Lynch yea · Justin Beller yea
The other 3 items passed by unanimous or near-unanimous consent.
Tue Sep 2, 2025 · 6:00 PM

City Council Regular Meeting

Council to adopt FY 2025-26 budget, set tax rate, and vote on fee changes

The City Council will hold a public hearing and vote on adopting the FY 2025-26 budget and tax rate, along with an ordinance ratifying the property tax revenue increase. Council will also consider changing rates and fees for city services. Several rezoning and specific use permit requests are scheduled for public hearings, including a McDonald's drive-through and multiple industrial and commercial rezonings. The consent agenda includes items such as requiring short-term rental platforms to collect hotel occupancy tax, adopting a ten-year water rate study, and approving construction contracts.

budgettaxzoningfeesshort-term-rentalspublic-hearingsinfrastructure
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-0006SUP2 — Approved
6 yea · 1 nay
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones nay · Bill Cox yea · Ernest Lynch yea
The other 31 items passed by unanimous or near-unanimous consent.
Tue Sep 2, 2025 · 3:00 PM

City Council Work Session

McKinney council discusses employee benefits and downtown property redevelopment

The McKinney City Council will discuss selecting a new employee health benefits provider and review downtown city-owned property redevelopment. The session also includes executive sessions on litigation and attorney consultations.

city-councilemployee-benefitsdowntown-developmentexecutive-sessionproclamationsmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
4 yea · 3 absent
Patrick Cloutier yea · Rick Franklin yea · Michael Jones absent · Gere Feltus absent · Justin Beller absent · Bill Cox yea · Ernest Lynch yea
Thu Aug 28, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider $2M park grant and grant increases

The McKinney Community Development Corporation will consider approving project grant applications totaling over $10 million, including a $2 million request for park enhancements at West Grove. The board will also hold public hearings to consider increasing a grant for the NeighborHub project.

parksgrantsneighborhooddowntowninfrastructurepublic-hearingbudget
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
25-3094 — Approved
6 yea · 1 nay
Angela Richardson-Woods yea · David Kelly nay · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-3095 — Approved
5 yea · 2 nay
Angela Richardson-Woods yea · David Kelly nay · Deborah Bradford yea · AJ Micheletto yea · Joy Booth nay · David Riche yea · Chris Wilkes yea
25-3098 — Approved
6 yea · 1 nay
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth nay · David Riche yea · Chris Wilkes yea
The other 7 items passed by unanimous or near-unanimous consent.
Tue Aug 26, 2025 · 8:00 AM

Visit McKinney

Council will consider the FY 2025‑26 Visit McKinney budget

The Visit McKinney board will consider, discuss, and act on the budget for fiscal year 2025‑26 as submitted to the city manager. The meeting also includes board and liaison reports from the City, MEDC, MCDC, Parks and Recreation, Finance, and Marketing committees. A presentation on Zartico geolocation data – CJ Cup Byron Nelson will be given. Public comments on non‑public‑hearing items will be heard.

budgetreportspublic-commentspresentationgeolocation
Council Chambers 401 E. Virginia St. McKinney, TX. 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3079 — Approved and Referred
6 yea · 2 absent
Efrem Windom absent · Patrick McGuire absent · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
25-3082 — Approved
7 yea · 1 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
ADJOURN — Adjourn
7 yea · 1 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Tue Aug 26, 2025 · 3:00 PM

City Council Special Meeting

Council to appoint members to boards, commissions, and TIRZ boards

The McKinney City Council will consider and act on appointments to various city boards and commissions for the 2025-26 term, including filling vacancies from expired terms, resignations, and removals. They will also vote on resolutions appointing members to the Tax Increment Reinvestment Zone Number One (TIRZ1) and Number Two (TIRZ2) boards. An executive session is scheduled to discuss real property matters related to Lower 5 Plaza and municipal facilities.

appointmentsboardscommissionstirzreal-estateexecutive-sessioncity-council
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
25-3086 — Approved
7 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Aug 26, 2025 · 6:00 PM

Planning & Zoning Commission

Rezoning for residential development near Saffira Way and Trinity Falls Parkway

The Planning and Zoning Commission will hold public hearings on three items: a design exception for Custer Frontier Marketplace (requested to be tabled), a specific use permit for a drive-through restaurant (Smalls Sliders) at 1700 North Custer Road, and a request to rezone property approximately 140 feet south of Saffira Way to a Planned Development District for single-family and multi-family residential uses. The commission will also consider approval of the August 12, 2025 meeting minutes.

zoningpublic-hearingspecific-use-permitplanned-developmentresidentialcommercialmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Aug 21, 2025 · 4:30 PM

McKinney Arts Commission

Arts Commission to discuss FY2026 grant funding and new Capacity Building Grant

The McKinney Arts Commission will consider/discuss/act on approving minutes, a City Hall art installation, recommended funding amounts for FY2026 Season Grant Organizations, and a new Capacity Building Grant. No public hearings are scheduled. A quorum of city council or other boards may be present but no separate action will be taken.

arts-commissiongrantsfundingpublic-artmckinneycity-hall-artcapacity-building
111 N. Tennessee Street McKinney. Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3044 — Approved and Referred
6 yea
Kimberlie Page yea · Jackie Brewer yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea · John Magnuson yea
25-3046 — Approved and Referred
6 yea
Kimberlie Page yea · Jackie Brewer yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea · John Magnuson yea
ADJOURN — Adjourn
6 yea
Kimberlie Page yea · Jackie Brewer yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea · John Magnuson yea
Thu Aug 21, 2025 · 5:00 PM

Library Advisory Board

Board will discuss revised circulation policy and other library matters

The Library Advisory Board will approve the minutes from the July 17, 2025 meeting. It will discuss a code‑compliance presentation, a revised circulation policy draft, an organizational plan for agenda postings, and the Director’s August 2025 report. No formal actions are scheduled for these items.

librarypolicycode-compliancecirculationgovernance
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3074 — Approved and Referred
5 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Beth Beck yea
ADJOURN — Adjourn
5 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Beth Beck yea
Tue Aug 19, 2025 · 4:30 PM

Joint Meeting

Joint meeting to receive update on state land‑use and zoning bills

The McKinney City Council and Planning & Zoning Commission will hold a joint meeting on August 19, 2025. The agenda includes a presentation updating members on Texas Senate Bills 840 and 15 and House Bill 24 that affect land use and zoning. No formal actions or decisions are scheduled for these items.

city-councilplanning-commissionlegislationland-usezoning
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
14 yea · 7 abstain · 7 absent
Patrick Cloutier abstain · Rick Franklin abstain · Michael Jones abstain · Ernest Lynch abstain · Gere Feltus abstain · Justin Beller abstain · Bill Cox abstain · James Craig yea · Russell Buettner yea · Deidre Woodard yea · Steve Lebo yea · Charles Wattley yea · Jesserend Conrad yea · Gina Hammack yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Ernest Lynch yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · James Craig absent · Russell Buettner absent · Deidre Woodard absent · Steve Lebo absent · Charles Wattley absent · Jesserend Conrad absent · Gina Hammack absent
Tue Aug 19, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC to deliberate economic development projects in executive session

The McKinney Economic Development Corporation meeting includes consent items, reports, a Main Street downtown update, and approval of June financials. The board will then enter executive session to discuss real property (42.5348 acres) and economic development incentive projects (codenamed Durant, Mirage, Terrigen, Semper Fi). No city council action will be taken.

economic-developmentreal-estatemain-streetfinancialsexecutive-sessionmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
In accordance with the Texas Government Code: A. Section 551.071(2) Consultations with Attorney on any Work Session, Special or Regular Session agenda item requiring confidential, attorney/client…
7 yea · 1 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-3048 — Approved and Referred
7 yea · 1 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-3052 — Approved
7 yea · 1 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
Tue Aug 19, 2025 · 3:00 PM

City Council Work Session

Council discusses draft ordinances on camping, panhandling, and sitting/lying down

The City Council will discuss potential ordinance updates regarding camping, aggressive panhandling, and sitting or lying down in community spaces. The session also includes updates on airport development and board appointments.

ordinancespublic-safetyairport-developmentappointmentsreal-estate
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
7 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Aug 19, 2025 · 6:00 PM

City Council Regular Meeting

Council to hold budget hearing, adopt new fire and building codes

The McKinney City Council will hold a public hearing for citizen input on the proposed FY 2025-26 budget. The consent agenda includes adopting the 2024 International Fire Code and updated building codes, along with several other ordinances and resolutions. Three rezoning requests will be considered, including one for a multi-family senior living development. The council will also vote on a term sheet for providing utilities to 575 acres north of F.M. 1461.

budgetfire-codebuilding-codesrezoningsenior-housingperforming-artsutilities
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Aug 14, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Parks board to hear director's report, youth sports presentations

This meeting is largely procedural. The board will consider approval of July 10 meeting minutes and receive the director's report and presentations from outdoor youth sports associations. No significant votes, contracts, or policy changes are on the agenda.

parksrecreationadvisory-boardprocedural
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3028 — Approved and Referred
7 yea
David Clarke yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea
ADJOURN — Adjourn
7 yea
David Clarke yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren yea
Thu Aug 14, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board to discuss downtown security and construction

The McKinney Main Street Board will meet to review financial reports and receive updates on downtown security and construction. The board will also discuss upcoming events and approve minutes from the July 10, 2025 meeting.

downtownpublic-safetyconstructionfinance
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3034 — Approved and Referred
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
ADJOURN — Adjourn
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Wed Aug 13, 2025 · 6:00 PM

Board of Adjustment

Board of Adjustment to hear appeals on artificial turf, school drop-off lane, and digital billboard

The Board will hold public hearings on three appeals of city officials' decisions regarding property violations. Items include a homeowner's request to keep artificial turf in a front yard, a developer's request to use parking spaces instead of a stacking lane for a school tenant, and a request to install a digital billboard that violates multiple sign regulations.

board-of-adjustmentzoningappealssignagelandscapingtrafficmckinney
McKinney City Hall 401 E.Virginia St McKinney. Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-3024 — Denied
3 nay · 2 yea
Eric Roberts nay · Jon N Prevost nay · Tonya Dangerfield yea · Deanna Kuykendall yea · Randall Wilder nay
The other 3 items passed by unanimous or near-unanimous consent.
Wed Aug 13, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to discuss 2025 Veterans Day Ceremony and Rotary fundraiser

The McKinney Armed Services Memorial Board will meet to discuss planning for the 2025 Veterans Day Ceremony and a Rotary Veterans Fundraiser. No official actions will be taken during this meeting.

veteransmemorialeventsfundraising
CH 550 Wattley Conference Room McKinney City Hall 401 E. Virginia St. McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-3040 — Approved and Referred
5 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Guy Green yea · Paul Reed yea
ADJOURN — Adjourn
5 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Guy Green yea · Paul Reed yea
Tue Aug 12, 2025 · 6:00 PM

Planning & Zoning Commission

Planning commission to hear rezoning requests and specific use permits

The Planning & Zoning Commission will discuss and vote on multiple rezoning requests and specific use permits, including a drive-through restaurant and several industrial and commercial zone changes. The meeting will also include a public hearing to consider tabling a planned development request.

zoningplanningpublic-hearingdevelopmentcommercialindustrialspecific-use-permit
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Fri Aug 8, 2025 · 8:30 AM

City Council Work Session

McKinney City Council to discuss Fiscal Year 2025-26 Budget

The City Council is holding a work session to discuss the budget for Fiscal Year 2025-26. The meeting also includes a scheduled executive session for confidential matters.

budgetfiscal-year-2025-26city-council
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
4 yea
Michael Jones yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Thu Aug 7, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to consider demolishing carriage house at 612 W Virginia Street

The Historic Preservation Advisory Board will hear a request to demolish a carriage house at 612 W Virginia Street, and consider two Certificates of Appropriateness for residential rehabilitations at 401 N Bradley Street and 609 N Benge Street. The board will also receive an update on redevelopment of city-owned properties in historic downtown. Consent items include approval of previous meeting minutes.

historic-preservationdemolitioncertificate-of-appropriatenessdowntown-redevelopmentmckinney
City Hall Council Chambers 401 E. Virginia St. McKinney, Texas 75069
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
HP2025-0055 — Approved
4 yea · 1 nay · 1 abstain
Maegan Escamilla yea · Marsha Prior-Robertson nay · Betty Petkovsek yea · James West abstain · Kari Kennedy yea · Kimberly Wolfe yea
HP2025-0028.3 — Approved
4 yea · 2 nay
Maegan Escamilla nay · Marsha Prior-Robertson nay · Betty Petkovsek yea · James West yea · Kari Kennedy yea · Kimberly Wolfe yea
The other 3 items passed by unanimous or near-unanimous consent.
Wed Aug 6, 2025 · 6:00 PM

Administration

McKinney conducts candidate interviews for boards and commissions

The city is holding the sixth session of interviews for 2025 boards and commissions candidates. No official action will be taken at this event.

appointmentsboards-and-commissionsgovernment
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Tue Aug 5, 2025 · 6:00 PM

City Council Regular Meeting

McKinney City Council to discuss proposed FY 2025-26 tax rate

The City Council will consider the proposed tax rate for Fiscal Year 2025-26 and hold public hearings on the 2025-2029 Consolidated Plan and the 2025-2026 Annual Action Plan. The body will also review several rezoning requests and professional service contracts.

budgetzoningtax-ratepublic-hearingscontracts
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (25 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0017Z2 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2773 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2891 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2892 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2937 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2961 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3007 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3008 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3009 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3021 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3020 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3012 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3013 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3010 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3015 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3016 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3014 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-3019 — Approved
5 yea
Justin Beller yea · Patrick Cloutier yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Tue Aug 5, 2025 · 3:00 PM

City Council Work Session

Council discusses downtown redevelopment and noise ordinance enforcement

The City Council will hold a work session to discuss items for a subsequent regular meeting. Topics include the redevelopment of city-owned property in historic downtown and the enforcement of construction noise ordinances.

redevelopmentdowntownnoise-ordinancecity-propertypublic-safety
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
In Accordance with the Texas Government Code: A. Section 551.071(2) Consultations with Attorney on any Work Session, Special Session, or Regular Session agenda item requiring confidential…
4 yea · 1 absent
Patrick Cloutier yea · Michael Jones yea · Justin Beller yea · Bill Cox yea · Ernest Lynch absent
ADJOURN — Adjourn
5 yea
Patrick Cloutier yea · Michael Jones yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Tue Jul 29, 2025 · 6:00 PM

Administration

City to interview candidates for boards and commissions

The McKinney City Council will interview candidates for various boards and commissions during a public session. The meeting is a procedural gathering where no official action is expected.

boardscommissionsinterviewsquorumpublic-meeting
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Thu Jul 24, 2025 · 6:00 PM

Administration

McKinney conducts candidate interviews for boards and commissions

The city is holding the fourth session of interviews for 2025 Boards & Commissions candidates. No official action is scheduled to be taken during this event.

appointmentsboards-and-commissionscity-administration
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 7069
Thu Jul 24, 2025 · 8:00 AM

McKinney Community Development Corporation

MCDC to consider $25M grant and $10.25M loan for JW Marriott Craig Ranch Resort

The McKinney Community Development Corporation board will hold public hearings and vote on multiple project grant applications. Major items include a $25,000,000 grant and $10,250,000 loan for the JW Marriott Craig Ranch Resort, an $8,000,000 grant for parks and recreation improvements, and several smaller promotional and infrastructure grants. The board will also review a $2,000,000 park enhancement project at West University Drive and a $233,137 fire‑suppression upgrade at 6675 Mediterranean Drive.

economic-developmentparksinfrastructuretourismgrants
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2984 — Approved
5 yea · 2 nay
Angela Richardson-Woods yea · David Kelly nay · Deborah Bradford nay · Markus Lloyd yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
The other 19 items passed by unanimous or near-unanimous consent.
Tue Jul 22, 2025 · 4:00 PM

City Council Special Meeting

City Council to consider suspending Oncor's requested rate change

The City Council will discuss and act on a resolution to suspend the July 31, 2025 effective date of Oncor Electric Delivery Company’s requested rate change. The body will also hold a work session regarding district composition under the McKinney Home Rule Charter.

utilitieselectricity-ratescity-chartergovernance
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-3000 — Approved
7 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
A. Section 551.071(2) Consultations with Attorney on any Work Session, Special Session, or Regular Session agenda item requiring confidential attorney/client advice necessitated by the deliberation…
4 yea · 3 absent
Patrick Cloutier absent · Rick Franklin absent · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch absent
ADJOURN — Adjourn
4 yea · 3 abstain
Patrick Cloutier abstain · Rick Franklin abstain · Michael Jones yea · Gere Feltus yea · Justin Beller yea · Bill Cox yea · Ernest Lynch abstain
Tue Jul 22, 2025 · 6:00 PM

Planning & Zoning Commission

Planning & Zoning Commission to consider five rezoning requests

The Planning & Zoning Commission will hold public hearings to consider and act on five different rezoning requests. These requests involve changes to allow for commercial, multi-family, and senior living uses at various locations across the city.

zoninghousingcommercial-developmentsenior-living
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Mon Jul 21, 2025 · 6:00 PM

Administration

City Council conducts third round of board and commission candidate interviews

This is a procedural meeting for the third session of candidate interviews for various city boards and commissions. No specific agenda items or decisions are listed beyond the interview process. The meeting notice includes standard administrative details and ADA accommodations.

administrationboards-and-commissionscandidate-interviewsmckinneyprocedural
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Fri Jul 18, 2025 · 6:00 PM

Administration

City council to interview candidates for boards and commissions

This is the second session of candidate interviews for various City of McKinney boards and commissions. No votes or decisions will be taken; the event is purely for interviewing applicants.

boardscommissionsinterviewscandidatesmckinney
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Thu Jul 17, 2025 · 4:00 PM

McKinney Arts Commission

Arts Commission to review grant applicants and library art call

The McKinney Arts Commission will consider approving minutes from May, discuss a call for artists for the Roy and Helen Hall Memorial Library Art Installation, and hear presentations from 2025-2026 Season Art Grant applicants. The meeting includes public comment periods for both agenda items and general matters.

artscommissiongrantslibrarypublic-artmckinney
111 N. Tennessee Street McKinney. Texas 75069
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2955 — Approved and Referred
6 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Kathryn Waite yea
25-2956 — Approved
6 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Kathryn Waite yea
ADJOURN — Adjourn
6 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Kathryn Waite yea
Thu Jul 17, 2025 · 5:00 PM

Library Advisory Board

Library Board meets to discuss updates and director's report

The Library Advisory Board will discuss updates on the McKinney Public Library Foundation and the Director's Report. The meeting includes approval of minutes from a previous session and a period for public comments.

libraryboardpublic-libraryfoundationminutespublic-comments
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2958 — Approved and Referred
7 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
ADJOURN — Adjourn
7 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
Tue Jul 15, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC board will vote on the FY25‑26 budget for economic development projects

The McKinney Economic Development Corporation board will consider and act on the FY25‑26 MEDC budget. The meeting also includes routine reports, updates on projects such as Terrigen, Sparky, and Durant, and a discussion of 42.5348 acres in the George Fitzhugh Survey. No formal city council actions will be taken.

budgeteconomic-developmentprojectsland-usereports
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
5 yea · 3 absent
Brian Loughmiller yea · Scott Woodruff absent · Thad Helsley yea · Robert Hamilton absent · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn absent · Mark Denissen yea
ACTION ON EXECUTIVE SESSION — Approved
5 yea
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Julie Williams yea · Chantelle Kadala yea
ADJOURN — Adjourn
5 yea
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Julie Williams yea · Chantelle Kadala yea
25-2964 — Approved
5 yea
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Julie Williams yea · Chantelle Kadala yea
Tue Jul 15, 2025 · 6:00 PM

City Council Regular Meeting

City Council to consider annexations, generator purchase, and interlocal agreements

The City Council will hold a public hearing on two annexation and zoning requests for agricultural districts and consider resolutions for a generator replacement, interlocal agreements with Collin County, and a supplemental agreement for drainage study work.

city-councilannexationzoninginfrastructureemergency-servicesinterlocal-agreementdrainage
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (17 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0004A/25-0060Z — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0007A/25-0063Z — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2777 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2820 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2863 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2896 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2907 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2908 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2909 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2971 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2975 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2974 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2972 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2973 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2970 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Tue Jul 15, 2025 · 3:00 PM

City Council Work Session

Council to discuss housing plan, community land trust, and legislative updates

This work session will discuss several upcoming regular meeting items, including an update on the 2025-2029 Housing & Community Development Consolidated Plan and the 2025-2026 CDBG Annual Action Plan, an update on the Community Land Trust, and a presentation on the Lower 5 Plaza project. The council will also consider state legislative updates regarding governing bodies and public meeting agenda postings, and receive an update on the 2025 City Boards & Commissions Member Appointments Program. Additionally, the council will enter executive session to discuss litigation, real property acquisitions, and a facilities agreement.

housingcommunity-developmentplanningpublic-meetingslitigationreal-estateboards-commissions
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
4 yea · 3 absent
Patrick Cloutier yea · Rick Franklin absent · Michael Jones absent · Gere Feltus absent · Justin Beller yea · Bill Cox yea · Ernest Lynch yea
Mon Jul 14, 2025 · 6:00 PM

Administration

2025 Boards & Commissions Candidate Interviews – Session #1

The Administration meeting will conduct the first session of candidate interviews for city boards and commissions. No official actions are expected; the notice serves to establish a potential quorum under Texas Government Code Section 551.002. The meeting will be streamed live on the city website.

boards-commissionscandidate-interviewsgovernancequorumlive-stream
City Hall Council Chambers 401 E. Virginia Street McKinney, TX 75069
Thu Jul 10, 2025 · 6:30 PM

Community Grants Advisory Commission

Commission will discuss updates on the McKinney Opioid Settlement Fund grant process

The Community Grants Advisory Commission will review the current grant application process, including an update on the McKinney Opioid Settlement Fund. It will also receive updates on housing and community grant programs and the consolidated fiscal year 2025‑2026 grant plan. No formal actions are scheduled; the meeting is for discussion and public comment.

grantsopioid-settlementhousingbudgetpublic-hearing
Tennessee Conference Room - CH125 401 E. Virginia St., McKinney Texas 75069
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
25-2891 — Approved and Referred
6 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Eniola Campbell yea · Barbara Kelly yea
25-2892 — Approved and Referred
6 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Eniola Campbell yea · Barbara Kelly yea
25-2893 — Approved
6 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Eniola Campbell yea · Barbara Kelly yea
25-2895 — Approved
6 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Eniola Campbell yea · Barbara Kelly yea
ADJOURN — Approved
6 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Eniola Campbell yea · Barbara Kelly yea
Thu Jul 10, 2025 · 8:30 AM

McKinney Main Street Board

Board to discuss downtown security, financial reports

The McKinney Main Street Board will meet to discuss routine items including approval of previous meeting minutes, financial reports, a downtown security update, and upcoming events. No major decisions or new ordinances are on the agenda.

main-streetboarddowntownsecurityeventsreports
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
10 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
25-2951 — Approved and Referred
10 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Thu Jul 10, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Board to receive annual updates on Oak Hollow Golf Course and Courts

The Parks, Recreation, and Open Space Advisory Board will meet to receive annual reports on the Oak Hollow Golf Course and the Courts of McKinney Facility. No action will be taken on any item; the meeting is for information and discussion only. Consent items include approval of the June 12, 2025 minutes.

parksrecreationgolffacilitiesreportsmckinney
City Hall Council Chambers 401 E. Virginia St. McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2942 — Approved and Referred
6 yea
David Clarke yea · Monica Escamilla yea · LuAnne Malnory yea · Mohammed Elhindi yea · Todd Burton yea · Leslie Warren yea
ADJOURN — Adjourn
6 yea
David Clarke yea · Monica Escamilla yea · LuAnne Malnory yea · Mohammed Elhindi yea · Todd Burton yea · Leslie Warren yea
Wed Jul 9, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board considers adding two names to the Veterans Memorial Wall

The McKinney Armed Services Memorial Board will meet to discuss the 2025 Veterans Day Ceremony. The board will also consider and act on adding two specific names to the Veterans Memorial Wall.

veterans-memorialpublic-ceremonymemorial-wall
Council Chambers 401 E. Virginia St. McKinney, Texas
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-2937 — Approved and Referred
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
25-2940 — Approved
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
25-2941 — Approved
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Tue Jul 8, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to vote on rezoning for 2901 McKinney Ranch Parkway for multi-family housing

The Planning & Zoning Commission will conduct public hearings on three rezoning requests and one design exception. Three rezoning items have been requested to be tabled (2250 South Central Expressway, North Custer Road, and North Lake Forest Drive). The commission will also consider a design exception for a daycare at 1900 Aviation Way and a rezoning on Trinity Falls Parkway for commercial development.

planning-and-zoningrezoningpublic-hearingmulti-familycommercialdesign-exceptionmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Mon Jul 7, 2025 · 4:00 PM

Building and Standards Commission

Commission to consider adopting 2024 International Building and Fire Codes

The Building and Standards Commission will hold a public hearing to recommend the adoption of several 2024 International Codes and local amendments. The body will also discuss whether to restore or demolish a home at 1103 Oak St.

building-codesfire-codedemolitionordinances
Virginia Conference Room (CH123) 401 E. Virginia Street McKinney. Texas 75069
Notable items
Thu Jul 3, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board considers demolition request for house at 402 Barnes Street

The Historic Preservation Advisory Board will review requests for Certificates of Appropriateness regarding two residential properties. The board will also discuss the Certificate of Appropriateness process.

historic-preservationdemolitionresidential-rehabilitation
City Hall Council Chambers 401 E. Virginia St. McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
HP2025-0041 — Approved
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
HP2025-0028.2 — Tabled to Another Meeting
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
25-2933 — Approved and Referred
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
ADJOURN — Adjourn
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea · Kari Kennedy yea
Thu Jul 3, 2025 · 8:30 AM

McKinney Community Development Corporation

MCDC to discuss FY2026 strategic priorities

The McKinney Community Development Corporation will hold a special meeting to consider and discuss strategic priorities for Fiscal Year 2026. Following the open session, the board will convene in executive session to deliberate on three economic development projects: Project 17-04 (Craig Ranch Resort Hotel), Project 24-15 (Sanchez Charities NeighborHub), and Project 25-04 (Invited). No votes are scheduled; the agenda consists of discussion items only.

community-developmentstrategic-prioritieseconomic-developmentfiscal-year-2026craig-ranch-resort-hotelsanchez-charities-neighborhubinvited-projectmckinney
MCDC Office 7300 SH 121 SB, Suite 200 McKinney, TX 75070
Notable items
Tue Jul 1, 2025 · 6:00 PM

City Council Regular Meeting

Council to vote on annexation plan for 141 acres at US 75 and Spur 195

The McKinney City Council will consider a consent agenda including a budget amendment and contracts for the Roy and Helen Hall Memorial Library renovation, and a professional services contract for the public safety building. The regular agenda features a public hearing and vote on a rezoning at Alma Road and Wessex Court, and a resolution to authorize a term sheet governing annexation, zoning, and development of approximately 141 acres at the northeast corner of US 75 and Spur 195.

city-councilmckinneyannexationzoningbudgetlibrariespublic-safetydevelopment
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Jul 1, 2025 · 4:00 PM

City Council Work Session

Council will discuss a parks proclamation and code compliance overview

The McKinney City Council Work Session will present a proclamation for Parks & Recreation Month (item 25-2925). It will also provide an overview of code compliance operations (item 25-2926). Council liaison updates on city boards and commissions will be shared. No formal actions are scheduled for this meeting.

parksrecreationcode-compliancecouncilliaisonwork-session
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
6 yea · 1 absent
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · Justin Beller absent · Bill Cox yea · Ernest Lynch yea
Thu Jun 26, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider $35.25M loan/grant for JW Marriott hotel at Craig Ranch

The McKinney Community Development Corporation will hold a public hearing and vote on a $10.25 million loan and $25 million grant for partial funding of a $325 million JW Marriott Resort Hotel at Craig Ranch. The board also considers an extension to the loan agreement for Chestnut Elevated Storage Tank improvements. Several promotional and community event grants for 2025 events are up for discussion and action.

community-developmenteconomic-developmenthotelgrantspublic-hearingloanmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
ADJOURN — Approved
4 yea · 3 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford absent · AJ Micheletto yea · Joy Booth absent · David Riche yea · Chris Wilkes absent
25-2913 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2914 — Close the public hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
Tue Jun 24, 2025 · 6:00 PM

Planning & Zoning Commission

Two public hearings on zoning to Agriculture District in Honey Creek area

The Planning & Zoning Commission will hold public hearings on two requests to rezone properties to the AG (Agriculture) District, both located in the Honey Creek area. The commission will also consider approving the minutes from its June 10 meeting as a consent item. No other substantive decisions are scheduled.

planningzoningpublic-hearingagriculture-districthoney-creekmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Jun 24, 2025 · 8:00 AM

Visit McKinney

Visit McKinney board to review reports, Parks update

The Visit McKinney board is meeting to receive various reports, including an update from McKinney Parks and Recreation. According to the agenda notice, no city council, board, or commission action will be taken. The board will also consider approving minutes from the previous meeting as a consent item.

tourismreportsparks-and-recreationboard-meetingno-actionconsent-items
Council Chambers 401 E. Virginia Street McKinney, TX. 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
5 yea · 3 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena absent · Keith Gall absent
25-2902 — Approved and Referred
5 yea · 3 absent
Efrem Windom absent · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena absent · Keith Gall absent
Wed Jun 18, 2025 · 6:30 PM

Community Grants Advisory Commission

Commission to discuss FY2025-2026 consolidated grants process

The Community Grants Advisory Commission will discuss housing and community grant updates, the McKinney Opioid Settlement fund grant process, and the Fiscal Year 2025-2026 consolidated grants application process. However, no formal action will be taken at this meeting.

grantshousingopioid-settlementcommunity-grantsbudgetmckinney
Tennessee Conference Room - CH 125 401 E. Virginia Street
Tue Jun 17, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC to consider proposed workforce development plan and review May financials

The McKinney Economic Development Corporation will consider acting on the proposed G.R.O.W. workforce development plan and review the May 2025 financials. The board will also receive updates from Visit McKinney and board liaisons. An executive session is scheduled to discuss economic development projects including Project Terrigen, Project Durant, and Petoskey Plastics. The meeting includes consent items and routine reports.

economic-developmentworkforce-developmentfinancial-reportsexecutive-sessioneconomic-development-projectsmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
5 yea · 3 absent
Brian Loughmiller yea · Scott Woodruff absent · Thad Helsley yea · Robert Hamilton absent · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen absent
25-2896 — Approved and Referred
4 yea · 3 absent · 1 abstain
Brian Loughmiller abstain · Scott Woodruff absent · Thad Helsley yea · Robert Hamilton absent · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen absent
25-2899 — Approved
5 yea · 3 absent
Brian Loughmiller yea · Scott Woodruff absent · Thad Helsley yea · Robert Hamilton absent · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen absent
25-2900 — Approved
5 yea · 3 absent
Brian Loughmiller yea · Scott Woodruff absent · Thad Helsley yea · Robert Hamilton absent · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen absent
Tue Jun 17, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider grant agreements for Taxilane A Airport project

The McKinney City Council will vote on multiple resolutions, including authorizing the City Manager to apply for and accept a Safe Streets and Roads for All federal grant and to execute a grant agreement with the Texas Department of Transportation for the McKinney National Airport Taxilane A Rehabilitation and Construction Phase II. A separate resolution will approve an agreement with Garver, LLC for the same airport project. Council members will also hear a public petition to annex land north of County Road 124 and rezone it to Residential District R5, and consider ordinances to increase the homestead exemption for seniors and the disabled and to amend the 2024‑2025 budget for project AI2114.

grantsairportinfrastructurezoningbudgetpublic-hearing
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (21 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
ADJOURN — Adjourn
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0002A/25-0036Z2 — Tabled Indefinitely
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-0003M2 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2622 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2752 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2763 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2783 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2880 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2883 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2881 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2882 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2888 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2889 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2877 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2878 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2879 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2887 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2885 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
25-2886 — Approved
7 yea
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · Bill Cox yea · Ernest Lynch yea
Tue Jun 17, 2025 · 3:00 PM

City Council Special Meeting

City Council to certify June 7 runoff election results

The City Council will meet to certify the results of the June 7, 2025, runoff election for Mayor and City Council Member At-Large #1. The meeting also includes a work session and an executive session to discuss litigation and real property.

electionsreal-estatelitigationcity-council
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
4 yea · 3 absent
Patrick Cloutier yea · Rick Franklin yea · Michael Jones absent · George Fuller yea · Gere Feltus yea · Justin Beller absent · Charlie Philips absent
25-2874 — Approved
6 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · George Fuller yea · Gere Feltus yea · Justin Beller yea
Thu Jun 12, 2025 · 8:30 AM

McKinney Main Street Board

Downtown monument sign proposal up for discussion and possible action

The McKinney Main Street Board will consider and potentially act on a downtown monument sign proposal. They will also discuss financial reports, a marketing update, and upcoming events. The meeting includes reports from the city liaison, director, and subcommittees.

downtownmain-streetsignsmarketingfinancial-reportsevents
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2863 — Approved and Referred
9 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea
ADJOURN — Adjourn
9 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea
Thu Jun 12, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Parks, Recreation, and Open Space Advisory Board to review project updates

The board will meet to approve minutes from the May 8, 2025 meeting. Members will receive reports regarding the director's office, special events, and capital improvement projects.

parksrecreationcapital-improvementspublic-meetings
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2870 — Approved and Referred
6 yea
David Clarke yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Bruce Mead yea · Todd Royal yea
ADJOURN — Adjourn
6 yea
David Clarke yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Bruce Mead yea · Todd Royal yea
Wed Jun 11, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Armed Services Memorial Board to debrief 2025 Memorial Day Ceremony

The McKinney Armed Services Memorial Board will meet to review reports and discuss the 2025 Memorial Day Ceremony. The agenda states that no board action will be taken during this meeting.

memorialsveterans-affairsparks-and-recreation
Council Chambers 401 E. Virginia St. McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2856 — Approved and Referred
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Tue Jun 10, 2025 · 6:00 PM

Planning & Zoning Commission

McKinney P&Z to consider rezoning and site plan exceptions

The Planning & Zoning Commission will hold public hearings on several zoning requests and design exceptions for a multi-family development. Two agriculture district zoning requests have been requested to be tabled.

zoninghousingland-usepublic-hearings
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Thu Jun 5, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to consider tax exemption and rehabilitation request for historic properties

The Historic Preservation Advisory Board will review a tax exemption request for a property on W Heard Street and a rehabilitation certificate for a structure on N Bradley Street. The board will also receive information regarding neighborhood planning in McKinney.

historic-preservationtax-exemptionneighborhood-planningzoning
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
HP2025-0028 — Approved
3 nay · 3 yea
Maegan Escamilla nay · Jimmy Don Burris nay · Marsha Prior-Robertson nay · Betty Petkovsek yea · Tom Pence yea · Kari Kennedy yea
The other 6 items passed by unanimous or near-unanimous consent.
Tue Jun 3, 2025 · 4:00 PM

McKinney Urban Transit District Board

Board to consider extension of agreement with Dallas Area Rapid Transit

The McKinney Urban Transit District Board will review a staff report and service update. The board is also deciding whether to authorize the City Manager to seek an extension of the interlocal agreement with the Dallas Area Rapid Transit Local Government Corporation.

transitpublic-transportationinterlocal-agreementdart
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
9 yea · 4 absent
Brian Loughmiller absent · Michael Jones yea · Rick Franklin yea · Patrick Cloutier yea · Craig Andres yea · Bob Petitt yea · Jason Little absent · Michael Mashburn absent · Anthony Satarino absent · Brad Kearney yea · Charlie Philips yea · Gere Feltus yea · George Fuller yea
25-2840 — Approved
9 yea · 1 absent
Michael Jones yea · Rick Franklin yea · Patrick Cloutier yea · Craig Andres yea · Bob Petitt yea · Brad Kearney yea · Charlie Philips absent · Gere Feltus yea · George Fuller yea · Justin Beller yea
Tue Jun 3, 2025 · 6:00 PM

City Council Regular Meeting

City Council to vote on budget, zoning, and water tank projects

The McKinney City Council will consider budget amendments for infrastructure projects, including the Cannon Beach and Chestnut water tank projects, and will hold public hearings on several zoning and annexation requests.

budgetzoninginfrastructurepublic-hearingwatercouncilannexation
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
23-0093Z3 — Approved
5 yea · 1 absent · 1 nay
Justin Beller absent · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea · George Fuller yea · Charlie Philips nay
25-0023SP — Approved
5 yea · 2 nay
Justin Beller yea · Patrick Cloutier yea · Gere Feltus nay · Rick Franklin yea · Michael Jones yea · George Fuller yea · Charlie Philips nay
The other 17 items passed by unanimous or near-unanimous consent.
Tue Jun 3, 2025 · 3:00 PM

City Council Work Session

City Council discusses cellular towers and executive sessions

The McKinney City Council will hold a work session to discuss cellular towers and review the agenda for their upcoming regular meeting. The session includes executive sessions regarding a Tucker Hill facilities agreement and a Craig Ranch luxury hotel project.

cellular-towersexecutive-sessioncity-councilmckinneytexasfacilities-agreementeconomic-development
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
4 yea · 3 absent
Patrick Cloutier yea · Rick Franklin absent · Michael Jones absent · Gere Feltus absent · George Fuller yea · Charlie Philips yea · Justin Beller yea
ADJOURN — Adjourn
7 yea
Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Gere Feltus yea · George Fuller yea · Charlie Philips yea · Justin Beller yea
Tue Jun 3, 2025 · 5:00 PM

Reinvestment Zone Number One

Council will consider funding for Chestnut 0.5 MG storage tank rehab project

The Reinvestment Zone Number One board will review the minutes from its March 31, 2025 meeting. The council will then consider, discuss, and act on funding for the Chestnut 0.5 MG Elevated Storage Tank Rehabilitation Project under TIRZ 1. The meeting also includes standard consent items and an executive session with no board actions.

tirzfundinginfrastructurepublic-workscity-council
Council Chambers 401 E. Virginia Street McKinney, Texas
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2838 — Approved
7 yea · 1 nay
Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Darrell Hale nay · Steve Lebo yea · Gere Feltus yea · George Fuller yea · Charlie Philips yea
The other 2 items passed by unanimous or near-unanimous consent.
Wed May 28, 2025 · 6:00 PM

Board of Adjustment

Board to hear appeal of sign violation for 120 sq ft 'Public Storage' sign

The Board of Adjustment will hold a public hearing to consider an appeal of the Building Official's decision regarding a sign area violation at 7150 Craig Ranch Parkway. The applicant requests approval to install a 120-square-foot attached sign reading 'Public Storage' on the south elevation, exceeding the 25-square-foot limit for alternate building sides under UDC Article 5 Section 504B.2.a.iii.c. The Board will also vote on approving the minutes from the April 9, 2025 regular meeting.

board-of-adjustmentpublic-hearingsignzoningappealmckinney
McKinney City Hall Virginia Conference Room 401 E. Virginia Street McKinney. Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2832 — Approved
3 yea · 1 nay
Eric Roberts yea · James Jenkins yea · Deanna Kuykendall nay · Randall Wilder yea
The other 1 item passed by unanimous or near-unanimous consent.
Tue May 27, 2025 · 8:00 AM

Visit McKinney

Visit McKinney to discuss $5,000 tourism grant for DCI Summer Tour

The Visit McKinney board will meet to discuss a tourism grant application for the 2025 Drum Corps International Summer Tour, with funding not to exceed $5,000 based on hotel pick-up reports. They will also receive an update on board and commission member appointments, and hear reports from committees and liaisons. The agenda notes that a quorum of city council or boards may be present but no action will be taken by those bodies.

tourismgrantsdci-summer-tourboard-appointmentsfinance-reportsoccupancy-reportsmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2827 — Approved and Referred
7 yea · 1 absent
Efrem Windom yea · Patrick McGuire yea · Whitney Nash absent · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
25-2830 — Approved
7 yea · 1 absent
Efrem Windom yea · Patrick McGuire yea · Whitney Nash absent · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
ADJOURN — Adjourn
7 yea · 1 absent
Efrem Windom yea · Patrick McGuire yea · Whitney Nash absent · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Tue May 27, 2025 · 6:00 PM

Planning & Zoning Commission

P&Z to hear library design exceptions and a residential rezoning

The Planning and Zoning Commission will hold public hearings on design exceptions for the Roy & Helen Hall Memorial Library and a zoning request to R5 residential. The consent agenda includes approval of prior meeting minutes. No fiscal items or major contracts are listed.

planning-and-zoningpublic-hearinglibraryrezoningdesign-exceptionsresidential
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue May 27, 2025 · 5:30 PM

Capital Improvements Advisory Committee

Public hearing on semiannual impact fee report for roadway and utility capital improvements

The Capital Improvements Advisory Committee will conduct a public hearing to consider and possibly act on the FY24-25 Mid-Year Semiannual Impact Fee Report, which details the progress of the capital improvements plan for roadway and utility impact fees. Consent items include approval of the minutes from the December 10, 2024 meeting. No other substantive items are on the agenda.

capital-improvementsimpact-feespublic-hearingroadwayutilitiesmckinney
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Thu May 22, 2025 · 8:00 AM

McKinney Community Development Corporation

Board will consider reappropriating $2.8 million plus other park funds

The McKinney Community Development Corporation board will review a request from the Parks and Recreation Department to reallocate previously awarded funds for several park projects, totaling $2,797,804 and additional amounts to six other parks. The board will also consider two project grant applications: $500,000 for a transitional living community at 3286 County Road 168, and $211,160 for trail improvements at One Nature Place. Additional agenda items include updates on board and commission appointments, the city housing and community development plan, and the April 2025 financial report.

parksgrantscommunity-developmenthousingfinance
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
7 yea · 1 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth yea · David Riche yea · Chris Wilkes absent
ACTION ON EXECUTIVE SESSION — Approved
6 yea · 2 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth absent · David Riche yea · Chris Wilkes absent
ADJOURN — Approved
6 yea · 2 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth absent · David Riche yea · Chris Wilkes absent
25-2787 — Approved
7 yea · 1 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth yea · David Riche yea · Chris Wilkes absent
25-2788 — Approved
7 yea · 1 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth yea · David Riche yea · Chris Wilkes absent
25-2789 — Approved
7 yea · 1 absent
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · Joy Booth yea · David Riche yea · Chris Wilkes absent
Tue May 20, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC to deliberate Project Mirage, Terrigen, Mathewson, Durant in closed session

The McKinney Economic Development Corporation will consider and act on financial reports for February, March, and April 2025, then enter executive session to discuss economic development incentives for four confidential projects (Mirage, Terrigen, Mathewson, Durant). The board will also receive updates on board appointments and monthly reports. No city council action will be taken, though a quorum of council may be present.

economic-developmentfinancial-reportsexecutive-sessionproject-mirageproject-terrigenproject-mathewsonproject-durantboard-appointments
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
12 yea · 4 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-2818 — Approved and Referred
6 yea · 2 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-2820 — Approved and Referred
11 yea · 5 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton absent · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-2825 — Approved
6 yea · 2 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
ACTION ON EXECUTIVE SESSION — Adjourn
6 yea · 2 absent
Brian Loughmiller absent · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
Tue May 20, 2025 · 3:00 PM

City Council Work Session

Council to discuss parks funding and charter amendment update

The City Council will hold a work session to discuss agenda items for the regular meeting later that day. Topics include panel replacement for concrete arterial roadways, the Collin County Parks and Open Space Project Funding Assistance Program, parks and recreation funding, and an update on the 2024 Charter Amendment Election. The council will also enter executive session for legal consultations and economic development negotiations. No final votes are expected during this work session.

work-sessionroadsparksfundingcharter-amendmentlitigationeconomic-developmentmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Tue May 20, 2025 · 6:00 PM

City Council Regular Meeting

McKinney City Council to restate Home Rule Charter

The City Council will consider restating the Home Rule Charter following a November 2024 election and gather citizen input on the FY 2025-26 budget. The body will also hold public hearings on two rezoning requests and an amendment to the Unified Development Code.

zoningbudgetcharterinfrastructurepublic-hearings
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu May 15, 2025 · 6:30 PM

Community Grants Advisory Commission

McKinney grants commission holds public hearing on FY 2025-2026 applications

The Community Grants Advisory Commission will hold a public hearing to discuss the FY 2025-2026 consolidated grants application process. No city council action is scheduled for this meeting.

grantspublic-hearingadvisory-commissionbudgetmckinney
Council Chambers 401 E. Virginia Street McKinney. Texas 75069
Thu May 15, 2025 · 4:30 PM

McKinney Arts Commission

Arts Commission to vote on $10,500 mural for Community Lifeline Center

The McKinney Arts Commission will consider approving a $10,500 public art mural for the Andrea Holmes Community Lifeline Center, discuss public art opportunities at the Roy and Helen Hall Library, and review the grant application process. The commission will also approve minutes from April 17, 2025. No public hearings are scheduled.

arts-commissionpublic-artmurallibrarygrantsmckinney
111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2773 — Approved and Referred
6 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
25-2774 — Approved
6 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
ADJOURN — Adjourn
6 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
Thu May 15, 2025 · 5:00 PM

Library Advisory Board

Library Advisory Board to preview Summer Reading Program

The Library Advisory Board will meet to discuss the 2025 Summer Reading Program and the Summer 2025 Library Guide. The board will also receive updates on the McKinney Public Library Foundation and the Director's Report.

librarysummer-readingcommunity-programs
City Hall Virginia Conference Room (CH 123) 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2777 — Approved and Referred
6 yea
Lisa Harris yea · Courtney Hugghins yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
ADJOURN — Adjourn
6 yea
Lisa Harris yea · Courtney Hugghins yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
Wed May 14, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to discuss 2025 Memorial Day Ceremony

The McKinney Armed Services Memorial Board will meet to discuss the 2025 Memorial Day Ceremony (no action taken). The board will also consider approval of minutes from the April 9, 2025 meeting and receive board and liaison reports. This meeting is largely procedural, with no votes on substantive policy matters expected.

memorialarmed-servicesceremonyminutespublic-meeting
CH 550 Wattley Conference Room McKinney City Hall 401 E. Virginia St. McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2763 — Approved and Referred
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Wed May 14, 2025 · 9:00 AM

City Council Special Meeting

City Council to certify May 3 election results and call for June 7 runoff

The City Council will meet to certify the results of the May 3, 2025, General Election for Mayor and City Council members. The body will also consider calling for a runoff election on June 7, 2025.

electionscity-councilvoting
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
5 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Michael Jones yea
TMP25-2184 — Approved
5 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Michael Jones yea
TMP25-2185 — Approved
6 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
Wed May 14, 2025 · 6:30 PM

Community Grants Advisory Commission

Commission to discuss FY 2025-2026 consolidated grants application process

The Community Grants Advisory Commission will meet to review the public hearing schedule for the FY 2025-2026 consolidated grants application process. The commission will also consider the minutes from the April 24, 2025 meeting.

grantspublic-hearingsbudget
Council Chambers 401 E. Virginia Street McKinney. Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
7 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Andrea Harvey-Rodgers yea · Eniola Campbell yea · Barbara Kelly yea
25-2766 — Approved and Referred
7 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Andrea Harvey-Rodgers yea · Eniola Campbell yea · Barbara Kelly yea
Wed May 14, 2025 · 6:00 PM

Board of Adjustment

Board to hear appeal on oversized sign at Craig Ranch Parkway storage facility

The Board of Adjustment will hold a public hearing to consider an appeal of the Building Official's decision regarding a sign violation at 7150 Craig Ranch Parkway. The applicant seeks to install a 120-square-foot sign reading 'Public Storage' where code limits sign area to 25 square feet. The board will also consider approving the minutes from the April 9, 2025 meeting.

board-of-adjustmentsignspublic-hearingzoningappeal
McKinney City Hall Virginia Conference Room (CH 123) 222 N. Tennessee Street McKinney. Texas 75069
Notable items
Tue May 13, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to consider rezoning for industrial uses at Industrial and Airport

The Planning & Zoning Commission will hold public hearings on three development-related items and a code amendment. They will vote on design exceptions for a multi-family project on West University Drive, a rezoning to allow industrial uses at Industrial Boulevard and Airport Drive, and another rezoning to light industrial on Old Mill Road. Additionally, they will consider amendments to the Unified Development Code concerning the McKinney Town Center.

zoningpublic-hearingsindustrial-developmentmulti-familytown-centerunified-development-code
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Fri May 9, 2025 · 8:00 AM

McKinney Housing Finance Corporation

Board will consider authorizing issuance of multifamily housing bonds (Series 2025C)

The McKinney Housing Finance Corporation board will approve the minutes from its March 14, 2025 meeting. It will receive an update on the Community Land Trust. The board will consider a resolution to issue Multifamily Housing Subordinate Revenue Bonds (Series 2025C) along with related financing and regulatory agreements. Finally, the board will discuss the proposed 2025‑2026 budget.

housingfinancebondsbudgetboard-appointmentscommunity-land-trust
Council Chambers 401 E, Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
4 yea
Gwendolyn Brannon yea · Paul Shirar yea · Lisa Emery yea · Tyler Underwood yea
25-2759 — Approved and Referred
4 yea
Gwendolyn Brannon yea · Paul Shirar yea · Lisa Emery yea · Tyler Underwood yea
25-2762 — Approved
4 yea
Gwendolyn Brannon yea · Paul Shirar yea · Lisa Emery yea · Tyler Underwood yea
25-2761 — Approved
4 yea
Gwendolyn Brannon yea · Paul Shirar yea · Lisa Emery yea · Tyler Underwood yea
Thu May 8, 2025 · 8:30 AM

McKinney Main Street Board

Main Street Board to discuss and potentially act on downtown marketing initiative

The McKinney Main Street Board will meet to discuss financial reports, a downtown security update, and a downtown marketing initiative that may be voted on. They will also receive updates on downtown construction and upcoming events. The meeting includes public comment periods for agenda and non-agenda items.

downtownmarketingsecurityfinancial-reportsconstructioneventspublic-hearing
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2752 — Approved and Referred
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
ADJOURN — Adjourn
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
25-2755 — Approved
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Thu May 8, 2025 · 5:00 PM

Joint Meeting

City Council to approve contract for Gabe Nesbitt Park and Apex Centre upgrades

The PROS Advisory Board will consider a recommendation to authorize the City Manager to execute a construction contract for improvements at Gabe Nesbitt Park and the Apex Centre. The board will also discuss a recommendation to apply for Collin County funding assistance for the Rowlett Creek Trail at Stacy Road. Additional items include an update on MCDC FY24 approved projects and a discussion of park project funding priorities.

parksrecreationopen-spaceconstructiontrailcity-councilfunding
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ADJOURN JOINT MEETING — Adjourn
7 yea
Bruce Mead yea · Todd Burton yea · Mohammed Elhindi yea · Leslie Warren yea · Monica Escamilla yea · LuAnne Malnory yea · David Clarke yea
25-2703 — Approved
7 yea
Bruce Mead yea · Todd Burton yea · Mohammed Elhindi yea · Leslie Warren yea · Monica Escamilla yea · LuAnne Malnory yea · David Clarke yea
25-2704 — Approved
7 yea
Bruce Mead yea · Todd Burton yea · Mohammed Elhindi yea · Leslie Warren yea · Monica Escamilla yea · LuAnne Malnory yea · David Clarke yea
25-2702 — Approved and Referred
7 yea
Bruce Mead yea · Todd Burton yea · Mohammed Elhindi yea · Leslie Warren yea · Monica Escamilla yea · LuAnne Malnory yea · David Clarke yea
ADJOURN PARKS, RECREATION, AND OPEN SPACE BOARD MEETING — Adjourn
7 yea
Bruce Mead yea · Todd Burton yea · Mohammed Elhindi yea · Leslie Warren yea · Monica Escamilla yea · LuAnne Malnory yea · David Clarke yea
Tue May 6, 2025 · 5:00 PM

Reinvestment Zone Number Two

Public hearing on TIRZ funding for McKinney National Airport Eastside project

The McKinney City Council will review the minutes of the Tax Increment Reinvestment Zone Number Two (TIRZ2) Board meeting held on March 31, 2025. The council will then hold a public hearing to consider a request for TIRZ funding for the McKinney National Airport Eastside Infrastructure Project (AI2250). No decisions are indicated in the agenda; the hearing is for discussion and possible action.

tirzairportinfrastructurepublic-hearingcity-council
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2714 — Approved
7 yea · 1 nay
George Fuller yea · Justin Beller nay · Gere Feltus yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Darrell Hale yea · Cam McCall yea
The other 2 items passed by unanimous or near-unanimous consent.
Tue May 6, 2025 · 3:00 PM

City Council Work Session

City Council to discuss strategic goals for Fiscal Year 2025-26

The City Council will hold a work session to discuss department objectives and strategic goals for the 2025-26 fiscal year. The session includes several proclamations and an executive session to discuss legal matters and personnel evaluations.

budgetstrategic-planningpolicelitigationpersonnel
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
4 yea · 2 absent
George Fuller yea · Justin Beller absent · Patrick Cloutier yea · Gere Feltus absent · Rick Franklin yea · Michael Jones yea
ACTION ON EXECUTIVE SESSION — Adjourn
4 yea · 2 absent
George Fuller yea · Justin Beller absent · Patrick Cloutier yea · Gere Feltus absent · Rick Franklin yea · Michael Jones yea
Tue May 6, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider funding and contracts for McKinney National Airport infrastructure

The City Council will discuss budget amendments and multiple professional service contracts for the McKinney National Airport Eastside Infrastructure Project. The meeting also includes public hearings for three rezoning requests and an amendment to the Unified Development Code.

airportinfrastructurezoningbudgetpublic-safety
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 7 divided votes
Named votes as recorded in the official record.
23-0093Z2 — Tabled Indefinitely
5 yea · 1 nay
George Fuller nay · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
25-0001M2 — Approved
5 yea · 1 nay
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones nay
25-2737 — Approved
4 yea · 2 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier nay · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
25-2739 — Approved
4 yea · 2 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier nay · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
25-2741 — Approved
5 yea · 1 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
25-2738 — Approved
4 yea · 2 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier nay · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
25-2736 — Approved
4 yea · 2 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier nay · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
The other 27 items passed by unanimous or near-unanimous consent.
Thu May 1, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to vote on historic marker for 401 W Hunt property

The Historic Preservation Advisory Board will consider a request from Nancy Powell to approve a historic marker for the property at 401 W Hunt. The board will also receive an update on 2025 board and commission member appointments and vote on the April 2025 meeting minutes.

historic-preservationhistoric-markerpublic-hearingboard-appointmentsmeeting-minutes
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Thu May 1, 2025 · 3:30 PM

Historic Preservation Advisory Board

Historic Preservation Board will discuss Municipal Complex Exhibit Project

The Historic Preservation Advisory Board will hold a work session with no formal action taken. Board members will discuss Item 25-2701, the Municipal Complex Exhibit Project. Public comments are invited on agenda items that are not public hearings. The meeting will also include board and staff announcements and acknowledgments.

historic-preservationmunicipal-complexpublic-commentsboard-meetingdiscussion
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Apr 29, 2025 · 8:00 AM

Visit McKinney

Visit McKinney to hear 2025 CJ Cup Byron Nelson update

The Visit McKinney board will meet to hear an update on the 2025 CJ Cup Byron Nelson golf tournament and receive a sales presentation. The agenda also includes approval of previous minutes and reports from committees and the executive director. Per the agenda notice, no official action will be taken by the board at this meeting.

tourismgolfsports-eventsboard-meetingreports
401 E Virginia St. McKinney, TX. 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2695 — Approved and Referred
5 yea
Patrick McGuire yea · Whitney Nash yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
ADJOURN — Approved
5 yea
Patrick McGuire yea · Whitney Nash yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Thu Apr 24, 2025 · 8:00 AM

McKinney Community Development Corporation

MCDC to vote on $6.7M park fund reappropriation and $711K grants

The McKinney Community Development Corporation will hold public hearings and consider actions on reappropriating $6,741,106 in previously awarded funds across seven park projects, including Wattley, Old Settlers Park, Greens Neighborhood Park, and others. Additionally, the board will review two project grant applications: $500,000 for Direction 61:3 transitional living homes for young adults aging out of foster care, and $211,160 for trail improvements at Heard Natural Science Museum. The meeting also includes an executive session on economic development matters.

mckinney-community-development-corporationparks-and-recreationgrantspublic-hearingseconomic-developmenthousingmuseumstrails
Council Chambers 401 E Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
6 yea
Angela Richardson-Woods yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · David Riche yea · Chris Wilkes yea
ADJOURN — Adjourn
6 yea
Angela Richardson-Woods yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · David Riche yea · Chris Wilkes yea
25-2687 — Close the public hearing
6 yea
Angela Richardson-Woods yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · David Riche yea · Chris Wilkes yea
25-2688 — Close the public hearing
6 yea
Angela Richardson-Woods yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · David Riche yea · Chris Wilkes yea
25-2686 — Close the public hearing
6 yea
Angela Richardson-Woods yea · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd yea · David Riche yea · Chris Wilkes yea
Tue Apr 22, 2025 · 4:00 PM

City Council Work Session

Council to hear update on McKinney Airport Eastside Infrastructure Project

The McKinney City Council will hold a work session to receive updates on the Eastside Infrastructure Project at McKinney National Airport, the May 3, 2025 General Election, and the 2025 Boards & Commissions Annual Appointments Program. An executive session is scheduled to discuss pending litigation regarding the City's application to decertify a portion of its Certificate of Convenience and Necessity in Collin County. No formal votes are expected.

airportinfrastructureelectionboards-and-commissionslitigationproclamationwork-session
Council Chambers 401 E. Virginia Street McKinney, TX 75069
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
7 yea
George Fuller yea · Charlie Philips yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
Tue Apr 22, 2025 · 6:00 PM

Planning & Zoning Commission

Consider rezoning of property at Industrial Blvd & Airport Drive to allow industrial uses

The Planning & Zoning Commission will hold public hearings on two agenda items. One is a request to rezone a parcel at the northeast corner of Industrial Boulevard and Airport Drive from Planned Development to Planned Development with added industrial uses and modified standards. The other is an amendment to the Unified Development Code affecting zoning regulations and development standards. No city council action will be taken at this meeting.

zoningdevelopment-codepublic-hearingplanning
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Apr 17, 2025 · 4:30 PM

McKinney Arts Commission

Arts Commission to consider two public art mural contracts

The McKinney Arts Commission will meet to discuss and potentially act on funding for two public art murals. The commission will also receive updates on board member appointments and subcommittee progress.

artspublic-artcontractsmurals
111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-2648 — Approved and Referred
7 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
25-2649 — Approved
7 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
25-2650 — Approved
7 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
ADJOURN — Adjourn
7 yea
Ava Daley yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea · Kathryn Waite yea
Thu Apr 17, 2025 · 6:00 PM

Library Advisory Board

Board to discuss Storyland exhibit and library foundation updates

This meeting consists of discussion items only, with no votes or action expected. Topics include updates on the McKinney Public Library Foundation and the traveling exhibit 'Storyland: A Trip Through Childhood Favorites,' along with a director's report. Consent items cover approval of the March 20, 2025 minutes.

libraryadvisory-boardstorylandfoundationexhibitsdirector-reportmckinney
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2672 — Approved and Referred
5 yea
Lisa Harris yea · Courtney Hugghins yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea
ADJOURN — Adjourn
5 yea
Lisa Harris yea · Courtney Hugghins yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea
Tue Apr 15, 2025 · 4:00 PM

City Council Work Session

Discussion of downtown city‑owned property redevelopment

The McKinney City Council Work Session will review several items before the regular council meeting at 6:00 p.m. Topics include building inspection ISO ratings for 2025, updates from council liaisons, and a review of the downtown city‑owned property redevelopment plan. The session also includes the city manager’s annual performance evaluation and briefings on economic‑development projects Hemispheres and Lasso.

inspectionsdevelopmentpersonneleconomic-developmentcity‑property
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Apr 15, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider rezoning at 500 W University Dr, annexation, and affordable housing support

The McKinney City Council will hold public hearings on several rezoning requests, including a property at 500 W University Drive to Planned Development, and a proposed annexation and zoning for land on County Road 166. The council will also vote on a resolution supporting the McKinney Housing Authority's partnership with Presidium to build the Cotton Mill Phase I affordable housing development. Additionally, consent items include contracts for citywide street rehabilitation, Erwin Park improvements, and street striping. Appointments to the North Texas Municipal Water District Board and Historic Preservation Advisory Board are also on the agenda.

zoningpublic-hearingsaffordable-housingannexationstreet-rehabilitationparksappointments
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Apr 10, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board to discuss financial reports and upcoming events

The McKinney Main Street Board will meet to review financial reports and discuss upcoming events. The agenda also includes reports from the city liaison, director, and subcommittees.

financeeventsappointmentscity-administration
McKinney Performing Arts Center *Noble Hall 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
25-2640 — Approved and Referred
11 yea
Onel Perez yea · Preston Schwalls yea · Von Daniel yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Thu Apr 10, 2025 · 6:00 PM

Parks, Recreation, and Open Space Advisory Board

Board will discuss future capital improvement projects for parks and recreation

The Parks, Recreation, and Open Space Advisory Board will consider and discuss potential future capital improvement projects for parks and recreation. No formal actions or votes are scheduled; the discussion is for informational purposes only. The meeting also includes routine consent items, a director’s report, and public comment time.

parksrecreationcapital-improvementpublic-commentsadvisory-board
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2643 — Approved and Referred
5 yea · 1 absent
David Clarke yea · Monica Escamilla yea · LuAnne Malnory absent · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea
ADJOURN — Adjourn
5 yea · 1 absent
David Clarke yea · Monica Escamilla yea · LuAnne Malnory absent · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea
Wed Apr 9, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to discuss 2025 Memorial Day ceremony

The McKinney Armed Services Memorial Board will meet to approve minutes from March and discuss plans for the 2025 Memorial Day ceremony. No action will be taken on the ceremony discussion. The board will also receive updates on board member appointments and reports from liaisons.

armed-servicesmemorialceremonyminutesappointmentsboard
Council Chambers 401 E. Virginia St. McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2622 — Approved and Referred
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Approved Withdrawal of Motion
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Wed Apr 9, 2025 · 12:00 PM

Animal Service Facilities Advisory Committee

Animal Service Facilities Advisory Committee to introduce new manager

The committee will introduce new Animal Services Manager Hannah Golden and board members. The body will also discuss 2025 member appointments and determine the date for the next meeting.

animal-servicesappointmentscity-government
Virginia Conference Room (CH123) 401 E. Virginia Street McKinney. Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2627 — Approved and Referred
6 present
Ewa Cissik present · Maredith Brennan present · Cheryl Darveaux present · Lacy DeHorney present · Moka Anderson present · Hannah Golden present
ADJOURN — Approved
6 present
Ewa Cissik present · Maredith Brennan present · Cheryl Darveaux present · Lacy DeHorney present · Moka Anderson present · Hannah Golden present
Wed Apr 9, 2025 · 6:00 PM

Board of Adjustment

Board to hear appeal of artificial turf ban at 5408 Comanche Wells Dr.

The Board of Adjustment will hold a public hearing on an appeal of a building official's decision regarding artificial turf installed in a front yard, which is prohibited by the Unified Development Code. Consent items include approval of minutes from the January 8, 2025 meeting. A discussion item covers an update on 2025 board and commission member appointments.

board-of-adjustmentzoningartificial-turfpublic-hearingappealmckinney
McKinney City Hall Virginia Conference Room (CH 123) 401 E. Virginia Street McKinney. Texas 75069
Notable items
Tue Apr 8, 2025 · 6:00 PM

Planning & Zoning Commission

Public hearing on rezoning for mixed-use development near Bloomdale Road

The Planning & Zoning Commission will hold public hearings on two rezoning requests. The first would rezone land on Bloomdale Road from Planned Development to Planned Development to allow multi-family residential, single-family residential, and commercial uses. The second would rezone a property at Andrews and Green Streets to allow for a trade school. The consent agenda includes approval of prior meeting minutes.

zoningpublic-hearingplanned-developmentmulti-familycommercialtrade-schoolmckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Apr 3, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to consider demolition of shed at 1407 W. Louisiana Street

The Historic Preservation Advisory Board will consider a request for a Certificate of Appropriateness to demolish a detached shed at 1407 W. Louisiana Street. They will also discuss a Rehabilitation Level Historic Neighborhood Improvement Zone Program Tax Exemption for 612 W Virginia Street. Additionally, the board will select 12 houses for the 2026 Preserve Historic McKinney Home Recognition Program Calendar. An informational update on Municipal Complex projects is also on the agenda.

historic-preservationcertificate-of-appropriatenessdemolitiontax-exemptionhistoric-neighborhood-improvement-zonerecognition-programmckinney
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
25-2620 — Approved and Referred
6 yea
Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · James West yea · Kari Kennedy yea
REGULAR AGENDA ITEMS — Approved
6 yea
Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · James West yea · Kari Kennedy yea
HP2024-0082 — Approved
6 yea
Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · James West yea · Kari Kennedy yea
ADJOURN — Adjourn
6 yea
Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · James West yea · Kari Kennedy yea
Mon Mar 31, 2025 · 5:00 PM

Reinvestment Zone Number One

TIRZ1 board to consider minutes and annual report

The Tax Increment Reinvestment Zone Number One board will meet to approve minutes from its December 2024 meeting and receive a presentation on the fiscal year 2023-2024 annual report. No other decisions or public hearings are scheduled.

tax-increment-reinvestment-zonetirz1mckinneyannual-reportminutes
Council Chambers 401 E. Virginia Street McKinney, Texas
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
25-2605 — Approved and Referred
8 yea
George Fuller yea · Justin Beller yea · Gere Feltus yea · Charlie Philips yea · Rick Franklin yea · Patrick Cloutier yea · Michael Jones yea · Steve Lebo yea
Mon Mar 31, 2025 · 5:15 PM

Reinvestment Zone Number Two

McKinney TIRZ 2 board to hear annual report, approve past minutes

The Reinvestment Zone Number Two board will consider approving minutes from its May 2024 meeting and receive a presentation on the fiscal year 2023-2024 annual report. No other new business or decisions are on the agenda.

tirztax-increment-financingreinvestment-zonemckinneyannual-report
Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2616 — Approved and Referred
8 yea
George Fuller yea · Justin Beller yea · Gere Feltus yea · Charlie Philips yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Cam McCall yea
ADJOURN — Adjourn
8 yea
George Fuller yea · Justin Beller yea · Gere Feltus yea · Charlie Philips yea · Patrick Cloutier yea · Rick Franklin yea · Michael Jones yea · Cam McCall yea
Mon Mar 31, 2025 · 6:00 PM

City Council Regular Meeting

Public hearings on multi-family rezoning and UDC amendments highlight council agenda

The McKinney City Council will hold public hearings on three items: amendments to the Unified Development Code (including changes to use regulations and McKinney Town Center), a rezoning request for multi-family residential at Laud Howell Parkway and Trinity Falls Parkway, and a rezoning at 500 W University Drive. The consent agenda includes approvals of minutes, an electioneering ordinance for new City Hall, a revised procurement policy, a grant application for Old Settler's Park improvements, a contract for fire department scheduling software, consent to include ETJ in an emergency services district, a license agreement for Gray Branch Park, and an additional services agreement for airport environmental assessment.

zoninghousingpublic-hearingfire-departmenteconomic-developmentairportsemergency-servicesparks
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
24-0018Z2 — Approved
6 yea · 1 nay
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips nay · Michael Jones yea
The other 19 items passed by unanimous or near-unanimous consent.
Mon Mar 31, 2025 · 4:00 PM

City Council Work Session

Downtown parking modifications proposed to improve circulation

The City Council is holding a work session to discuss agenda items for the regular meeting later that day. They will hear a presentation on proposed changes to downtown on-street parking spaces to improve vehicle circulation and safety. The session also includes executive session items on a real property development agreement, the city manager's performance evaluation, and an economic development project.

parkingdowntownpolicecity-managereconomic-developmentreal-estateprocurement
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Mar 27, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider $25,332 infrastructure grant for Sugar Rush Holdings bakery

The McKinney Community Development Corporation will consider three retail development infrastructure grant applications totaling $59,877, including a $25,332 grant for Sugar Rush Holdings at 2950 Craig Drive. The board will also discuss Habitat for Humanity of Collin County’s request to extend a loan agreement for Project 4B 23-15 to March 31, 2026. Additional agenda items include updates on city special events processes and two Project 4B initiatives.

economic-developmentgrantsinfrastructureretailloancommunity-development
Council Chambers 401 E Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
CONSENT ITEMS — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
ACTION ON EXECUTIVE SESSION — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
ADJOURN — Adjourn
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2592 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2593 — Denied
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2594 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2595 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
Tue Mar 25, 2025 · 4:00 PM

Joint Meeting

Informational update on restaurant drive‑through development regulations

The McKinney City Council and Planning & Zoning Commission will hold a joint session to receive an informational update on development regulations for restaurants with drive‑throughs. No formal action or decision is scheduled; the presentation is for staff and public awareness. The meeting also includes standard public comments on agenda items and procedural items.

zoningdevelopmentrestaurantsdrive-throughplanning
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Mar 25, 2025 · 8:00 AM

Visit McKinney

Library Project Update: Reimagining Roy & Helen Hall Memorial Library

The council will hear a presentation on the status of the Roy & Helen Hall Memorial Library redesign. No formal actions or votes are scheduled; the item is informational. The meeting also includes routine consent items, reports from various city entities, and public comment periods.

librarycity-councilreportspublic-commentsagenda
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2581 — Approved and Referred
6 yea
Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Keith Gall yea
ADJOURN — Adjourn
7 yea
Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Tue Mar 25, 2025 · 3:00 PM

City Council Special Meeting

Council to consider loan to Economic Development Corporation for land purchase

The City Council will hold a special meeting and work session to discuss land acquisition and employee benefits. The body is deciding on an interfund loan from the General Fund to the McKinney Economic Development Corporation.

economic-developmentland-acquisitionemployee-benefitselectionscity-planning
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Mar 25, 2025 · 6:00 PM

Planning & Zoning Commission

Commission will hear rezoning of 4877 West University Drive for a telecom tower

The Planning & Zoning Commission will hold public hearings on four rezoning requests, including a high‑rise telecommunication structure at 4877 West University Drive. Other items consider rezoning the northeast corner of South Tennessee Street and Christian Street from Neighborhood Business to Residential (R5), zoning a site east of County Road 166 to Neighborhood Commercial (C1), and allowing detached accessory structures at 2041 Redbud Boulevard. The meeting also includes consent items to approve the minutes from the March 11, 2025 commission meeting.

zoningpublic-hearingdevelopmenttelecomresidentialcommercial
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Mar 20, 2025 · 4:30 PM

McKinney Arts Commission

McKinney Arts Commission to review mural and grant presentations

The McKinney Arts Commission will meet to discuss and act on presentations regarding public art murals and project/outreach grants. The commission will also elect a Vice Chair and review previous meeting minutes.

artspublic-artgrantscommissions
111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
25-2578 — Approved
5 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea
25-2579 — Approved
5 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea
25-2577 — Approved and Referred
5 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea
25-2576 — Approved
5 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea
ADJOURN — Adjourn
5 yea
Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Tamara Mader yea
Thu Mar 20, 2025 · 5:00 PM

Library Advisory Board

Library Board to discuss code of conduct and foundation updates

The Library Advisory Board will review the minutes from the February 20, 2025 meeting and discuss the library's Code of Conduct policy and updates from the McKinney Public Library Foundation. The meeting is a routine session with no city council action planned.

librarypolicyboardfoundationagenda
Roy and Helen Hall Memorial Library Dulaney Room 101 E. Hunt Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2572 — Approved and Referred
6 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
ADJOURN — Adjourn
6 yea
Lisa Harris yea · Courtney Hugghins yea · Stacy Ridenour yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea
Tue Mar 18, 2025 · 4:00 PM

City Council Work Session

Council to discuss Assistant City Manager appointment in executive session

This is a work session where the City Council will discuss agenda items for the regular meeting later that evening. An executive session is scheduled for legal consultation under Texas Government Code Section 551.071 and a personnel matter concerning the Assistant City Manager appointment under Section 551.074. Public comments on posted agenda items will be heard.

city-councilwork-sessionexecutive-sessionpersonnelassistant-city-managermckinney
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Tue Mar 18, 2025 · 3:00 PM

Joint Meeting

Council to consider $30M grant for airport terminal expansion at McKinney National Airport

The joint meeting will consider a $30 million project grant application for Eastside Airport Infrastructure and Passenger Terminal elements at McKinney National Airport. Also up for discussion are the issuance of sales tax revenue bonds by both the McKinney Community Development Corporation and the Economic Development Corporation, along with related resolutions. An executive session is scheduled to discuss economic development matters regarding the Craig Ranch Resort Hotel.

airportbondseconomic-developmentgrantsinfrastructure
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Notable items
Tue Mar 18, 2025 · 6:00 PM

City Council Regular Meeting

Council to vote on bond issuances, rezoning near Custer and FM 1461

The McKinney City Council will consider authorizing the issuance of multiple bond series, including certificates of obligation and general obligation bonds. The council will also hold public hearings on four rezoning requests: a mixed-use development at Custer Road and FM 1461, a government complex at 1400 S. College Street, a townhome district at 1405 N Graves Street, and light industrial zoning near Airport Drive and Old Mill Road. Consent items include budget amendments for the Roy and Helen Hall Memorial Library Reimagine project and Trinity Falls districts, as well as contracts for infrastructure improvements like the Virginia and Throckmorton street project and the Independence Parkway waterline.

zoningbondspublic-hearingsbudgetinfrastructurelibrarydevelopment
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Tue Mar 18, 2025 · 2:00 PM

McKinney Economic Development Corporation

Board will discuss pending litigation and major development projects in executive session

The McKinney Economic Development Corporation board will approve the minutes from its January 21 and February 18, 2025 meetings. It will review and act on the January 2025 financial statements and related invoices. An executive session will be held to consult counsel on pending litigation, two city land parcels, and several economic development projects.

financelitigationreal-estatedevelopment-projectsexecutive-sessioneconomic-development
Council Chambers 401 E Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
26 yea · 6 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea
ADJOURN — Adjourn
6 yea · 2 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea
25-2548 — Approved and Referred
6 yea · 2 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea
25-2547 — Approved and Referred
6 yea · 2 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea
25-2551 — Approved
6 yea · 2 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn absent · Mark Denissen yea
Fri Mar 14, 2025 · 8:00 AM

McKinney Housing Finance Corporation

Bond application for The Mill Stream Apartments to be considered

The McKinney Housing Finance Corporation will consider a resolution to submit an application for private activity bonds to the Texas Bond Review Board for The Mill Stream Apartments Project, and declare an expectation to reimburse expenditures. A presentation introducing The NRP Group is scheduled. The board will also consider adopting an Affordable Housing Scorecard.

housing-financebondsaffordable-housingmill-stream-apartmentsscorecardmckinney
Tennessee Conference Room (CH125) 401 E. Virginia Street McKinney, Texas 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
5 yea
Gwendolyn Brannon yea · John Reidy yea · Lisa Emery yea · Ranjith Raghunath yea · Tyler Underwood yea
25-2546 — Approved
5 yea
Gwendolyn Brannon yea · John Reidy yea · Lisa Emery yea · Ranjith Raghunath yea · Tyler Underwood yea
25-2544 — Approved
5 yea
Gwendolyn Brannon yea · John Reidy yea · Lisa Emery yea · Ranjith Raghunath yea · Tyler Underwood yea
25-2543 — Approved and Referred
5 yea
Gwendolyn Brannon yea · John Reidy yea · Lisa Emery yea · Ranjith Raghunath yea · Tyler Underwood yea
Thu Mar 13, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board meets to review minutes and discuss events

The McKinney Main Street Board will review the minutes from their February 13, 2025 meeting and discuss upcoming events. The agenda includes reports from the City Liaison, the 'M' Group, and the Director, as well as a strategic planning recap.

board-meetingminuteseventsstrategic-planningreport
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Adjourn
8 yea
Onel Perez yea · Von Daniel yea · Amy Pyeatt yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea
25-2536 — Approved and Referred
8 yea
Onel Perez yea · Von Daniel yea · Amy Pyeatt yea · Daniel Stampfel yea · Mike Buchanan yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea
Thu Mar 13, 2025 · 5:00 PM

Parks, Recreation, and Open Space Advisory Board

Board to approve minutes, hear director’s report

This is a routine meeting consisting of consent items, a director’s report, and board comments. No major decisions or public hearings are scheduled.

parksrecreationopen-spaceadvisory-boardminutesreport
Parks Administration Conference Room 1611 N. Stonebridge Drive McKinney, Texas 75070
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2540 — Approved and Referred
7 yea
David Clarke yea · Monica Escamilla yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Bruce Mead yea · Leslie Warren yea
ADJOURN — Adjourn
7 yea
David Clarke yea · Monica Escamilla yea · LuAnne Malnory yea · Osiola Henderson yea · Mohammed Elhindi yea · Bruce Mead yea · Leslie Warren yea
Wed Mar 12, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board will discuss the 2025 Memorial Day Ceremony

The McKinney Armed Services Memorial Board will approve the February 12, 2025 meeting minutes and receive board and liaison reports. It will discuss plans for the 2025 Memorial Day Ceremony, but no formal action will be taken. The meeting includes public comment time for non‑public‑hearing items.

memorialeventsboardminutesreports
Parks Administration Conference Room 1611 N. Stonebridge Drive McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2529 — Approved and Referred
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Guy Green yea · Paul Hoch yea
Tue Mar 11, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to consider rezoning for multi-family housing and UDC amendments

The Planning & Zoning Commission will hold public hearings to consider two rezoning requests and amendments to the Unified Development Code. These actions determine how specific land parcels are used and how zoning regulations are applied within the city.

zoninghousingland-useordinancesmulti-family
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Thu Mar 6, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board will discuss the Preservation Law (no action taken)

The Historic Preservation Advisory Board will approve the minutes from its February 6, 2025 meeting. It will hold a discussion on the Preservation Law but will not take any action on it. The meeting also includes public comment time and board‑staff announcements.

historic-preservationboard-meetingpublic-commentsminutes-approvalpreservation-law
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2506 — Approved and Referred
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea
ADJOURN — Adjourn
7 yea
Maegan Escamilla yea · Johanna Friedel yea · Jimmy Don Burris yea · Marsha Prior-Robertson yea · Betty Petkovsek yea · Tom Pence yea · James West yea
Tue Mar 4, 2025 · 3:00 PM

City Council Work Session

Council to discuss drive-through restaurant regulations update

The McKinney City Council will hold a work session to discuss items for the regular meeting later that day. They will receive an informational update on development regulations for restaurants with drive-throughs and a recap of 2024 development activity. The council will also convene an executive session to discuss pending litigation, real property redevelopment (Downtown City-Owned Property and Honey Creek), and economic development (Project Hemispheres). No final votes are taken at the work session.

zoningdevelopmentdrive-throughslitigationreal-estateeconomic-developmentcity-counciltexas
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Tue Mar 4, 2025 · 6:00 PM

City Council Regular Meeting

Public hearing on rezoning for mixed-use at Custer Road and FM 1461

The McKinney City Council will hold public hearings on several rezoning requests, including a mixed-use development at Custer Road and FM 1461, and rezonings near County Road 317 and at 2041 Redbud Boulevard. The council will also consider waiving roadway impact fees for two multi-family developments under the Neighborhood Empowerment Zone program. Consent items include a contract for McKinney Soccer Complex renovations, a cell tower lease, and adoption of budget policies for FY 2025-26.

zoningrezoningmulti-familypublic-hearingcontractcommunity-granttransportation
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
24-0103Z2 — Close the public hearing
3 yea · 2 nay
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin nay · Charlie Philips nay
24-0103Z2 — Approved
3 yea · 2 absent · 2 nay
George Fuller absent · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin nay · Charlie Philips nay · Michael Jones absent
The other 25 items passed by unanimous or near-unanimous consent.
Tue Mar 4, 2025 · 8:30 AM

McKinney Economic Development Corporation

MEDC to hold 2025 strategic planning session

This is a special meeting of the McKinney Economic Development Corporation. The only agenda item is a 2025 Strategic Planning Session. No votes, contracts, or public hearings are scheduled.

economic-developmentstrategic-planningspecial-meetingmckinney
McKinney Economic Development Corporation District 121 121 Board Room 7300 State Highway 121 Suite 200 McKinney, TX 75070
Fri Feb 28, 2025 · 11:30 AM

Joint Meeting

McKinney City Council and MISD Board to discuss joint safety initiatives

This joint meeting of the McKinney City Council and McKinney ISD Board of Trustees is a discussion-only session covering topics including joint safety initiatives, MISD strategic plan, economic development projects, and more. An executive session is scheduled for legal and real property matters. No formal votes are on the agenda.

city-councilschool-boardjoint-meetingsafetyeducationeconomic-developmentinfrastructure
City Hall Council Chambers 401 E. Virginia Street McKinney, Texas 75069
Thu Feb 27, 2025 · 8:00 AM

McKinney Community Development Corporation

$30M airport terminal grant and other project grants considered by MCDC

The McKinney Community Development Corporation will consider multiple project grant applications, including a $30 million grant for Eastside Airport infrastructure at McKinney National Airport and a $1.5 million grant for erosion stabilization at TPC Craig Ranch. The board will also act on a corrected grant for the 2025 Arts in Bloom event and hear updates on the Roy and Helen Hall Library re-imagined project. Several public hearings are scheduled for retail infrastructure grants.

community-developmentgrantsairportinfrastructurehousingparkshistoric-preservationretail
Council Chambers 401 E Virginia Street McKinney, TX 75069
Notable items
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
ADJOURN — Approved
6 yea · 1 absent
Angela Richardson-Woods yea · David Kelly absent · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2479 — Approved and Referred
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2489 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2490 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2491 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2492 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2493 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2495 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2496 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2488 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2497 — Close the public hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2498 — Close the public hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2499 — Close the public hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2494 — Close the public hearing
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2500 — Approved
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
25-2494 — Tabled to Another Meeting
7 yea
Angela Richardson-Woods yea · David Kelly yea · Deborah Bradford yea · AJ Micheletto yea · Joy Booth yea · David Riche yea · Chris Wilkes yea
Thu Feb 27, 2025 · 6:30 PM

Community Grants Advisory Commission

Public hearing on FY 2024-2025 Community Support Grant funding recommendations

The commission will discuss the FY 2025-2026 consolidated grants application process and receive program updates on CDBG, CSG, and community development activities. A public hearing will be held to consider funding recommendations or program changes under the FY 2024-2025 Community Support Grant. Consent items include approval of previous meeting minutes.

community-grantspublic-hearingfundingcdbgcsgconsolidated-grantsmckinney
2nd Floor Conference Room 222 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Adjourn
8 yea
Silvia Escamilla yea · Aaron Schmitz yea · Tammy Chewe yea · Nicholas Dangerfield yea · Sally Riche yea · Andrea Harvey-Rodgers yea · Eniola Campbell yea · Barbara Kelly yea
Tue Feb 25, 2025 · 8:15 AM

Visit McKinney

Visit McKinney to review Hotel Occupancy Tax grant policies

The Visit McKinney board will meet to discuss and potentially act on updates to the Festival & Event Hotel Occupancy Tax (HOT) Grant Policy and Procedure. The meeting also includes reviews of financial, occupancy, and director reports.

tourismgrantshotel-occupancy-taxfinance
Council Chambers 401 E Virginia Street McKinney, TX. 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2471 — Approved and Referred
6 yea
Efrem Windom yea · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea
25-2474 — Approved
6 yea
Efrem Windom yea · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea
ADJOURN — Adjourn
6 yea
Efrem Windom yea · Patrick McGuire yea · Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea
Tue Feb 25, 2025 · 6:00 PM

Planning & Zoning Commission

Public hearings on three rezonings: government complex, townhomes, light industrial

The Planning & Zoning Commission will hold three public hearings on rezoning requests. One seeks to rezone 1400 S. College Street from Planned Development to Government Complex District. Another proposes changing 1405 N Graves Street from single-family residence to townhome residential. A third requests rezoning the northwest corner of Airport Drive and Old Mill Road from agriculture/estate to light industrial. The consent agenda includes approval of the February 11 meeting minutes.

planning-and-zoningzoningpublic-hearingrezoningsmckinneygovernment-complextownhomelight-industrial
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Notable items
Mon Feb 24, 2025 · 12:00 PM

Visit McKinney

Test meeting, no official action will be taken

This is a test meeting for procedural purposes only. No city council, board, or commission action will be taken. The agenda includes a consent item for minutes and a regular agenda item to discuss the Visit McKinney budget for fiscal year 2024-25.

test-meetingvisit-mckinneybudgetprocedural
Council Chambers 401 E Virginia Street McKinney, TX. 75069
Fri Feb 21, 2025 · 8:30 AM

City Council Work Session

McKinney City Council to review strategic goals

The City Council will hold a work session to receive an update on City Council Strategic Goals. The meeting includes a potential executive session for confidential attorney consultations.

strategic-planningcity-managementgovernance
Council Chambers 401 E. Virginia Street McKinney, TX 75069
Thu Feb 20, 2025 · 4:30 PM

McKinney Arts Commission

Arts Commission to review project/outreach grant presentations

The McKinney Arts Commission will consider and possibly act on project/outreach grant presentations, review minutes from the January meeting, and receive a subcommittee update. No public hearings are scheduled.

artsgrantsminutessubcommitteemckinney
111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2342 — Approved
4 yea
Ava Daley yea · Kimberlie Page yea · Matt Anderson yea · Tamara Mader yea
25-2443 — Approved and Referred
4 yea
Ava Daley yea · Kimberlie Page yea · Matt Anderson yea · Tamara Mader yea
ADJOURN — Adjourn
4 yea
Ava Daley yea · Kimberlie Page yea · Matt Anderson yea · Tamara Mader yea
Thu Feb 20, 2025 · 5:00 PM

Library Advisory Board

McKinney Library Advisory Board to discuss genealogy policy and foundation updates

The Library Advisory Board will meet to discuss updates to the Genealogy Local History Policy and receive reports on the McKinney Public Library Foundation. The board will also introduce the Customer Service Manager and review the Director's report.

librarygenealogypublic-policymckinney-public-library-foundation
John and Judy Gay Library The Bailey 6861 W. Eldorado Parkway McKinney, Texas 75070
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2466 — Approved and Referred
5 yea
Lisa Harris yea · Stacy Ridenour yea · Euphemia Gans yea · Beth Beck yea · Jonathan Sims yea
25-2467 — Approved
5 yea
Lisa Harris yea · Stacy Ridenour yea · Euphemia Gans yea · Beth Beck yea · Jonathan Sims yea
ADJOURN — Adjourn
5 yea
Lisa Harris yea · Stacy Ridenour yea · Euphemia Gans yea · Beth Beck yea · Jonathan Sims yea
Tue Feb 18, 2025 · 4:00 PM

Joint Meeting

McKinney City Council and MEDC to hold joint meeting on economic development

The McKinney City Council and McKinney Economic Development Corporation (MEDC) will meet to receive an MEDC update. The body will enter executive session to discuss real property and specific economic development projects.

economic-developmentreal-estatemedccity-council
City Hall Council Chambers 222 N. Tennessee Street McKinney, Texas 75069
Notable items
Tue Feb 18, 2025 · 3:00 PM

City Council Work Session

Council to discuss annual audit results and fire department California wildfire deployment

The City Council will hold a work session to discuss items for the regular meeting later that day. Agenda items include the annual audit results and acceptance of the Annual Comprehensive Financial Report for FY2024, an update on the Fire Department's deployment to California wildfires, and an executive session on Project Hemispheres economic development. The council will also receive liaison updates from city boards and commissions.

auditbudgetfire-departmentwildfireseconomic-developmentcouncil-work-sessionfinances
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
Tue Feb 18, 2025 · 6:00 PM

City Council Regular Meeting

McKinney City Council to consider affordable housing scorecard and airport terminal project

The City Council will discuss the adoption of an affordable housing scorecard and a pre-construction contract for the McKinney National Airport Commercial Terminal. The meeting includes public hearings for rezoning and site plan variances, as well as several infrastructure and service contracts.

affordable-housingzoningairportinfrastructurecontracts
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
Tue Feb 18, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC board to discuss 8 economic development projects in closed session

The McKinney Economic Development Corporation will consider consent items, receive board and liaison reports, and discuss December 2024 financials and supplemental policies. The board will also enter closed session to deliberate on several economic development projects and real estate acquisitions, including the Craig Ranch Resort Hotel and multiple code-named projects.

economic-developmentreal-estatefinancialspoliciesexecutive-sessionmckinney
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
25-2449 — Approved
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
ACTION ON EXECUTIVE SESSION — Approved
21 yea · 3 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
ADJOURN — Adjourn
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
25-2445 — Approved and Referred
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
25-2450 — Approved
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
ACTION ON EXECUTIVE SESSION — Amended
28 yea · 4 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams yea · Chantelle Kadala absent · Kurt Kuehn yea · Mark Denissen yea
Thu Feb 13, 2025 · 8:30 AM

McKinney Main Street Board

Main Street Board to discuss strategic planning and financial reports

The McKinney Main Street Board will meet to approve minutes from December 2024, discuss financial reports, and hold a discussion on 2025 strategic planning. No public hearings are scheduled, and no binding actions are expected on agenda items beyond the minutes approval.

main-streetdowntowneconomic-developmentplanningfinance
McKinney National Airport 1508 E. Industrial Blvd McKinney TX 75069 Airport North Conference Room, 2nd Floor
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
24-2335 — Approved and Referred
8 yea
Preston Schwalls yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
ADJOURN — Adjourn
8 yea
Preston Schwalls yea · Amy Pyeatt yea · Kate McAnally yea · Daniel Stampfel yea · Heather Lowry yea · Lauren F. Smith yea · Kim Black yea · Ginger Hayes yea
Thu Feb 13, 2025 · 5:30 PM

Parks, Recreation, and Open Space Advisory Board

Board to consider community farm at Gray Branch Parkland and soccer complex renovations

The Parks, Recreation, and Open Space Advisory Board will discuss the use of Gray Branch Parkland for a community farm. The board will also consider a recommendation to City Council regarding a construction contract for field renovations and improvements at the McKinney Soccer Complex.

parksrecreationcommunity-farmsoccer-complexinfrastructure
Parks Administration Conference Room 1611 N. Stonebridge Drive McKinney, Texas 75070
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2439 — Approved
6 yea · 1 nay
David Clarke yea · Monica Escamilla yea · Osiola Henderson yea · Mohammed Elhindi yea · Todd Burton yea · Bruce Mead yea · Leslie Warren nay
The other 3 items passed by unanimous or near-unanimous consent.
Wed Feb 12, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Board to vote on adding name to Veterans Memorial Wall

The McKinney Armed Services Memorial Board will consider and potentially act on adding a name to the Veterans Memorial Wall. The board will also discuss proposed signage for Corporal RD Foster Veterans Memorial Park and plans for the 2025 Memorial Day Ceremony. The meeting includes approval of previous minutes and board liaison reports.

memorialveteransparkssignageceremonies
Parks Administration Conference Room 1611 N. Stonebridge Drive McKinney, Texas
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2429 — Approved and Referred
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Paul Reed yea
25-2433 — Approved
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Paul Reed yea
ADJOURN — Adjourn
6 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Paul Reed yea
Tue Feb 11, 2025 · 6:00 PM

Planning & Zoning Commission

McKinney P&Z to consider three rezoning requests and two site permits

The Planning & Zoning Commission will hold public hearings to act on several land use requests. These include rezoning for residential and commercial developments and permits for telecommunications and site design exceptions.

zoningland-useresidentialcommercialtelecommunications
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
Mon Feb 10, 2025 · 6:00 PM

City Council Regular Meeting

Test agenda with placeholder items only

This meeting agenda is marked as a test and contains only placeholder entries, such as minutes from 2019 and a historic marker request with generic names and addresses. No substantive decisions or public hearings are scheduled.

testplaceholderhistoric-preservationminutes
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Thu Feb 6, 2025 · 5:30 PM

Historic Preservation Advisory Board

Board to discuss local government program and 2026 historic home calendar

The Historic Preservation Advisory Board will meet to review the Certified Local Government Program and the 2026 Historic Home Recognition Calendar. No formal actions will be taken on the discussion items.

historic-preservationlocal-governmentcommunity-recognition
City Hall Council Chambers 222 N. Tennessee Street McKinney, Texas 75069
Tue Feb 4, 2025 · 6:00 PM

City Council Regular Meeting

City Council to consider senior living project and zoning requests

The City Council will hold public hearings regarding a new senior living development and two property rezoning or use requests. The body will also discuss grant applications for police equipment and cybersecurity, as well as the May 2025 general election.

zoninghousingelectionspublic-safetycybersecurity
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2422 — Approved
5 yea · 1 nay
Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips nay · Michael Jones yea
The other 30 items passed by unanimous or near-unanimous consent.
Tue Feb 4, 2025 · 4:00 PM

City Council Work Session

McKinney City Council to discuss cellular towers and economic development

The City Council will hold a work session to discuss items for the February 4 regular meeting. The session includes updates on cellular towers and an executive session for confidential matters.

cellular-towerseconomic-developmentsecuritycity-council
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
EXECUTIVE SESSION — Approved
5 yea · 1 absent
Charlie Philips yea · Justin Beller yea · Patrick Cloutier absent · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
ADJOURN — Adopted
5 yea · 1 absent
Charlie Philips yea · Justin Beller yea · Patrick Cloutier absent · Gere Feltus yea · Rick Franklin yea · Michael Jones yea
Tue Jan 28, 2025 · 8:00 AM

Visit McKinney

Visit McKinney to get update on NCAA DII Football Championship

The Visit McKinney board will meet to receive reports from liaisons, committees, and the executive director, and will hear an update on the NCAA Division II Football Championship. No votes on ordinances or contracts with dollar amounts are scheduled; the agenda is primarily informational and procedural.

tourismeconomic-developmentsportsreportsmckinney
Council Chambers 222 N. Tennessee Street McKinney, TX. 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2401 — Approved and Referred
6 yea
Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
ADJOURN — Adjourn
6 yea
Whitney Nash yea · Katie Scott yea · Jill Thompson Barnes yea · Brian Medina yea · Juanita Pena yea · Keith Gall yea
Tue Jan 28, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to hear rezonings for multi-family and commercial at Custer Road and Virginia Parkway

This meeting includes election of chair and vice-chair, approval of minutes, and public hearings on three rezoning requests and one variance. The commission will consider a request to table a rezoning at Custer Road and FM 1461, a variance for Modera Multi-Family on Hardin Boulevard, a rezoning at 6633 Virginia Parkway, and a rezoning at Lake Forest Drive and Collin McKinney Parkway.

planning-and-zoningrezoningmulti-familycommercialvariancepublic-hearingmckinney
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
Thu Jan 23, 2025 · 8:00 AM

McKinney Community Development Corporation

Board to consider $30M grant for McKinney National Airport expansion

The McKinney Community Development Corporation will consider approving 15 promotional and community event grants totaling about $160,000 and nine project grants ranging from $20,000 to $30 million. Public hearings will be held for project grants including a $30 million airport infrastructure project, a $1.5 million creek erosion fix at TPC Craig Ranch, and a $970,000 Hugs Cafe headquarters. The board will also discuss quality of life award nominations and go into executive session on economic development matters.

community-developmentgrantsairportinfrastructurehousingparkspublic-hearingeconomic-development
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
25-2371 — Approved
6 yea · 1 nay · 1 absent
Angela Richardson-Woods yea · David Kelly nay · Deborah Bradford yea · AJ Micheletto yea · Markus Lloyd absent · Joy Booth yea · David Riche yea · Chris Wilkes yea
The other 23 items passed by unanimous or near-unanimous consent.
Tue Jan 21, 2025 · 3:00 PM

City Council Work Session

City Council will discuss downtown city‑owned property redevelopment

The work session will include updates on the Roy & Helen Hall Library re‑imagining and restaurant drive‑through development regulations. Council liaison reports on city boards and commissions will be presented. The council will also consider matters related to downtown city‑owned property redevelopment, the Craig Ranch Hotel project, and Project Hemispheres.

developmentlibraryrestaurantsdowntowneconomic-development
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
4 yea · 3 absent
George Fuller yea · Charlie Philips absent · Justin Beller yea · Patrick Cloutier yea · Gere Feltus absent · Rick Franklin yea · Michael Jones absent
ADJOURN — Approved
4 yea · 3 absent
George Fuller yea · Charlie Philips absent · Justin Beller yea · Patrick Cloutier yea · Gere Feltus absent · Rick Franklin yea · Michael Jones absent
Tue Jan 21, 2025 · 6:00 PM

City Council Regular Meeting

City Council to approve contracts and zoning changes

The McKinney City Council will consider approving multiple contracts, including a resolution to award a concrete ready-mix contract to Holcim-SOR, Inc., and a resolution to authorize a facilities agreement for the Painted Tree Subdivision. The body will also hold a public hearing to discuss a rezoning request for a property on Mediterranean Drive.

city-councilcontractszoningpublic-hearingroadshousingpolice
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
CONSENT AGENDA — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2395 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2394 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
ADJOURN — Adjourn
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
24-0128Z2 — Approved
6 yea · 1 abstain
George Fuller abstain · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
24-2245 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2398 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2392 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2393 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2391 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2399 — Tabled to Another Meeting
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2389 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2390 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2397 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2396 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
25-2400 — Approved
7 yea
George Fuller yea · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
Tue Jan 21, 2025 · 8:00 AM

McKinney Economic Development Corporation

MEDC to discuss 2024 financials, airport presentation, and economic development projects

The McKinney Economic Development Corporation will discuss final September 2024 financials, receive a presentation on McKinney National Airport, and hear a Cannon Beach update. An executive session is scheduled for discussions on a 42.5348-acre real estate acquisition, several economic development projects (including Craig Ranch Resort Hotel and Project Hemispheres), and the President's employment agreement. No city council action will be taken during this meeting.

economic-developmentairportreal-estatefinancial-reportschamber-of-commerceexecutive-session
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
ACTION ON EXECUTIVE SESSION — Approved
21 yea
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea · Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
ADJOURN — Adjourn
7 yea
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-2386 — Approved
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
25-2383 — Approved
7 yea · 1 absent
Brian Loughmiller yea · Scott Woodruff yea · Thad Helsley yea · Robert Hamilton yea · Julie Williams absent · Chantelle Kadala yea · Kurt Kuehn yea · Mark Denissen yea
Thu Jan 16, 2025 · 4:30 PM

McKinney Arts Commission

Arts Commission to consider project/outreach grant presentations

The McKinney Arts Commission will meet to approve November 2024 minutes, discuss and potentially act on project/outreach grant presentations, and receive a subcommittee update. No city council action will be taken. Public comment is allowed on agenda items.

artsgrantsminutessubcommitteemckinney
MPAC Gallery - lower level 111 N. Tennessee Street McKinney. Texas 75069
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
25-2341 — Approved and Referred
6 yea
Brian Magnuson yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Kathryn Waite yea
ADJOURN — Adjourn
6 yea
Brian Magnuson yea · Kimberlie Page yea · Jackie Brewer yea · Matt Anderson yea · Amber Douzart yea · Kathryn Waite yea
Thu Jan 16, 2025 · 5:00 PM

Library Advisory Board

Library Advisory Board to discuss Hall renovation and circulation policy

The Library Advisory Board will meet to receive updates on library facilities and policies. The board is scheduled to discuss the Hall renovation, downtown development, and the library's circulation policy.

libraryrenovationpublic-policycity-development
Roy and Helen Hall Memorial Library Dulaney Room 101 E. Hunt Street McKinney, Texas 75069
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
25-2344 — Approved and Referred
7 yea
Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea · Jonathan Sims yea
25-2347 — Approved
7 yea
Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea · Jonathan Sims yea
ADJOURN — Adjourn
7 yea
Courtney Hugghins yea · Stacy Ridenour yea · Connie Gibson yea · Euphemia Gans yea · Beth Beck yea · Catherine Kelly yea · Jonathan Sims yea
Tue Jan 14, 2025 · 6:00 PM

Planning & Zoning Commission

Commission to consider rezoning and site plan exceptions

The Planning & Zoning Commission will hold public hearings to act on a rezoning request and a specific use permit. The body will also consider design exceptions for two site plans.

zoningpublic-hearingsland-useairportcommercial-development
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
Thu Jan 9, 2025 · 8:30 AM

McKinney Main Street Board

McKinney Main Street Board to select Main Street Partner of the Year

The board will meet to discuss financial reports, upcoming events, and downtown construction updates. The body is scheduled to take action on selecting the Main Street Partner of the Year.

downtowneconomic-developmentcommunity-awardsconstruction
McKinney Performing Arts Center 111 N. Tennessee Street McKinney, Texas 75069
Wed Jan 8, 2025 · 6:00 PM

Board of Adjustment

Appeal of tree-planting violation at 708 Setting Sun Trail

The McKinney Board of Adjustment will hold a public hearing to consider an appeal of a building official's decision requiring two canopy trees on single-family properties. The property owner at 708 Setting Sun Trail requests exemption from planting one missing tree in the front yard. The board will also vote on minutes from October 2024 meetings.

board-of-adjustmentpublic-hearingtree-violationappealzoningmckinney
McKinney City Hall 222 N. Tennessee Street McKinney. Texas 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
24-2317 — Approved
3 nay · 2 yea
Eric Roberts nay · Larry Jagours nay · Tonya Dangerfield nay · Deanna Kuykendall yea · Randall Wilder yea
The other 2 items passed by unanimous or near-unanimous consent.
Wed Jan 8, 2025 · 6:00 PM

McKinney Armed Services Memorial Board

Armed Services Memorial Board meets to approve minutes and receive reports

This is a routine meeting of the McKinney Armed Services Memorial Board. The board will consider approving minutes from its November 13, 2024 meeting and hear board and liaison reports. No significant decisions or public hearings are on the agenda.

memorial-boardparksproceduralminutesreports
Parks Administration Conference Room 1611 N. Stonebridge Drive McKinney, Texas
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
24-2318 — Approved and Referred
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
ADJOURN — Adjourn
7 yea
Shane Ousey yea · Mark Hunt yea · Colin Kimball yea · Seth Norton yea · Carly McCall yea · Guy Green yea · Paul Hoch yea
Tue Jan 7, 2025 · 6:00 PM

City Council Regular Meeting

Council to consider renovation of McKinney Performing Arts Center

The City Council will discuss funding and architectural services for the McKinney Performing Arts Center renovation. The meeting includes public hearings on rezoning and a specific use permit, as well as a final plat approval.

arts-and-culturezoningairportinfrastructurepublic-works
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
24-2329 — Approved
5 yea · 2 nay
George Fuller yea · Justin Beller nay · Patrick Cloutier nay · Gere Feltus yea · Rick Franklin yea · Charlie Philips yea · Michael Jones yea
The other 17 items passed by unanimous or near-unanimous consent.
Tue Jan 7, 2025 · 3:00 PM

City Council Work Session

Council to discuss airport development and DART railroad projects

The City Council will hold a work session to review items for a subsequent regular meeting. Discussions include airport development and railroad crossing updates, followed by an executive session for legal and security matters.

airporttransportationrailroadlitigationdevelopment
Council Chambers 222 N. Tennessee Street McKinney, TX 75069
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ADJOURN — Approved
6 yea · 1 absent
George Fuller yea · Charlie Philips absent · Justin Beller yea · Patrick Cloutier yea · Gere Feltus yea · Rick Franklin yea · Michael Jones yea