The Boring PartsFederalLocal · USLocal · Canada
Hobart, IN

Hobart public meetings in 2021

174 substantive meetings from 2021, with official agendas or minutes and plain-English summaries.

Tue Dec 28, 2021

Sanitary and Stormwater District Board

Hobart sanitary board to consider PER hearing, GIS contract, leaf vacuum

The Hobart Sanitary and Stormwater District Board will meet to discuss and consider several items, including a public hearing notice for a preliminary engineering report on the Main Lift Station and Parallel Force Main, approval of a 2022 GIS contract with GTG, and the purchase of a leaf vacuum machine. The meeting also includes routine approvals of minutes, financial reports, and SRF bond claims.

sanitary-districtstormwaterinfrastructurecontractsequipmentpublic-hearing
✓ Decided: Board conditionally approves $78,676 leaf machine purchase

The Hobart Sanitary District Board conditionally approved the purchase of a leaf machine from Brown Equipment for $78,676, contingent on reaching a shared-cost agreement with the Board of Works. The board also ratified a $1,655 elevator repair at the main lift station, approved advertising a public hearing for the SRF bond process, and gave provisional approval to the GTG contract pending legal review. All votes were unanimous (5-0).

Tue Dec 21, 2021

Historic Preservation Commission

Commission to review signage and two facade renovations

The Hobart Historic Preservation Commission will meet to consider three certificates of appropriateness: a new wall sign at 222 Center Street and facade renovations at 345 and 347 Main Street. The meeting also includes approval of the October minutes and public comment.

historic-preservationcertificate-of-appropriatenesssignagefacade-renovation
✓ Decided: Historic Preservation Commission approves demolition of 222 Main St.

The Hobart Historic Preservation Commission approved a Certificate of Appropriateness for the demolition of the structure at 222 Main St., with conditions. The commission also discussed and approved several other certificates, including one for a new building at 222 Main St. and a sign application. All decisions were made in accordance with the city's preservation guidelines.

Fri Dec 17, 2021

Redevelopment Commission

Hobart Redevelopment Commission reviews US 30 and 69th Avenue development plans

The Commission will consider an amended Economic Development Plan for the US 30 and 69th Avenue area. The meeting includes status reports on the TRAX Project and 69th Avenue Improvement Project, as well as a motion regarding rezoning applications for Steiner Homes, Ltd.

redevelopmentzoninginfrastructureeconomic-developmentgrants
✓ Decided: RDC rescinds two Main Street facade grants, approves $945K bond requisition

The Hobart Redevelopment Commission rescinded facade improvement grants for 345 and 347 Main Street so the property owner can reapply, after work completed did not match approved scopes. The commission also approved a $945,268.66 bond requisition for the 69th Avenue project, including $779,603.81 for construction and legal costs from an eminent domain case. Additionally, it approved a $779,603.81 pay estimate, a 2022 General Services Agreement with BF&S, and allowed Steiner Homes to proceed with rezoning and subdivision applications.

Wed Dec 15, 2021

Board of Public Works and Safety

Board to consider planning and bond legal service agreements

The Hobart Board of Public Works and Safety is meeting to consider agreements for professional planning services and bond legal services, and to review updates on unsafe building and sidewalk cases. The agenda also includes a notice of a public hearing on a TIF allocation amendment for US 30 and 69th Avenue.

public-workssafetyplanninglegal-servicesunsafe-buildingstifpublic-hearing
✓ Decided: Board approves $165,120 comprehensive plan contract with Lakota Group

The Board approved a professional planning services agreement with Lakota Group for the city's comprehensive plan, not to exceed $165,120, with the Park Board contributing $30,568. They also approved a legal services agreement for bond services, reduced a letter of credit for Cressmoor Estates from $860,000 to $120,000, and continued two unsafe building cases. All votes were unanimous (3-0).

Wed Dec 15, 2021

City Council

City Council considers new storm water user fees and park program charges

The Common Council is reviewing updates to user fees for the city storm water system and park department programs. The body is also considering agreements regarding paint recycling and tax abatement compliance. Additionally, the council will review amendments to the US 30 and 69th Avenue Economic Development Area plan.

storm-waterparkstax-abatementeconomic-developmentrecycling
✓ Decided: Council adopts storm water fee increase and park fee changes

The Hobart Common Council unanimously adopted two ordinances: one establishing a new storm water user fee system and another amending park department fees. It also approved resolutions for a latex paint recycling interlocal agreement with Porter County, a tax abatement compliance waiver for Wynright Corp., and an amendment to the US 30 & 69th Ave economic development plan. All votes were 6-0.

Tue Dec 14, 2021

Sanitary and Stormwater District Board

Board to consider IHCDA water assistance MOA and multiple contracts

The Hobart Sanitary District/Storm Water Management Board will discuss and potentially approve several items, including an IHCDA water vendor MOA for a low-income water assistance program, a Scadata contract update, and a change order for the Hobart Community Pool site improvements. They will also review the 2022 HSD GI maintenance proposals and GIS contract with GTG, and discuss possible purchases and easement modifications.

waterstormwatercontractslow-income-assistanceinfrastructuremaintenance
✓ Decided: Board approves IHCDA water assistance MOA, multiple contracts

The Hobart Sanitary District Board approved several items, including an MOA with IHCDA for the low-income water assistance program, a Gasvoda proposal for pressure gauge replacement, change order #2 for the Hobart Community Pool (a reduction of $81,252.86), and a 2022 GI maintenance contract with Cardno for $31,891. The Board tabled the 2022 GTG contract pending legal review and discussion. No other substantive decisions were made; several items were informational or deferred.

Mon Dec 13, 2021

Board of Park Commissioners

Board discusses Community Center flooring and Master Plan budget

The Board of Park Commissioners is meeting to review department reports and discuss several facility updates. Key items include flooring for the Community Center and improvements to the Hall.

parkscommunity-centerbudgetfacilities
✓ Decided: Park board approves $40,813 flooring, painting, door repairs

The Hobart Board of Park Commissioners approved three Community Center improvement contracts: Master Tile vinyl flooring for $40,813.20, Bills Professional Painting for $2,660, and Imboden Construction door removal/restaining for $4,942. They also accepted a $35,568 master plan park budget. All votes were unanimous (3-0).

Thu Dec 9, 2021

Hobart Fire Civil Service Commission

Hobart Fire Civil Service Commission meeting cancelled

The regularly scheduled Hobart Civil Service Fire Commission meeting on December 9, 2021, has been cancelled. The agenda contains no other business items.

firecivil-servicecancelled
Wed Dec 8, 2021

Maria Reiner Center Board

Maria Reiner Center Board discusses leadership vacancies and 2022 planning

The Board of Directors will review financial reports and end-of-year updates. Discussions include a vacancy on the Board, the election of officers in January, and planning for 2022.

governancefinancerecreationplanning
✓ Decided: Board approves Friday pickleball with $5 fee for members

The Maria Reiner Center board approved a Friday night pickleball program (5-9pm) with a $5 fee per player, donated to the center, and requiring liability forms and police drop-off of money. The board also accepted minutes, agenda, claims totaling $2,468.85, and financial reports for October and November 2021. A board vacancy from Mike Adams' resignation was noted, with nominations to be sent to the mayor.

Thu Dec 2, 2021

Plan Commission

Plan Commission to review concrete recycling site, Cressmoor PUD, and more

The Hobart Plan Commission is meeting to consider several development-related items, including a site plan review for an existing concrete recycling facility, amendments to the Cressmoor PUD, a final plat for a subdivision, and a resolution for the US 30 & 69 Development Area. They will also discuss a temporary storage container for a remediation project. The agenda includes public dial-in information.

plan-commissionzoningsubdivisioneconomic-developmentsite-plan-review
✓ Decided: Plan Commission approves Albanese expansion area, tables concrete recycling site plan

The Hobart Plan Commission approved a resolution supporting the Redevelopment Commission's amendments to create Allocation Area No. 2 in the US 30 & 69th Ave. TIF district, which would allow Albanese to pursue economic development revenue bonds for an expansion. The commission tabled a site plan review for a concrete recycling facility at 327/337 Liverpool Road, citing unresolved issues including berm placement, drainage calculations, and site plan details. It also approved amendments to the Cressmoor PUD declarations and a temporary site plan for remediation work at Hobart Laundry & Dry Cleaners.

🏢 Building at this address: 3 m tall
Thu Dec 2, 2021

Board of Zoning Appeals

BZA to consider variance requests for storage containers and a driveway

The Board of Zoning Appeals will hold public hearings for three developmental standards variance requests. Two requests concern storage containers at 11 N. Hobart Rd., and one concerns a driveway at 225 N. Indiana St.

zoningvariancespublic-hearings
Wed Dec 1, 2021

Board of Public Works and Safety

Board to consider EMS agreement with New Chicago for 2022-2024

The Hobart Board of Public Works and Safety will hold a regular meeting on December 1, 2021. They will consider an Emergency Medical Services Agreement with the Town of New Chicago for 2022-2024, along with several other items including right-of-way agreements and a resolution to encumber 2021 funds. The board will also discuss tabled items such as HPD General Order 19 and property violations.

emergency-medical-servicesright-of-waybudgetsubdivisionpublic-safety
✓ Decided: Board approves EMS agreement with New Chicago for 2022-2024

The Board approved the Emergency Medical Services Agreement with the Town of New Chicago for 2022-2024, with annual payments of $29,500, $30,250, and $31,000. They also approved the Merrillville Partnership Right-of-Way Acquisition Agreement contingent on final review, and approved the signing of Mylars for the Albanese Subdivision. The Board accepted compliance for the property at 7197 Mississippi St. with fines to be paid by July 1, 2022, and continued the Cagney's sidewalk matter to December 15, 2021.

Wed Dec 1, 2021

City Council

Hobart City Council considers storm water fees and zoning changes

The Council will review a zoning change for properties on E. Lincoln Highway and a new system of rates and charges for the city storm water system. Additionally, the body will consider an authorization to transfer 2021 appropriations and upcoming council appointments.

zoningstorm-waterfeesbudgetgovernment-appointments
✓ Decided: Council adopts PUD-to-B-3 zoning change for two E. Lincoln Highway properties

The Council voted 7-0 to adopt Ordinance 2021-42, changing the zoning of 3802 and 3823 E. Lincoln Highway from a PUD zone to B-3. It also passed first readings of ordinances setting 2022 stormwater user fees (2021-44) and park department fees (2021-45), and adopted a resolution authorizing 2021 appropriation transfers. All votes were unanimous. The Council took no action on other proposed 2022 fee increases, which were set by prior ordinances.

Tue Nov 23, 2021

Sanitary and Stormwater District Board

Storm water rate increase and Fleming Street cost share on agenda

The Hobart Sanitary and Storm Water District Board will hold a public hearing on a proposed storm water rate increase and consider several contracts and cost-sharing agreements. The board will also discuss a proposal for work at 935 and 955 Fleming Street, a contract with SCADATA, and approval of a Baxter & Woodman contract.

storm-waterratespublic-hearingcontractsinfrastructure
✓ Decided: Hobart sanitary board raises Fleming Street sewer repair cap to $11,000

The board voted 5-0 to raise the cap for the 80/20 sanitary replacement project on Fleming Street to $11,000, allowing additional payments to residents. It also adopted a confirming resolution for new storm water rates to be sent to the Common Council, and approved a $226,160 contract for Duck Creek Tributary restoration. The board authorized a direct contract with Absolute Pipe for extra pipe cleaning and approved the Gasvoda SCADA contract pending legal review.

Wed Nov 17, 2021

Board of Public Works and Safety

Board to review property violations, unsafe buildings, and sign off on subdivisions

The Hobart Board of Public Works and Safety will hold its regular meeting, covering unfinished business such as a discussion on HPD General Order 19, property maintenance violations, and unsafe building updates. New business includes requests for tree removal, a dead end sign, fireworks, and approval of subdivision plats and a maintenance agreement for a Raising Cane's restaurant.

public-safetyproperty-maintenancesubdivisionagreementspermits
✓ Decided: Board approves multiple contracts, K-9 Faust, and fireworks at tree lighting

The Board of Public Works and Safety approved several items, including accepting K-9 Faust into the police department, approving a fireworks display for the tree lighting, signing mylars for a subdivision, approving a maintenance agreement for Raising Cane's, a supplemental agreement for Delaware St. reconstruction, and the Colorado Street Project signature page. Several property maintenance and unsafe building cases were continued to future meetings.

Wed Nov 17, 2021

City Council

Hobart City Council to consider zoning changes and budget transfers

The Common Council will meet to discuss a use variance for a two-family dwelling and a zoning classification change. The body will also consider an ordinance to transfer appropriations within the 2021 budget.

zoningbudgethousingland-use
✓ Decided: Council approves use variance for 2-family dwelling at 17 E. 3rd St.

The Common Council approved a use variance for a 2-family attached dwelling at 17 E. 3rd St., following a favorable BZA recommendation. It passed Ordinance 2021-42 on first reading to rezone 3802-3823 E. Lincoln Highway to B-3, with conditions including a 40-foot right-of-way dedication. It also passed and adopted Ordinance 2021-43, transferring appropriations within the 2021 budget for the General Fund, Recycling and Sanitation Departments, and the MVH Fund. The meeting minutes from November 3 and 9 were approved, and the agenda was adopted.

Tue Nov 16, 2021

Historic Preservation Commission

Hobart Historic Preservation Commission meeting cancelled

The November 16, 2021 meeting of the Hobart Historic Preservation Commission was cancelled. No decisions or discussions took place. The next scheduled meeting is December 21, 2021.

cancellationhistoric-preservationprocedural
Mon Nov 15, 2021

Redevelopment Commission

Hobart RDC to approve revised grant, road projects, and new allocation area

The Hobart Redevelopment Commission will hold its regular meeting to approve the agenda, minutes, and treasurer's report. Under old business, they will consider a revised grant amount for 347 Main Street. New business includes status reports on the TRAX and 69th Avenue projects, approval of pay estimate #12 for the 69th Avenue project, and several letters of engagement for Project Talon. They will also vote on a resolution to establish Allocation Area No. 2 for the US 30 and 69th Avenue Economic Development Area, and approve a design services agreement for Colorado Street widening and intersection improvements at 61st Avenue.

redevelopmentgrantsroadseconomic-developmentcontractspublic-hearing
✓ Decided: RDC approves Resolution 2021-10 to create TIF allocation area for Albanese expansion

The Hobart Redevelopment Commission approved Resolution 2021-10, which initiates the process to create a new allocation area within the US 30 and 69th Avenue TIF district to support Albanese Confectionery's expansion via a TIF bond. The commission also approved three engagement letters for financial and legal services related to the project, and approved design services for the Colorado Street widening and 61st Avenue intersection improvement. Additionally, the commission approved two education and workforce training grants and a revised December meeting date.

Thu Nov 11, 2021

Hobart Fire Civil Service Commission

Hobart Fire Civil Service Commission meeting cancelled

The regularly scheduled Hobart Civil Service Fire Commission meeting on November 11, 2021, has been cancelled. No business will be conducted at this meeting.

firecivil-servicemeeting-cancelled
Tue Nov 9, 2021

City Council

Hobart Common Council to hold executive session on litigation strategy

The Common Council is meeting in an executive session to discuss strategy regarding the initiation of litigation or litigation that is pending or threatened in writing.

legallitigationexecutive-session
✓ Decided: Council holds executive session on litigation strategy

The Hobart Common Council held an executive session on November 9, 2021, limited to discussing litigation strategy as authorized by state law. No votes or substantive decisions were made; the session was procedural and adjourned after one hour.

Tue Nov 9, 2021

City Council

Council considers amendment to Cressmoor Estates PUD covenants

The Common Council is holding a special meeting to conduct a second reading of Ordinance 2021-24. This ordinance proposes changes to the covenants and restrictions for the Cressmoor Estates PUD zoning classification.

zoningordinancepudland-use
✓ Decided: Council adopts amended Cressmoor Estates PUD covenants (6-1)

The Hobart Common Council held a special meeting and voted 6-1 to amend and adopt Ordinance 2021-24, which updates covenants and restrictions for the Cressmoor Estates planned unit development (PUD) south of 37th Avenue, west of Lake Park Avenue, and east of Wisconsin Street. The amendments add HOA responsibilities for townhome snow removal and landscaping, revise foundation landscape plans, and change a section title. The amended ordinance will go back to the Plan Commission for ratification before final approval.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
to approve and ratify. If they do not approve, they will come back to the Council for a final decision. Attorney McCarthy stated the amendments would go back to the Plan Commission to review the…
6 yea
Huddlestun yea · Maggio yea · Vinzant yea · Wells yea · Claussen yea · Waldrop yea
motion to adopt Ordinance 2021-24 as amended. Roll Call Vote taken
6 yea
Huddlestun yea · Maggio yea · Vinzant yea · Wells yea · Claussen yea · Waldrop yea
Mon Nov 8, 2021

Board of Park Commissioners

Board of Park Commissioners to discuss 2022 fee adjustments

The Board of Park Commissioners is meeting to review department reports and address new business. The primary item for consideration is the adjustment of fees for 2022.

parks-and-recreationfeescity-government
✓ Decided: Park board approves 2022 fee increases for rentals and bricks

The Board of Park Commissioners approved a 2022 fee schedule that raises nonresident field rental prices, sets a flat cleaning fee, removes the weeknight rate, increases the meeting rate, and doubles memorial brick prices. The board also approved the agenda, minutes, and register of claims as amended, and heard reports on park projects and community events.

Thu Nov 4, 2021

Plan Commission

Plan Commission to review manufacturing expansion, subdivision plats, and rezoning

The Hobart Plan Commission will hold public hearings and site plan reviews on several property requests, including a manufacturing facility expansion, a 2-lot subdivision, a rezoning from PUD to B-3, and multiple subdivision plats. They will also discuss proposed uses for the vacant Carson's in the mall, including a revised Chick-fil-A site plan.

plan-commissionzoningsubdivisionrezoningmanufacturingsite-plancommercial
✓ Decided: Plan Commission approves D.R. Horton's 197-lot Cressmoor Estates preliminary plat

The Hobart Plan Commission granted preliminary plat approval for the 197-lot Cressmoor Estates subdivision, contingent on modifications to covenants, road design, and townhome count. The commission also approved site plans for a concrete recycling facility, a manufacturing expansion, a 2-lot subdivision, and several other projects. One petition was tabled.

Thu Nov 4, 2021

Board of Zoning Appeals

Board of Zoning Appeals discusses residential variances

The Board will consider a use variance for a 2-family attached dwelling at 17 E. 3rd St. and a developmental standards variance regarding a front yard fence at 6545 Grand Blvd.

zoninghousingresidentialfences
✓ Decided: BZA recommends 2-family dwelling variance, approves 350-ft fence

The Hobart Board of Zoning Appeals voted 4-0 to give a favorable recommendation to the Common Council for a use variance at 17 E. 3rd St. to permit a 2-family attached dwelling, after a fire caused water damage and renovation costs exceeded the 10% threshold. The board also approved a developmental standards variance for a 350-foot fence at 6545 Grand Blvd., contingent on a signed trustee document and verification of state right-of-way. Both public hearings were closed without comments.

Wed Nov 3, 2021

Board of Public Works and Safety

Board to consider development agreements for property at 2400 E. 69th Ave.

The Hobart Board of Public Works and Safety will hold a regular meeting with routine items like minutes, claims, and agenda approval. They will also discuss several property maintenance and unsafe building cases, tree removal requests, and a sidewalk installation request. The most consequential items are two resolutions to approve development agreements with 2100 E. 69th Avenue Indiana, LLC for real and personal property at 2400 E. 69th Ave.

development-agreementpublic-workssafetyproperty-maintenancesidewalktree-removal
✓ Decided: Board approves emergency police hiring, waives application fee

The Board of Public Works and Safety approved an emergency police hiring under Rule 3, waiving the application fee, and approved two development agreements for property at 2400 E. 69th Ave. It also imposed a $500 fine on a property owner for a slope violation and continued several property maintenance cases. The city was awarded a $990,000 Community Crossings grant.

Wed Nov 3, 2021

City Council

Council considers tax abatements and zoning changes for industrial sites

The City Council will hold public hearings regarding real and personal property tax abatements for 2100 E. 69th Ave. The body is also reviewing zoning amendments for properties including Albanese Candy and a site near 69th Ave and Mississippi St.

zoningtax-abatementeconomic-developmentmunicipal-codebudget
✓ Decided: Council approves tax abatements, zoning changes, and 2022 tax anticipation warrants

The Hobart City Council approved multiple resolutions and ordinances, including tax abatements for Project Solar at 2400 E. 69th Ave., zoning changes for Albanese Candy and Becknell Investors, and an ordinance amending off-street parking regulations. The council also passed a 2022 tax anticipation warrant ordinance and adopted the 2022-2023 Capital Improvement Plan. A motion to direct city departments to stop denying permits based on unpaid tap-on fees was withdrawn after the city attorney advised against discussion due to litigation.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Mr. Claussen, seconded by Mr. Kopil to Adjourn the meeting. Roll Call Vote taken
3 yea
Kopil yea · Wells yea · Claussen yea
Wed Nov 3, 2021

Redevelopment Commission

Hobart Redevelopment Grant Committee to meet Nov. 3

The Grant Committee of the Hobart Redevelopment Commission is holding a meeting on Wednesday, November 3, 2021, at 10:00 a.m. in the City Council Chambers at Hobart City Hall. The agenda contains only the meeting notice and location; no specific agenda items are listed.

redevelopmentgrant-committeemeeting
✓ Decided: Redevelopment Commission discusses 2022 funding requests

The Hobart Redevelopment Commission met on November 3, 2021, and discussed funding requests for 2022, including items related to the City of Hobart, the Center of Workforce Innovations, and the Hobart Digital Literacy Initiative. No formal votes or decisions were recorded in the minutes.

Tue Nov 2, 2021

City Council

Council considers zoning amendment for Cressmoor Estates

The Common Council is holding a special meeting to address a tabled ordinance. The body will consider amendments to covenants and restrictions for a specific PUD zoning classification.

zoningordinanceland-usecressmoor-estates
✓ Decided: Council advances Cressmoor Estates covenant amendment on first reading

The Hobart Common Council voted 7-0 to remove Ordinance 2021-24 from the table and pass it on first reading. The ordinance amends covenants and restrictions for certain parcels in the Cressmoor Estates PUD, with conditions recommended by the Plan Commission. A second reading is scheduled for a special meeting on November 9, 2021.

Tue Oct 26, 2021

Sanitary and Stormwater District Board

✓ Decided: Board approves 5% stormwater rate hike for 3 years, sets hearing

The Board approved a declaratory resolution for new stormwater rates, setting a public hearing for November 23, 2021. The rate increase was changed from 5% for 5 years to 5% for 3 years. The Board also granted a 90-day extension and removed the $9,500 cap for Stephen Burton's sewer connection, and authorized advertising for a guaranteed savings contract.

Wed Oct 20, 2021

Board of Public Works and Safety

Board to discuss police order, property violations, tree requests

The Hobart Board of Public Works and Safety is meeting to handle routine approvals and several property-related items. They will discuss a tabled police general order, review property maintenance violations, and consider requests for trees and banners in city easements.

policeproperty-maintenancetreeseasementspublic-safety
✓ Decided: Board approves native tree planting in city easement at 1205 Lincoln St.

The Board approved a request to plant native trees in a city easement at 1205 Lincoln St., with conditions to coordinate with Public Works and maintain 10-12 feet from laterals. They also approved a temporary banner for a job fair, landscape plans for a subdivision corner, and continued several property maintenance and unsafe building cases to the next meeting.

Wed Oct 20, 2021

City Council

Hobart City Council to consider zoning changes for Albanese Candy and other sites

The Common Council will discuss several zoning amendments and a use variance for a fireworks facility. The meeting also includes a second reading of the 2022 budget appropriations and tax rates.

zoningbudgettax-ratesland-useordinances
✓ Decided: Council denies fireworks use variance, adopts 2022 budget

The Hobart City Council denied a use variance for a proposed fireworks retail facility at 3821 W. 37th Ave., following an unfavorable recommendation from the BZA and a resident petition. The council also adopted the 2022 budget ordinance and passed several other ordinances on first reading, including zoning changes and a budget transfer.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Mr. Vinzant, seconded by Mr. Claussen, to adjourn the meeting. 6
6 yea
Kopil yea · Maggio yea · Vinzant yea · Wells yea · Claussen yea · Waldrop yea
Tue Oct 19, 2021

Historic Preservation Commission

Commission to consider sign removal at 517 East Third Street

The Hobart Historic Preservation Commission will meet to review a request for a Certificate of Appropriateness regarding sign removal. The agenda also includes a discussion on Certified Local Government status.

historic-preservationzoningsignagehobart
✓ Decided: Commission approves demolition of historic house at 1.5 E. 5th St.

The Hobart Historic Preservation Commission approved a Certificate of Appropriateness for the demolition of a house at 1.5 E. 5th St., despite objections from the public. The commission also discussed and approved other permits, including a fence and a new structure, and reviewed the status of the city's historic preservation efforts.

Mon Oct 18, 2021

Redevelopment Commission

Redevelopment Commission to approve multiple 69th Avenue project payments and change orders

The Hobart Redevelopment Commission is meeting to handle routine financial approvals, including change orders, pay estimates, and grant reports. Key items include multiple payments and change orders for the 69th Avenue Improvement Project, as well as several grant-related approvals for education and workforce training programs.

redevelopmentinfrastructuregrantspublic-worksbudget
✓ Decided: RDC approves $633,683 in claims, including $453,496 for 69th Ave project

The Hobart Redevelopment Commission approved a register of claims totaling $633,683.24, including pay estimate #11 for the 69th Avenue improvement project. The commission also approved multiple grant payments and extensions, including a $1,000 awning grant, an $18,172.95 reimbursement to School City of Hobart, and a $6,470.84 reimbursement to Merrillville Community School Corporation. A 90-day facade grant extension for 347 Main Street was approved 4-1, while a revised grant amount for the same property was tabled.

Thu Oct 14, 2021

Hobart Fire Civil Service Commission

Fire Commission to discuss acting officer duties rule

The Hobart Fire Civil Service Commission is holding a regular meeting. The main item of business is a discussion and interpretation of Section I-9 on page 61 of the Commission Rules regarding the duties of acting officers, as requested by AC Dave Tinsley. The rest of the agenda consists of routine procedural items.

firecivil-servicecommissionrulesacting-officers
✓ Decided: Fire Commission adopts rule on acting officer selection to limit travel

The Hobart Civil Service Fire Commission approved a motion interpreting Commission rule II-9, stating that when a station requires an acting officer, preference will be given to the person already at that station to reduce travel. The commission also discussed the acting officer list and agreed to work on defining how officers get on and off that list. No other substantive decisions were made.

Wed Oct 13, 2021

City Council

Council considers tax abatements for manufacturing site at 2400 E. 69th Ave.

The Common Council is meeting to discuss designating a specific area as an Economic Revitalization Area. This designation would allow for real and personal property tax abatements for a manufacturing building.

tax-abatementeconomic-developmentmanufacturingzoning
✓ Decided: Council approves two tax abatements for manufacturing facility at 2400 E. 69th Ave.

The Hobart Common Council held a special meeting and unanimously approved two resolutions designating an Economic Revitalization Area for real and personal property tax abatements for a manufacturing building at 2400 E. 69th Ave. The petitioner, 2100 E. 69th Avenue Indiana, LLC, expects to create 73 new jobs. Public hearings for both abatements are set for November 3, 2021.

Tue Oct 12, 2021

Sanitary and Stormwater District Board

✓ Decided: Hobart sanitary board discusses stormwater rate study, no rate change approved

The board heard a presentation from Baker Tilly on a stormwater rate study but took no action on rates, with members requesting more data and options. They approved the September minutes, the agenda, and appraisals for the entire 37th Avenue property. No rate increase was approved or denied; discussion only.

Mon Oct 11, 2021

Board of Park Commissioners

Hobart Board of Park Commissioners to discuss 2022 fee changes

The Board of Park Commissioners will meet to review department reports and discuss fee changes for 2022. The meeting also includes the approval of the September 13, 2021, meeting minutes and the register of claims.

parksfeesmunicipal-government
✓ Decided: Park board approves 2022 fee increases for rentals and fields

The Board of Park Commissioners approved new 2022 pricing for all park rentals, including added nonresident fees and deposits for field rentals, to cover rising costs. The board also accepted the agenda, minutes, and register of claims, and heard reports on the master plan, upcoming events, and a bench donation from Friends of Robinson Lake.

Thu Oct 7, 2021

Plan Commission

Plan Commission to hear rezoning, PUD amendments, and site plans

The Hobart Plan Commission will hold public hearings and site plan reviews on several properties, including a rezoning request for 49.81 acres near US 30 and Grand Blvd., amendments to a PUD for a proposed light manufacturing building, and a zoning ordinance change to increase allowed off-street parking vehicle weight. The commission will also review a site plan for a concrete recycling facility and a replat for a 197-lot subdivision. The meeting includes discussion items on subdivision barriers and a restaurant replacement shed.

zoningrezoningpudsite-plansubdivisionparking
✓ Decided: Plan Commission recommends PUD rezoning for 49.81-acre site on E. Lincoln Hwy.

The Hobart Plan Commission recommended approval of a rezoning to PUD for a 49.81-acre property at 5441 E. Lincoln Hwy. (Petition 21-10A) and approved a site plan and preliminary plat for a 600,000 sq. ft. industrial building at 69th Ave. & Mississippi St. (Petitions 21-34, 21-34A, 21-34B). The commission also tabled a site plan review for a concrete recycling facility and deferred action on a 197-lot subdivision replat.

Thu Oct 7, 2021

Board of Zoning Appeals

BZA to consider fireworks facility and concrete recycling extension

The Board of Zoning Appeals will hold public hearings on three variance requests and one extension. The board is deciding on land use and developmental standards for properties on W. 37th Ave, E. 3rd St, and W. 1st Pl.

zoningvariancesland-usepublic-hearings
✓ Decided: Board grants 2-month extension for concrete recycling facility permit

The Hobart Board of Zoning Appeals approved a 2-month extension for a conditional use permit allowing a concrete recycling facility at 337 N. Liverpool Rd. It also approved a variance for an asphalt driveway at 1314 W. 1st Pl., tabled a use variance for a 2-family dwelling at 17 E. 3rd St., and gave an unfavorable recommendation to a proposed fireworks retail facility at 3821 W. 37th Ave.

Wed Oct 6, 2021

Board of Public Works and Safety

Board to discuss police order, property violations, unsafe buildings

The Hobart Board of Public Works and Safety is meeting to handle routine approvals and discuss several ongoing property and safety issues. Items include a tabled discussion on a police general order, updates on property maintenance violations and unsafe buildings, and a request for tree removal.

policeproperty-maintenanceunsafe-buildingstreespublic-workssafety
✓ Decided: Board denies tree removal at 451 N. Lawrence St. per arborist

The Board of Public Works and Safety denied a request for city tree removal at 451 N. Lawrence St. after the city arborist found the tree not dead, dying, or hazardous. The Board also accepted a warranty deed and temporary highway easement for the Colorado Street Project, Parcel 22, and continued several property maintenance and unsafe building cases to future meetings. The meeting was held with two members present and one absent.

Wed Oct 6, 2021

City Council

City Council to consider 2022 budget appropriations and tax rates

The Common Council will hold a second reading of the 2022 budget appropriations and tax rates. The body will also discuss hiring provisions for police and fire officers and COVID-19 premium pay for essential employees.

budgettax-ratespolicefirecovid-19zoning
✓ Decided: Council adopts police/fire hiring and COVID premium pay ordinances

The Hobart Common Council adopted two ordinances: one allowing highly qualified and lateral transfer hiring for police and firefighters, and another establishing COVID-19 premium pay for essential employees funded by the American Rescue Plan. Both were passed unanimously on first and second reading after suspending rules. The 2022 budget ordinance was tabled to October 20 due to a notice issue.

Wed Sep 29, 2021

Maria Reiner Center Board

Maria Reiner Center board to review finances, events, 501c3 status

The Maria Reiner Center Board of Directors is holding a regular meeting to approve minutes and claims, review financial reports, and discuss the executive director's report. The report covers upcoming events, including a Veterans Day breakfast and holiday market, and a 501c3 discussion with the Legacy Foundation. The agenda is largely routine, with no major policy decisions or contracts listed.

board-meetingfinanceseventsnonprofitvolunteers
✓ Decided: Board forms subcommittee to review 501c3 status documents

The board approved minutes, agenda, claims totaling $2,537.54, and the financial report showing $90,913.83. A subcommittee of four members was formed to review 501c3 documents provided by the Legacy Foundation, with a decision expected by year-end. The board also discussed hiring a new bus driver and a potential grant for bus maintenance.

Tue Sep 28, 2021

Sanitary and Stormwater District Board

✓ Decided: Board approves $965,990 engineering contract for lift station and force main

The Hobart Sanitary District Board approved an amended engineering services contract with Butler, Fairman and Seufert (BF&S) for the redundant force main and main lift station, with a preliminary not-to-exceed amount of $965,990. The board also approved soliciting bids for 2022 green infrastructure maintenance based on a completed Cardno assessment. Minutes from September 14 and the agenda were approved, and routine financial reports and invoices were accepted.

Wed Sep 22, 2021

Contractor's Licensing Board and Registration

Hobart contractor licensing board meeting cancelled for Sept. 22

The Contractor's Licensing Board meeting scheduled for September 22, 2021, has been cancelled due to a lack of new business items. No decisions or discussions will take place at this meeting.

contractorslicensingmeeting-cancellationhobart
Tue Sep 21, 2021

Historic Preservation Commission

Hobart Historic Preservation Commission meeting cancelled

The September 21, 2021 meeting of the Hobart Historic Preservation Commission is cancelled. The next meeting is scheduled for October 19, 2021.

historic-preservationmeeting-cancelled
Mon Sep 20, 2021

Redevelopment Commission

Redevelopment Commission to review TRAX, 69th Avenue projects and grants

The Hobart Redevelopment Commission is meeting to discuss and potentially approve items related to ongoing projects, including the TRAX project and the 69th Avenue Improvement Project. They will consider pay estimates and change orders for the road project, as well as a 2022 education and workforce training grant and the appointment of a grant committee. The agenda also includes routine approvals of minutes, treasurer's report, and claims registers.

redevelopmenttrax69th-avenueroadsgrantsclaims
✓ Decided: RDC approves $340K pay estimate for 69th Avenue project, tables change order

The Hobart Redevelopment Commission approved pay estimate #10 for the 69th Avenue Improvement Project in the amount of $340,281.80, and tabled change order #10 pending further cost details. The commission also approved the 2022 Education & Workforce Training Grant at $30,000, appointed a grant committee, and approved the register of claims totaling $345,917.60. All votes were unanimous (4-0).

Fri Sep 17, 2021

Plan Commission

Plan Commission to decide on 197-lot Cressmoor Estates subdivision

The Hobart Plan Commission is holding a special meeting with a single agenda item: a petition for a proposed 197-lot subdivision called Cressmoor Estates. The 81.48-acre site, zoned PUD, is located east of Wisconsin St., west of Lake Park Ave., and south of 37th Ave. The commission will discuss and potentially act on this request.

subdivisionzoningplan-commissionhousingdevelopment
✓ Decided: Hobart Plan Commission tables 197-lot Cressmoor Estates subdivision after 4-4 tie

The Hobart Plan Commission voted 4-4 on a motion to grant preliminary plat approval for the proposed 197-lot Cressmoor Estates subdivision, so the motion failed. The commission then voted 8-0 to table the petition. The vote followed concerns from City Engineer Phil Gralik that the design violated the Thoroughfare Plan, and discussion about traffic, driveway access, and lot coverage.

Wed Sep 15, 2021

Board of Public Works and Safety

Board to discuss HPD General Order 19 and property violations

The Hobart Board of Public Works and Safety will hold a regular meeting, including approval of claims and minutes. They will discuss unfinished business such as a tabled discussion on HPD General Order 19, property maintenance violations, a code violation for a kennel, and an unsafe building update. New business includes tree assessment/removal and planting requests, plus signing of plats for a subdivision and a vacation.

public-workssafetyproperty-maintenancecode-violationstreessubdivisionplat
✓ Decided: Board authorizes structural engineer for unsafe Cagney's sidewalk

The Board of Works approved hiring a structural engineer to assess the unsafe sidewalk in front of Cagney's at 236 Main St. after the owner did not respond to emails. The Board also authorized the Mayor to decide on purchasing a used rear loader garbage truck for $71,000 to address commercial trash pickup delays. Several property maintenance and code violation cases were continued or closed.

Wed Sep 15, 2021

City Council

Hobart City Council to hold public hearing on 2022 budget and tax rates

The Common Council is meeting to conduct a public hearing on the 2022 budget and tax rates. The body is also considering several ordinances regarding city employee and official salaries for 2022.

budgettax-ratessalarieszoningpublic-hearing
✓ Decided: Council adopts 2022 salary ordinances for city employees, police, fire, elected officials

The Hobart Common Council adopted six ordinances setting 2022 salaries for city officers and employees, police and fire sworn personnel, elected officials, and municipal utility officers, all on second reading. The 2022 budget ordinance (2021-30) had a public hearing with no comments and was set for adoption on October 6. A use variance for an online retail business at 840 S. Lake Park Ave. was approved with conditions, and two ordinances were passed on emergency second reading: transferring 2021 budget appropriations and vacating a platted median in Cressmoor Estates.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Motion by Mr. Waldrop, seconded by Mr. Kopil to adopt Ordinance 2021-25 as presented, Discussion followed: Mr. Vinzant proposed requiring employees to get the COVID vaccine in order to receive an…
5 yea
Kopil yea · Huddiestun yea · Maggio yea · Vinzant yea · Waldrop yea
Motion by Mr. Kopil, seconded by Mr. Maggio, to adopt Ordinance 2021-26 as presented. Roll Call Vote taken. 5
5 yea
Kopil yea · Huddlestun yea · Maggio yea · Vinzant yea · Waldrop yea
Motion by Mr. Kopil, seconded by Mr.. Waldrop, to adopt Ordinance 2021-27 as presented. Roll Call Vote taken. 5
5 yea
Kopil yea · Huddleston yea · Maggio yea · Vinzant yea · Waldrop yea
that the Council consider giving increases to Board/Commission members as they have not received an increase in many years. Mr. Huddlestun noted the need to keep moving forward with increases or…
4 yea
Kopil yea · Huddlestun yea · Maggio yea · Waldrop yea
Motion by Mr. Vinzant, seconded by Mr. Huddlestun, to adopt Ordinance 2021-29 as presented. Roll Call Vote taken, 5
5 yea
Kopil yea · Huddlestun yea · Maggio yea · Vinzant yea · Waldrop yea
Tue Sep 14, 2021

Sanitary and Stormwater District Board

✓ Decided: Board rejects all bids for 37th Avenue property, denies late fee waiver

The Hobart Sanitary District Board denied a request from Element Hobart/Tricap Chicago to waive $134.96 in late fees, and rejected all proposals for the 37th Avenue sanitary property because the minimum price was not met. The board provisionally approved a point repair award to H&G Underground (cap $12,000), approved entering negotiations with Wessler Engineering for the MS4 program, approved a $14,100 check valve repair, and authorized an evaluation of concrete failure at Lift Station #1. All votes were 5-0.

Mon Sep 13, 2021

Board of Park Commissioners

Hobart Board of Park Commissioners to discuss court and flooring repairs

The Board of Park Commissioners will meet to review department reports and address new business. The agenda includes discussions regarding repairs to pickleball courts and flooring at the Community Center.

parksmaintenancerecreationcommunity-center
✓ Decided: Park board approves claims, hears ARP funds for community center and Brickie Bowl

The Board of Park Commissioners approved the agenda, minutes, and register of claims as amended, all by unanimous 3-0 votes. The register included a new aerator fountain and concrete for ADA-compliant memorial benches. The board heard that the Parks Department will receive a large portion of American Rescue Plan funds for upgrades at the community center and Brickie Bowl, and discussed potential fee changes and community center flooring repairs, but took no action on those items.

Thu Sep 9, 2021

Hobart Fire Civil Service Commission

Hobart Fire Civil Service Commission meeting cancelled

The regularly scheduled Hobart Civil Service Fire Commission meeting on September 9, 2021, has been cancelled. No business will be conducted at this meeting.

firecivil-servicemeeting-cancelled
Thu Sep 2, 2021

Plan Commission

Plan Commission to vote on concrete recycling site plan review

The Hobart Plan Commission is meeting to consider four tabled items, including a site plan review for an existing concrete recycling operation, a replat for a subdivision, a replat of a 197-lot subdivision, and a public hearing on vacating a median. All items were previously tabled and are up for decisions or further discussion.

zoningplanningsubdivisionpublic-hearingrecycling
✓ Decided: Plan Commission tables Cressmoor Estates 197-lot subdivision over traffic concerns

The Hobart Plan Commission tabled the Cressmoor Estates preliminary/final plat for a 197-lot subdivision after the city engineer raised concerns about driveway spacing and traffic on Cressmoor Blvd. The commission also granted final plat approval for a replat at 1165 W. 37th Ave., recommended a 2-month extension for a conditional use at 327/337 Liverpool Rd., and tabled the site plan for the same property. Several minor site plan determinations were made for St. Mary Medical and Dunkin Donuts, and a favorable recommendation was given for vacating a median on West Rand St.

🏢 Building at this address: 4 m tall
Thu Sep 2, 2021

Board of Zoning Appeals

Hobart Board of Zoning Appeals to review three variance requests

The Board of Zoning Appeals will hold public hearings for three property variance requests. These include requests to exceed height and size limits for structures and a request to operate a business from a home accessory structure.

zoningvariancespublic-hearingsland-use
✓ Decided: Board approves 3 variances including online retail use

The Hobart Board of Zoning Appeals approved all three variance requests on the agenda. Two developmental standards variances for accessory structures were approved unanimously, and a use variance for an online retail business received a favorable recommendation to the Common Council with a 4-1 vote. All approvals included conditions prohibiting commercial use or residential living in the accessory structures, except the retail use which was allowed with specific limits.

Wed Sep 1, 2021

Board of Public Works and Safety

Board to discuss HPD General Order 19, signs, and paving requests

The Hobart Board of Public Works and Safety is meeting to handle routine business including claims approval and minutes, and to discuss several items: a tabled discussion on HPD General Order 19, a request for no semi truck and speed limit signs on 38th Avenue, and a request to pave right-of-way along Front Street and city property at 66 N. Main Street.

public-safetypoliceroadssignagepavingpublic-works
✓ Decided: Board approves right-of-way paving for Front St. and Main St.

The Board approved a request to pave an 8' x 110' right-of-way along Front St. and a 15.5' x 62' area on city property at 66 N. Main St., related to 55 N. Center St. The board also discussed a resident's complaint about semi-trucks and speeding on 38th Ave., with plans to contact the trucking company and possibly install speed bumps. A tabled discussion on HPD General Order 19 remained on the table.

Wed Sep 1, 2021

City Council

Hobart City Council to discuss 2022 budget and COVID-19 recovery grants

The Common Council is reviewing the 2022 budget appropriations and tax rates. The body is also considering a local fiscal recovery grant plan for ARP Coronavirus funds and rules regarding large vehicle parking in residential zones.

budgetparkingcovid-19salarieszoning
✓ Decided: Council adopts truck parking ban, ARP fund plan, and 2022 salary ordinances

The Common Council adopted Ordinance 2021-22, banning large trucks (over 11,000 lbs) from parking near residential zones, and forwarded it to the Plan Commission to align zoning. It also approved Ordinance 2021-23, appropriating ARP coronavirus relief funds for 2021. The Council passed first readings of the 2022 salary ordinances for civilian employees, police, firefighters, and elected officials, with Council members' pay kept at $13,750. The 2022 budget ordinance was approved on first reading with a public hearing set for September 15.

🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Motion by Mr. Claussen, seconded by Mr. Huddlestun, to approve Ordinance 2021-25 on first reading. Discussion followed regarding staffing shortages and the need to fairly compensate the employees…
5 yea
Kopil yea · Huddlestun yea · Maggio yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded by Mr. Maggio to approve Ordinance 2021-26 on first reading. The Council noted the same discussion should be considered as with the prior ordinance. Roll Call Vote…
5 yea
Kopil yea · Huddlestun yea · Maggio yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded by Mr. Maggio to approve Ordinance 2021-27 on first reading. The Council noted the same discussion should be considered as with the prior ordinance. Roll Call Vote…
5 yea
Kopil yea · Huddleston yea · Maggio yea · Claussen yea · Waldrop yea
[context] 4
4 yea
Kopil yea · Wells yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded. by Mr. Huddlestun, to approve Ordinance 2021-29 on first reading. Roll Call Vote taken. 5
5 yea
Kopil yea · Huddlestun yea · Maggio yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded by Mr. Kopil, to suspend the rules, declare an emergency and proceed with the second reading of the Ordinance this evening. Roll Call Vote taken. 5
5 yea
Kopil yea · Huddlestun yea · Wells yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded by Mr. Wells, to adjourn the meeting. 5
5 yea
Huddlestun yea · Maggio yea · Wells yea · Claussen yea · Waldrop yea
Tue Aug 24, 2021

Sanitary and Stormwater District Board

✓ Decided: Board authorizes RFQ for force main and lift station improvements

The Hobart Sanitary District Board authorized City Engineer Phil Gralik to issue a Request for Qualifications (RFQ) for the force main and lift station improvements project, a step toward selecting an engineering firm. The board also approved several routine items, including minutes, agenda, invoices, an emergency repair, and a printer purchase, all by unanimous 5-0 votes. Discussions covered the Stinky Creek design grant, Duck Creek project, and a potential shared IT/GIS position with the city, but no formal action was taken on those items.

Wed Aug 18, 2021

Maria Reiner Center Board

Maria Reiner Center board to discuss 501c3 status with Legacy Foundation

The Maria Reiner Center Board of Directors will hold its rescheduled August regular meeting, covering routine items like minutes, claims, and financial reports. A key discussion involves 501c3 status with guest Kelly Anoe of the Legacy Foundation, along with updates on recent and upcoming events.

board-meetingnonprofit501c3eventsfinancial-reports
✓ Decided: Board approves minutes, agenda, claims, and financial report

The Maria Reiner Center Board approved the July 28 minutes, the meeting agenda, claims totaling $558.64, and the financial report showing $91,796.89 in cash and investments. The board also discussed a potential endowment fund with the Legacy Foundation, but no formal decision was made on that topic.

Wed Aug 18, 2021

Board of Public Works and Safety

Board to consider demolition, police order, GIS upgrade, and street projects

The Hobart Board of Public Works and Safety will hold a regular meeting with several continued items, including a demolition request, discussion of a police general order, and cost-sharing for a GIS software upgrade. New business includes accepting a warranty deed, approving change orders for a streetscape project, signing plats for a subdivision, and granting an access easement to NIPSCO.

demolitionpolicegisstreetscapeeasementsubdivision
✓ Decided: Board approves demolition, GIS upgrade, and settlement

The Board approved several items, including authorizing demolition at 1317 South Lake Park with the lowest bid of $14,700 plus tree removal, approving a cost-sharing agreement with Hobart School District for an ESRI GIS upgrade (60% HSD, 40% City), and approving a settlement in Rogers vs. COH/Gonzalez. They also approved change orders for the 3rd/Center St. Streetscape totaling $86,708.61, and tabled discussion on HPD General Order 19 to September 1, 2021.

Wed Aug 18, 2021

City Council

Hobart Council to set 2022 salaries, mull County Line Road pact

The Hobart Common Council will hold its regular meeting on August 18, 2021, covering unfinished business, new ordinances, and requests. Key items include a use variance for cosmetics manufacturing, an interlocal agreement with Portage for County Line Road reconstruction, and multiple ordinances setting 2022 salaries for city employees, police, firefighters, and elected officials. The agenda also includes a public hearing set for September 1 on an ARP grant fund appropriation.

zoningbudgetsalariesroadspublic-hearingtax-abatement
✓ Decided: Council approves FOG inspector position, truck parking limit change

The Hobart Common Council approved several items, including a new FOG Inspector position in the Building Department, a use variance for cosmetics manufacturing, an interlocal agreement with Portage for County Line Road, and a waiver for Albanese Confectionery's tax abatement filing. The council also amended a truck parking ordinance to raise the weight limit to 16,000 pounds and passed it on first reading. Several 2022 salary ordinances and a PUD amendment were tabled for further review.

Tue Aug 17, 2021

Historic Preservation Commission

Commission reviews facade renovation changes at 345 and 347 Main Street

The Hobart Historic Preservation Commission will vote on two requests for Certificates of Appropriateness to modify existing facade renovations at 345 Main Street and 347 Main Street. The meeting also includes the approval of July 20, 2021 minutes and a discussion on Certified Local Government status. No specific dollar amounts or contract values are listed in the agenda.

historic-preservationzoningfacade-renovationmain-street
✓ Decided: Commission approves facade renovation with transom windows and side door changes

The Hobart Historic Preservation Commission approved a certificate of appropriateness (COA) for a facade renovation at 345 Main Street, allowing replacement of storefront windows and doors, installation of transom windows, and changes to the side entry including removal of a door and installation of a brick kickboard with new windows. The approval was made with specific notes on the three front transom windows and the far east entry changes. The commission also approved the minutes from July 20, 2021, and received an update on the city's Certified Local Government status.

Mon Aug 16, 2021

Redevelopment Commission

Hobart Redevelopment Commission reviews infrastructure and grant reports

The Commission will review status reports for the TRAX Project and the 69th Avenue Improvement Project. The meeting includes decisions on several change orders for road and streetscape projects and a grant report for Merrillville Community School Corporation.

infrastructuregrantsroadsstreetscapehobart
✓ Decided: RDC approves $108,608 pay estimate for 69th Avenue project

The Hobart Redevelopment Commission approved multiple payments and change orders for ongoing construction projects, including a $108,608.23 pay estimate for the 69th Avenue Improvement Project and four change orders for the 3rd Street Streetscape project. The commission also approved a $110,458.23 register of claims and a $40,464.22 bond requisition for engineering and legal services. All votes were unanimous (4-0).

Thu Aug 12, 2021

Hobart Fire Civil Service Commission

Fire commission to certify promotion lists

The Hobart Fire Civil Service Commission is holding a regular meeting to handle routine administrative matters, including approving the agenda and minutes. The only substantive new business is the certification of promotion lists for the fire department.

firecivil-servicepromotionsadministration
✓ Decided: Fire commission certifies promotion lists for 2 years

The Hobart Civil Service Fire Commission approved an invoice for promotional testing services and certified promotion lists for Battalion Chief, Director of Fire Prevention, and Lieutenant tests for a two-year period. All motions passed unanimously (3-0). No other substantive business was conducted.

Tue Aug 10, 2021

Sanitary and Stormwater District Board

✓ Decided: Board approves GLRI grant application for Duck Creek restoration

The Hobart Sanitary District Board approved submitting a GLRI grant application for Phase I and II of the Duck Creek Restoration Project, with a due date of August 20, 2021. The board tabled a reimbursement request from Oakwood Properties (Bob McGinnis) for a water leak, pending further documentation. Other items were discussed but not voted on, including the Red Zone project, SCADA project, and 73 Avenue project updates.

Mon Aug 9, 2021

Board of Park Commissioners

Hobart Board of Park Commissioners holds regular meeting

The Board of Park Commissioners met to conduct regular business. The agenda consists of procedural boilerplate items with no specific new business or decisions listed.

parksgovernmentprocedural
✓ Decided: Park board approves agenda, minutes, claims; consents to air B&B for conference

The Board of Park Commissioners approved the agenda, minutes, and register of claims as presented. They consented to the Park Director's plan to use an air B&B for the upcoming conference in Nashville instead of a hotel. No other substantive decisions were made; the meeting included reports and announcements.

Thu Aug 5, 2021

Plan Commission

Plan Commission to review site plans, plats, and PUD amendment

The Hobart Plan Commission will consider several site plans, final plats, and a PUD amendment, including a concrete recycling operation, additional storage buildings, and a large residential subdivision. They will also discuss an electronic attendance policy. Public hearings are scheduled for the D.R. Horton PUD amendment and replat.

plan-commissionsite-plan-reviewplat-approvalpud-amendmentpublic-hearingzoning
✓ Decided: Plan Commission recommends Cressmoor Estates PUD amendment to Council

The Hobart Plan Commission voted 6-0 to give a favorable recommendation to the Common Council for Petition 21-29, a proposed amendment to the Cressmoor Estates planned unit development (PUD) by D.R. Horton, contingent on amendments developed by the petitioner and approved by staff. The commission also approved site plans for a storage facility at 7190 Grand Blvd. and a loading area redesign at 3201 E. 83rd Pl., tabled a replat for the Cressmoor Estates subdivision (21-29A) and a site plan for a concrete recycling operation, and approved a final plat for Southlake Industrial Park. A motion to require concrete driveways in the PUD failed 2-4.

🏢 Building at this address: 4 m tall
Thu Aug 5, 2021

Board of Zoning Appeals

BZA to consider use variance for cosmetics manufacturing at 8201 Grand Blvd.

The Board of Zoning Appeals will hold public hearings for two variance requests. The board will also discuss an electronic attendance policy via BZA Resolution 2021-01.

zoningvariancesmanufacturingresidential-constructionpublic-hearings
✓ Decided: BZA recommends approval of cosmetics packaging facility variance

The Board of Zoning Appeals voted 3-0 to give a favorable recommendation to the Common Council for a use variance allowing a cosmetics and toiletries packaging facility at 8201 Grand Blvd. The board also approved a developmental standards variance for a second-floor addition at 412 Lake Shore Drive, and extended a conditional use for a property on N. Liverpool Rd. by two months. A resolution allowing electronic attendance for board members was also approved.

🏢 Building at this address: 7 m tall
Wed Aug 4, 2021

Board of Public Works and Safety

Board to review unsafe buildings, property violations, and fire truck donation

The Hobart Board of Public Works and Safety will hold a regular meeting to review and update several ongoing items, including unsafe building cases, property maintenance violations, a fire truck donation, and a police general order. They will also consider new requests for tree planting/removal, speed limit signs, an event easement, and a cost-sharing agreement for an ESRI license upgrade.

public-workssafetyunsafe-buildingsproperty-maintenancefire-truckpoliceeasementstechnology
✓ Decided: Board approves fire truck donation to Tradewinds

The Board of Public Works and Safety approved the donation of a fire truck to Tradewinds per a signed Letter of Understanding, and approved several other items including a tree planting, a performance contract, and an event use permit. Several matters were continued to future meetings, including a software upgrade and police order discussions. All votes were unanimous (3-0).

Wed Aug 4, 2021

City Council

Council to rezone 2.41 acres at Lincoln Hwy & Dakota St

The Hobart Common Council is holding its regular meeting with several items on the agenda. The most consequential item is the second reading of an ordinance to rezone 2.41 acres at the southwest corner of Lincoln Highway and Dakota Street from one PUD classification to another. The council will also consider an interlocal agreement with Porter County for road reconstruction, a budget transfer, and a new Building Department position.

zoningroadsbudgetpersonnelinterlocal-agreement
✓ Decided: Council approves County Line Road interlocal with Porter County

The Hobart City Council approved an interlocal agreement with Porter County for the reconstruction of County Line Road from US 6 to Cleveland Avenue, allowing right-of-way acquisition to proceed. The council also adopted a rezoning ordinance for a parcel at Lincoln Highway and Dakota Street, and passed several other ordinances, including a budget transfer and a new FOG Inspector position. A proposed ordinance restricting truck parking near residential areas was sent to the Ordinance Committee for further discussion.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Mr. Claussen, seconded by Mr. Kopil, to send this Ordinance to the Ordinance Committee for further discussion. 6
6 yea
Kopil yea · Maggio yea · Vinzant yea · Wells yea · Claussen yea · Waldrop yea
Wed Jul 28, 2021

Maria Reiner Center Board

Maria Reiner Center board to review budget, claims, and events

The Maria Reiner Center Board of Directors is holding a regular meeting to approve minutes and agenda, hear the executive director's report, and review financial reports and claims. The board will discuss the 501c3 status and budget, as well as upcoming events including Moose Bingo on August 14. The meeting is largely routine administrative business.

board-meetingbudgetnonprofiteventsfinancial-reports
✓ Decided: Board approves claims, financial report; plans 501c3 fundraising talk

The Maria Reiner Center Board approved the June 30 minutes, agenda, claims totaling $1,708.47, and the June financial report showing a negative cash balance of $8,666.33 but total cash and investments of $98,833.67. The board discussed setting up a 501c3 fundraising arm with help from the Legacy Foundation, scheduling a presentation for next month. Moose Bingo was set for August 14, and the next meeting was tentatively scheduled for August 18 at City Hall Council Chambers.

Wed Jul 28, 2021

Contractor's Licensing Board and Registration

Contractor's Licensing Board July meeting cancelled

The Contractor's Licensing Board meeting scheduled for July 28, 2021, has been cancelled due to a lack of new business items. The next regularly scheduled meeting will be held on September 22, 2021.

contractorslicensingmeeting-cancellation
Tue Jul 27, 2021

Sanitary and Stormwater District Board

Board to consider cost-share deadline extensions, truck purchase, budget

The Hobart Sanitary and Stormwater District Board will discuss and consider several items, including deadline extensions for three 80/20 cost-share projects, a replacement dump truck purchase, and the 2022 sanitary/storm water budget. The board will also review potential consultant solicitation, GIS software upgrades, and creek restoration projects.

budgetcontractsinfrastructurestormwatersanitarypublic-works
✓ Decided: Hobart sanitary board approves 2022 budget, sewer rate review

The Hobart Sanitary and Storm Water District Board approved the 2022 budget, a Baker Tilly rate study, and re-instituted utility shut-offs with proper notice. The board also granted 90-day extensions for three Fleming Street residents to connect to the city sewer main under the 80/20 cost share program.

Wed Jul 21, 2021

Board of Public Works and Safety

Board to consider wetland permit agreement, fire truck donation, and festival permits

The Hobart Board of Public Works and Safety will review property maintenance violations, consider a wetland permitting agreement for Colorado St. at US30, and discuss a police general order. They will also act on several requests for easement use and refunds, and approve performance agreements for the Lakefront Festival.

public-workssafetyeasementswetlandsfestivalpolicefire-truck
✓ Decided: Board approves $35,900 wetland permit agreement, denies tree removal

The Board approved a supplemental agreement for wetland permitting at Colorado St. and US 30, with the city covering 10% of the $35,900 cost. It also denied a request to remove a tree in an easement at 3845 E 34th Ln, denied a request to replace mailboxes with pavers at 6267 Oregon St, and approved several other items including a mailbox installation, easement paving, a fee refund, and festival performance agreements. Several matters were continued to the August 4 meeting.

Wed Jul 21, 2021

City Council

Hobart City Council discusses contractor licensing and rezoning

The City Council will address unfinished business including contractor licensing, the Capital Improvement Plan, and a rezoning request for 2.41 acres at Lincoln Highway and Dakota St. New business includes an ordinance to transfer appropriations within the 2021 MVH Fund budget.

zoninglicensingbudgetinfrastructuregovernment-finance
✓ Decided: Council approves 2021-2026 Capital Improvement Plan

The Hobart Common Council approved the 2021-2026 Capital Improvement Plan, which includes major projects like the Colorado Street/US 30 safety improvements, Delaware Street reconstruction, and a TRAX grant overpass. The council also passed first readings for a PUD rezoning and a budget transfer ordinance, and sent the contractor licensing ordinance back to committee.

Tue Jul 20, 2021

Historic Preservation Commission

Historic Preservation Commission to review two signage requests on Main Street

The Hobart Historic Preservation Commission will consider two applications for Certificates of Appropriateness for signage at 348 and 497 Main Street. The meeting includes routine items such as approval of minutes and public comment.

historic-preservationsignagecertificate-of-appropriatenessmain-street
✓ Decided: Commission approves two signage certificates for Main Street businesses

The Hobart Historic Preservation Commission approved two Certificates of Appropriateness for signage. The first, HHPC 21-11, approved a 48-inch aluminum composite sign for Hidden Trophy: Video Games and Collectibles at 348 Main Street. The second, HHPC 21-12, retroactively approved two pairs of black steel sign brackets for vinyl banners at the First Unitarian Church, 497 Main Street. Both properties are within the Lake George Commercial Historic District.

Mon Jul 19, 2021

Redevelopment Commission

Hobart redevelopment panel to review TRAX, 69th Avenue projects and grant reports

The Hobart Redevelopment Commission is meeting to approve the agenda, minutes, and treasurer's report, then hear status updates on the TRAX and 69th Avenue improvement projects. The commission will also consider approving education and workforce training grant reports from two school corporations and discuss 3-phase electric service for the 69th Avenue project.

redevelopment-commissiontrax-project69th-avenuegrantseducation-workforce-traininginfrastructure
✓ Decided: Hobart RDC approves claims, grants, and backs City route for 3-phase power

The Hobart Redevelopment Commission approved the register of claims totaling $23,783.40 and a bond requisition of $12,772.29. It approved grant reports for School City of Hobart and Merrillville's Welding Technology program, but tabled the Building Trades report pending more information. The Commission also endorsed the City's proposed route for 3-phase electric lines to serve Project MC, to be advocated at a meeting with NIPSCO.

Tue Jul 13, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board meeting cancelled for lack of business

The Sanitary District / Storm Water Management Board meeting scheduled for July 13, 2021, was cancelled due to lack of business. No items were discussed or decided.

meeting-cancellationsanitary-districtstormwater
Mon Jul 12, 2021

Board of Park Commissioners

Hobart Board of Park Commissioners holds regular meeting

The Board of Park Commissioners is meeting to conduct regular business. The agenda consists of procedural items and reports.

parksrecreationprocedural
✓ Decided: Hobart Park Board approves claims, minutes, agenda; hears reports

The Hobart Board of Park Commissioners approved the agenda, minutes, and register of claims as amended, all by 3-0 votes. The board heard reports from the Park Director on summer events and the pool, and from the School Board Representative on student awards. No old or new business was discussed.

Thu Jul 8, 2021

Hobart Fire Civil Service Commission

Hobart Fire Civil Service Commission meeting cancelled

The regularly scheduled Hobart Civil Service Fire Commission meeting on July 8, 2021, has been cancelled. No items will be discussed or decided at this meeting.

firecivil-servicemeeting-cancelled
Wed Jul 7, 2021

Board of Public Works and Safety

Board to review property violations, unsafe buildings, and approve agreements

The Hobart Board of Public Works and Safety is meeting to handle routine approvals and discuss several property-related items. They will review property maintenance violations, an unsafe building status, and a fire truck donation, as well as consider requests for signs, pavement, tree removal, and a mailbox placement. The board will also vote on a long-term maintenance agreement and a property conveyance.

public-worksproperty-maintenanceunsafe-buildingfire-truck-donationright-of-waytree-removallong-term-agreement
✓ Decided: Board approves guardrail, pavement, and subdivision mylars; denies two tree removals

The Board of Public Works and Safety approved a guardrail for Cleveland Ave., pavement in the right-of-way at 3717 E 82nd Ct. (with a maintenance agreement), a mailbox installation review, a long-term maintenance agreement for Hawk Crossing Phase 1, a warranty deed for the Colorado St. project, and the signing of mylars for Leonard's Subdivision and Smith Estates. Two tree removal requests (521 N. Indiana St. and 48 N. Linda St.) were denied unless homeowners remove the trees at their own expense. Several items were continued to future meetings, including property maintenance at 7197 Mississippi St., an unsafe building at 512 E. 4th & 347/349 Main St., and a fire truck donation from Tradewinds.

Wed Jul 7, 2021

City Council

Council to consider contractor and business licensing changes, capital plan update

The Hobart Common Council will hold its regular meeting, including unfinished business on a tabled contractor licensing ordinance and new business on a business licensing ordinance, a budget transfer, and an annual capital improvement plan update. The agenda is mostly routine, with no major standalone items.

licensingbudgetcapital-improvementordinancerecognition
✓ Decided: Council approves use variance for office space at 1741 W. Old Ridge Rd.

The Hobart City Council approved a use variance for a proposed multi-use office/professional space at 1741 W. Old Ridge Rd., with conditions recommended by the BZA. The council also adopted Ordinance 2021-17, transferring appropriations within the 2021 budget for the General Fund, Building Department, and Law Department. Several items were tabled, including the Capital Improvement Plan update and a PUD rezoning request, and a business licensing ordinance was sent back to committee.

Thu Jul 1, 2021

Plan Commission

Plan Commission to review 18 site plans, subdivisions, and PUD amendments

The Hobart Plan Commission will hold public hearings and site plan reviews for 18 items, including new restaurants, subdivisions, and amendments to planned unit developments. Several items were previously tabled and are being reconsidered. The agenda includes a mix of commercial and residential proposals.

zoningsite-plan-reviewsubdivisionpud-amendmentcommercial-developmentresidential-development
✓ Decided: Plan Commission approves multiple site plans, tables Cressmoor Estates revisions

The Hobart Plan Commission approved site plans for Chick-fil-A, Raising Cane's, a horse barn, a monument sign, and Target parking improvements, among others. It also granted final plat approvals for two subdivisions and a preliminary plat for a commercial subdivision. The commission tabled a major revision to the Cressmoor Estates residential development for further discussion.

🏢 Building at this address: 5 m tall
Thu Jul 1, 2021

Board of Zoning Appeals

Board of Zoning Appeals to review five variance requests

The Board of Zoning Appeals will hold public hearings to decide on five variance requests. These include requests for land use changes and deviations from developmental standards for residential and professional properties.

zoningvariancesland-usepublic-hearings
✓ Decided: Board approves all five variance requests, including office conversion and pole barn

The Hobart Board of Zoning Appeals approved all five petitions on the July 1, 2021 agenda, each by a 5-0 vote. This included a use variance for a professional office at 1741 W. Old Ridge Road, three developmental standards variances for fences, patios, and driveways, and two variances for a replacement pole barn at an equestrian facility. All decisions were forwarded as recommendations or approvals as recorded.

Wed Jun 30, 2021

Maria Reiner Center Board

Maria Reiner Center board to plan fundraisers and budget

The Maria Reiner Center Board of Directors is holding its regular monthly meeting. The board will discuss fundraiser ideas and the budget, along with operational items like the bus schedule and meal updates. They will also choose dates for upcoming events including an anniversary open house and a board sponsor breakfast.

budgetfundraisingeventstransportationmeals
✓ Decided: Board moves funds to safer account, sets 501C3 meeting

The board approved moving funds from high-risk accounts at People's Bank to an interest-bearing account, following a state audit recommendation. It also set a July 21 meeting to discuss becoming a 501C3 organization. Minutes, agenda, claims totaling $941.78, and the May financial report were all approved unanimously.

Tue Jun 22, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to weigh 2022 budgets, rate studies

The Hobart Sanitary District and Storm Water Management Board will meet to discuss and consider several operational and financial items, including the 2022 sanitary and storm water budgets, a storm water bond payment to Abonmarche Consultants, and 2022 rate studies by Baker Tilly. The board will also consider soliciting an MS4 RFQ, issues with a green infrastructure maintenance consultant, a lift station awning repair, a hydraulic breaker for the wastewater foreman, an RFP for the HSD property on 37th Avenue, and a copier maintenance agreement.

budgetstormwatersanitaryratesmaintenanceprocurement
✓ Decided: Board approves rate study, property sale RFP, and equipment purchases

The Hobart Sanitary District Board approved several items, including a rate study by Baker-Tilley, an RFP for the sale of district property, and purchases of a concrete breaker and awnings. The board also tabled a request to solicit an MS4 consultant until the next meeting. All votes were unanimous (4-0).

Mon Jun 21, 2021

Redevelopment Commission

Hobart Redevelopment Commission to review TRAX project, façade grant, and electric project

The Hobart Redevelopment Commission is holding a regular meeting to discuss several development items, including the TRAX project status, a façade grant application, and a 3-phase electric improvement project on 69th Avenue. The commission will also consider a resolution on electronic participation and approve claims registers.

redevelopmentgrantsinfrastructureelectricmeeting-policy
✓ Decided: Hobart RDC approves $6,012.50 facade grant for Brickies Gyros

The Hobart Redevelopment Commission approved a $6,012.50 facade grant for Brickies Gyros at 524 E. 3rd Street, covering half of the eligible $12,025 in front-elevation improvements. The commission also approved Resolution 2021-09, establishing a policy for electronic meeting participation, and approved the register of claims totaling $93,683.98. A $18,760.41 bond requisition for the 69th Avenue project was also approved.

Wed Jun 16, 2021

Board of Public Works and Safety

Board to consider food trucks at Arbor Lane Park and fire truck donation

The Hobart Board of Public Works and Safety is meeting to handle routine approvals and several continued items, including a code violation, a fire truck donation, and a policy on electronic participation. New business includes accepting a warranty deed for the Colorado Street Project and considering a food truck event at Arbor Lane Park.

public-workssafetycode-violationdonationfood-trucksdeedresolution
✓ Decided: Hobart board approves electronic meeting policy, food trucks at Arbor Lane Park

The Board of Public Works and Safety approved Resolution 2021-06, which establishes a policy for board members to participate electronically. They also approved a request for food trucks at Arbor Lane Park on July 10 from 4-7 pm, and signed a warranty deed for the Colorado Street Project. Several property maintenance and code violation cases were continued or set for future review.

Wed Jun 16, 2021

City Council

Council to consider zoning sign plan for Crossings at Hobart

The Hobart Common Council will hold its regular meeting, addressing unfinished business including a tabled contractor licensing ordinance and new items such as a resolution for community development activities with Lake County, budget transfers, and a zoning amendment for a master sign plan at the Crossings at Hobart. The meeting includes standard procedural items like minutes approval and committee reports.

zoningbudgetcontractor-licensingcommunity-developmentsignage
✓ Decided: Council adopts resolutions for county development and zoning sign plan

The Hobart Common Council approved Resolution 2021-12 to enter a three-year agreement with Lake County for community development activities, and passed Ordinances 2021-14 and 2021-15 on emergency second readings. Ordinance 2021-14 transfers appropriations within the 2021 budget for several funds, while Ordinance 2021-15 amends zoning maps to incorporate a master sign plan for the Crossings at Hobart. The council also tabled Ordinance 2021-04 on contractor licensing, pending further rework.

Mon Jun 14, 2021

Board of Park Commissioners

Hobart Park Commissioners meet on June 14, 2021

The Board will review the May 10, 2021 minutes and a register of claims. New business includes a resolution regarding electronic communication policies for board members and a CivicRec proposal.

government-policyparks-and-recreationhobart
✓ Decided: Park board approves CivicRec software, electronic meeting policy, shed replacement

The Board of Park Commissioners approved a CivicRec software proposal including the department header option, adopted Resolution No. 2021-2 allowing electronic participation in meetings, and granted Terry Lahaie of Classic Car Wash permission to replace a shed along the park's easement. The board also accepted the register of claims, including a $13,000 invoice to Puretek LLC for pool flooring and ramp repairs.

Thu Jun 10, 2021

Hobart Fire Civil Service Commission

Fire commission to discuss printing and online access to rules

The Hobart Fire Civil Service Commission is holding a regular meeting with standard procedural items. The only substantive item is a discussion under Old Business about printing and electronic access to the Commission rules. No votes or decisions are listed on the agenda.

firecivil-servicerulesadministration
✓ Decided: Fire Commission requires PERF physical for all new Hobart firefighters

The Hobart Civil Service Fire Commission voted unanimously to require all applicants offered a job at the Hobart Fire Department to undergo a physical through PERF, with current PERF members needing a fit-for-duty physical. The commission also approved the agenda, minutes from April and March meetings, and discussed ongoing amendments to commission rules regarding job scope and chain of command.

Tue Jun 8, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to consider iPads, manhole repair, remote attendance

The Hobart Sanitary District and Storm Water Management Board is meeting to discuss and potentially approve several items, including purchasing additional iPads for the AMP program, repairing a manhole on Michigan Ave, and adopting a resolution on electronic attendance. The agenda also includes routine approval of minutes and project updates from the city engineer.

infrastructuretechnologypublic-meetingstormwatersanitary
✓ Decided: Board approves iPads, manhole repair, and electronic meeting resolution

The Hobart Sanitary District Board approved the purchase of additional iPads, an emergency manhole repair, and a joint resolution allowing electronic meeting attendance. The board also discussed updates on several projects, including the Stinky Creek storm water project, Red Zone project, SCADA system, and main lift station project, but took no formal action on those items.

Tue Jun 8, 2021

Redevelopment Commission

Redevelopment Commission to discuss project priorities and funding

The Hobart Redevelopment Commission is holding a work session to discuss project priorities and funding. The meeting is scheduled for June 8, 2021, at 8:30 a.m. in the City Council Chambers. No specific projects or funding amounts are listed on the agenda.

redevelopmentfundingwork-session
✓ Decided: Redevelopment Commission discusses future projects, no votes taken

The Hobart Redevelopment Commission met on June 8, 2021, and discussed construction options, cash flow scenarios for 2020 Lease Rental Bonds and the 61st Ave. TIF (Fund 410), and several potential projects including 69th Ave. improvements, the Local TRAX Colorado St. Overpass, Northwind Pkwy. extension, and roundabouts at Marcella Blvd. and Colorado St. No formal decisions or votes were recorded; the meeting was informational only.

Thu Jun 3, 2021

Plan Commission

Plan Commission to review 10 site plans, subdivisions, and a PUD amendment

The Hobart Plan Commission will hold public hearings and site plan reviews on ten items, including a concrete recycling operation, office/warehouse facilities, subdivisions, a car wash shed, and a PUD amendment for a master sign plan. Several items were previously tabled and are back for action. The meeting includes public hearings for a storage building expansion, a subdivision, and the PUD amendment.

plan-commissionsite-plan-reviewsubdivisionpublic-hearingzoningpud-amendmentparkingsignage
✓ Decided: Plan Commission approves car wash shed, parking lot, and sign plan changes

The Hobart Plan Commission approved several site plans and a preliminary plat, all by 9-0 votes. Approvals included a shed and fence for Classic Car Wash, a gravel lot resurfacing for Abonmarche Consultants, a parking lot expansion for a used car dealership, and a preliminary plat for Smith Estates contingent on right-of-way dedication. The commission also gave a favorable recommendation to a Master Sign Plan amendment for the Crossings of Hobart. Several other petitions were tabled, including a concrete recycling site plan and a storage facility expansion.

Thu Jun 3, 2021

Board of Zoning Appeals

Board of Zoning Appeals discusses pole barn and shed variances

The Board will consider several requests for developmental standards variances. These include height and yard encroachment requests for pole barns at E. 83rd Ave. and E. 33rd Avenue, as well as a shed placement request on N. Lake Park Ave.

zoningresidentialcommercialvariancespole barns
✓ Decided: BZA approves four pole barn variances with conditions

The Hobart Board of Zoning Appeals approved all four variance requests for pole barns, each with conditions on exterior materials. Two variances were granted to William Kaminski for a 30x40 pole barn, contingent on faux brick matching the house. Two variances were granted to Chad and Crystal Hewitt for a 26x40 pole barn, contingent on wainscoting and colors matching the house. A variance for a 12x20 shed at Classic Car Wash was also approved, with the shed to be placed on the property line.

Wed Jun 2, 2021

Board of Public Works and Safety

Board to consider electronic meeting participation policy

The Hobart Board of Public Works and Safety will hold a regular meeting with routine items such as approving claims and minutes. They will also discuss property maintenance violations, unsafe buildings, and several requests for tree removal or fence replacement. A notable item is a resolution to establish a policy for electronic participation by board members.

public-workssafetyproperty-maintenanceunsafe-buildingstreespermitsresolution
✓ Decided: Board approves multiple property requests and Summer Market band contracts

The Board of Public Works and Safety approved several property-related requests, including tree removals, a fence replacement, and a subdivision mylar signing. They also approved the Summer Market band contracts and a long-term maintenance agreement for a church. A resolution on electronic meeting participation was tabled for further consideration.

Wed Jun 2, 2021

City Council

Council to consider contractor licensing, PUD zoning change, remote meeting policy

The Hobart Common Council will hold its regular meeting, addressing unfinished business including a tabled ordinance on contractor licensing. New business includes a compliance statement for Lake Park II, a zoning ordinance for Northwind Crossing South, and a resolution on remote participation for council members.

zoningcontractor-licensingremote-meetingcouncil-procedure
✓ Decided: Council adopts Northwind Crossing South PUD replacement ordinance

The Council approved Ordinance 2021-13 on first and second reading, replacing the preliminary plan for Northwind Crossing South (50 acres near 69th Ave & Mississippi St.) and repealing the prior Ordinance 2020-02. The Council also adopted Resolution 2021-11 establishing a policy for electronic meeting participation, effective after the Governor's emergency order expires. Other actions included approving the Statement of Benefits for Lake Park I, LLC and appointing a council member to the Comprehensive Plan Steering Committee.

Tue Jun 1, 2021

Plan Commission

Plan Commission to decide on rezones, subdivisions, and site plans

The Hobart Plan Commission will consider several tabled items, including rezones, subdivision plats, and a PUD amendment, plus new business such as a site plan review and a public hearing for a final development plan. The meeting also includes approval of minutes and a consultation on the Grothoff Subdivision.

zoningsubdivisionpublic-hearingsite-planpud
Thu May 27, 2021

Plan Commission

Plan Commission to review light manufacturing site plan and PUD amendment

The Hobart Plan Commission is holding a special meeting to consider two related items for a proposed light manufacturing building with office space, parking, and utilities on a 51.96-acre site zoned PUD (M-1), located 800 feet east of the northeast corner of 69th Avenue and Mississippi Street. The agenda includes a site plan review (PC 21-22) and a public hearing for a PUD amendment (PC 21-22A).

plan-commissionsite-plan-reviewpud-amendmentmanufacturinghobart
✓ Decided: Plan Commission approves site plan and PUD amendment for light manufacturing building

The Hobart Plan Commission approved a site plan review (PC 21-22) for a light manufacturing building with office, parking, and utilities on 51.96 acres near 69th Avenue and Mississippi Street, with changes to dock configuration and paving. The commission also gave a favorable recommendation to the Common Council for a PUD amendment (PC 21-22A) to allow increased paved area and fencing. Both votes were unanimous (6-0).

Wed May 26, 2021

Maria Reiner Center Board

Maria Reiner Center board to discuss masks, vaccines, bus fees, trips, meals, fundraisers

The Maria Reiner Center Board of Directors is holding its regular meeting to approve minutes and claims, review financial reports, and hear the executive director's report. Discussions will cover mask and vaccine guidelines, bus schedule and fees, field trips, meal updates, and possible fundraiser ideas. The meeting is routine with no major decisions listed on the agenda.

senior-centerhealthtransportationmealsfundraising
✓ Decided: Board approves mask-optional signage for Maria Reiner Center

The board approved posting signage that masks are encouraged but not required, aligning with the city's reopening plan. It also approved the April financial report and claims totaling $22,081.45, and welcomed a new board member. No other substantive decisions were made.

Wed May 26, 2021

Contractor's Licensing Board and Registration

Hobart contractor licensing board May 26 meeting cancelled

The Contractor's Licensing Board meeting scheduled for May 26, 2021, has been cancelled due to a lack of new business items. The next regularly scheduled meeting will be held on July 28, 2021.

contractorslicensingmeeting-cancellation
Tue May 25, 2021

Sanitary and Stormwater District Board

Hobart sanitary board to consider sewer cleaning, SCADA tower move, and cost-share extension

The Hobart Sanitary District/Storm Water Management Board will discuss and consider several items, including a deadline extension for the Julie Clark 6th Street 50/50 cost share, proposals for sanitary sewer cleaning from an RFP, and a proposal from AES to move a SCADA tower. They will also review a Duck Creek Tributary Restoration MOU with Delta and HSD, and consider a laptop replacement and mosquito program.

sewerstormwaterinfrastructurecontractsmosquito-control
✓ Decided: Board awards sewer rehab contract to Abonmarche, approves multiple purchases

The Hobart Sanitary District Board approved the 2021 Sewer Rehabilitation Project contract with Abonmarche (not to exceed $27,888), despite a slightly higher-cost proposal from Commonwealth, based on experience. The board also ratified an AES soil boring proposal, approved the purchase of two iPads (one for an intern, one for David Farley), approved a $17,064.49 mosquito spray purchase, and approved a scope of work with Delta for the Duck Creek Tributary Restoration project. All votes were unanimous (5-0).

Wed May 19, 2021

Board of Public Works and Safety

Board to consider right-of-way agreement for Northwind Parkway Extension and 61st Ave roundabout

The Hobart Board of Public Works and Safety is meeting to handle routine approvals, including claims and minutes, and to consider several property-related requests. Notable items include a right-of-way services agreement for the Northwind Parkway Extension and 61st Ave roundabout, sidewalk and tree removal requests, and a subdivision entrance sign request.

public-worksright-of-waysidewalk-waivertree-removalsubdivision-signperformance-agreements
✓ Decided: Board approves right-of-way services agreement for Northwind Parkway project

The Board approved a right-of-way services agreement with Butler, Fairman & Seufert, Inc. for the Northwind Parkway Extension and 61st Ave Roundabout Intersection, not to exceed $84,950. It also approved a sidewalk waiver for 1191 S. Hobart Rd., denied a tree removal request at 2030 E. 38th Ave., and continued several items to future meetings.

Wed May 19, 2021

City Council

Council to vote on golf cart/off-road vehicle use on city streets

The Hobart Common Council will consider several items, including a second reading of an ordinance to allow golf carts and recreational off-road vehicles on city streets under specified conditions. They will also address tabled items from previous meetings, including a use variance for a storage facility and a contractor licensing ordinance, plus new business on a tax levy appeal and budget transfers.

zoningordinancegolf-cartscontractor-licensingbudgettax-levy
✓ Decided: Council adopts golf cart ordinance 5-2, approves storage variance

The Hobart City Council adopted Ordinance 2021-11, allowing golf carts and off-road vehicles on city streets under specified conditions, with a 5-2 vote. They also approved a use variance for a climate-controlled storage facility at 7305 Grand Blvd, and approved a compliance statement for Hanson Logistics, a tax levy appeal resolution, and a budget transfer ordinance.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Mr. Kopil, seconded by Mr. Huddlestun, to adopt Ordinance 2021-11 as amended. Roll Call Vote taken
5 yea
Kopil yea · Huddiestun yea · Maggio yea · Claussen yea · Waldrop yea
Tue May 18, 2021

Historic Preservation Commission

Historic Preservation Commission reviews 8 certificate requests

The Hobart Historic Preservation Commission is meeting to review eight Certificate of Appropriateness requests for changes to historic properties, including signage, painting, masonry repairs, an awning, a mural, storefront rehabilitation, façade renovation, and siding replacement. The commission will also approve the April minutes and hear public comment.

historic-preservationcertificate-of-appropriatenesssignagemasonrymuralstorefront
✓ Decided: Historic Preservation Commission approves demolition of 3 structures

The Hobart Historic Preservation Commission met on May 18, 2021, and approved the demolition of three structures, including a house and two other buildings. The commission also discussed and approved several other items, including a certificate of appropriateness for a sign and a request for a fence. No items were denied or tabled.

Mon May 17, 2021

Redevelopment Commission

Redevelopment Commission to consider 2022 tax increment resolutions and budgets

The Hobart Redevelopment Commission will hold its regular meeting to discuss and potentially approve several items, including tax increment estimates for 2022, resolutions declaring tax increment needed for obligations, and the 2022 budgets for multiple funds. They will also consider a property disposition, an awning grant application, and a right-of-way services agreement for the Northwind Parkway Extension Project.

redevelopmenttax-incrementbudgetproperty-dispositiongrantsroads
✓ Decided: RDC awards $605,500 property sale to Steiner Homes, approves 2022 budgets

The Hobart Redevelopment Commission approved the disposition of property north of 61st Avenue and west of Arizona Street to Steiner Homes for $605,500, subject to legal documents. It also approved resolutions to capture 100% of 2022 tax increment in all three TIF districts, the 2022 budgets for Funds 406, 410, 412, and 250, a $1,000 awning grant for 437 E. 3rd Street, a right-of-way services agreement with BF&S for $84,950, and multiple claims. All votes were unanimous (5-0).

Thu May 13, 2021

Hobart Fire Civil Service Commission

Fire commission to discuss rules printing and tests

The Hobart Fire Civil Service Commission is holding a regular meeting to discuss old business, including printing commission rules, the Fire Prevention test, and the Lieutenant's test. The previous meeting was cancelled due to lack of quorum.

firecivil-servicecommissiontestsrules
✓ Decided: Fire Commission schedules three tests for Aug. 7, 2021

The Hobart Fire Civil Service Commission approved holding the Fire Prevention, Fire Lieutenant, Battalion Chief, and EMS Director tests on August 7, 2021, at the PCC building. It also approved coordinating with the Union and Fire Chief's office to review and update Commission rules, and Assistant Chief Tinsley requested the first three names from the hiring list, which were provided. All motions passed 3-0.

Thu May 13, 2021

Board of Public Works and Safety

Board reviews Northwind Crossings South replat and maintenance agreement

The Board of Public Works and Safety will consider a long-term maintenance and operation agreement for Project MC. The meeting also includes the signing of replats for the Northwind Crossings South development.

zoningdevelopmentland-useinfrastructure
✓ Decided: Board approves Northwind Crossings plats and maintenance agreement

The Board of Public Works and Safety approved two mylars for the Northwind Crossings South subdivision, including a plat of correction for NIPSCO easements and a replat of Lot 1, both with 3-0 votes. It also approved a Long-Term Maintenance and Operations Agreement with Indiana Becknell Investors 2011, LLC for Project MC, a mixed-use development on the same 51.96 acres, also 3-0. No other substantive decisions were made.

Tue May 11, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to discuss Shelby Street drainage project

The Hobart Sanitary District and Storm Water Management Board is meeting to approve minutes and agenda, receive project updates from the city engineer, and discuss or consider the Shelby Street Drainage Improvement Project. The meeting is open to the public via Zoom.

drainagestormwatersanitaryinfrastructurehobart
✓ Decided: Board approves Red Zone contract signing, engine purchase, truck auction

The Hobart Sanitary District Board approved several actions: authorizing the chairman to sign the Red Zone agreement for additional sanitary line cleaning pending legal review, approving the purchase of a replacement engine for Truck #15, and entering a 2006 Aries camera truck into the city auction. The board also discussed a stormwater software trial and the Shelby Street project but took no formal action on those items.

Mon May 10, 2021

Board of Park Commissioners

Board to discuss city property on East 6th St.

The Hobart Board of Park Commissioners is holding a regular meeting with routine items like approving the agenda, minutes from April 19, 2021, and the register of claims. Under new business, the board will discuss city property on East 6th St., presented by Ericka McCauley. Reports from the director, plan commission, common council, and school board are also on the agenda.

parkspropertymeeting
✓ Decided: Park board approves RFQ process for master plan

The Board of Park Commissioners approved a plan to issue a Request for Qualifications (RFQ) for a master plan, which will be incorporated into the city's overall comprehensive plan. The board also approved the register of claims, including payments for sheet metal removal and park flags. No other substantive decisions were made; the meeting included reports and public comments regarding the Duck Creek property.

Thu May 6, 2021

Plan Commission

Plan Commission to review 10 site plans, plats, and a subdivision hearing

The Hobart Plan Commission is meeting to decide on several site plan reviews, preliminary and final plats, and a public hearing for a proposed subdivision. Items include concrete recycling, warehouse/office developments, storage facilities, and a sheet metal building addition. The agenda also includes a discussion about the Wayne Street property.

plan-commissionsite-plan-reviewsubdivisionpublic-hearingzoningindustrialstorage
✓ Decided: Plan Commission approves final plat for Northwind Crossings South replat

The Hobart Plan Commission approved the final plat for the Northwind Crossings South replat, a 2-lot subdivision, along with a Plat of Correction. They also granted final plat approval for the Saddle Brook First Resubdivision, contingent on recording the agreement. Several other site plans and plats were approved, while some petitions were tabled or withdrawn.

🏢 Building at this address: 4 m tall
Thu May 6, 2021

Board of Zoning Appeals

Hobart Board of Zoning Appeals to consider several variance requests

The Board of Zoning Appeals will review multiple public hearings regarding developmental standards variances. These requests include accessory structure size and height limits, signage permissions, and building setback encroachments.

zoningresidentialcommercialindustrialdevelopment
✓ Decided: Hobart BZA approves 13 of 15 variance requests, tables 2 pole barn petitions

The Hobart Board of Zoning Appeals approved 13 developmental standards variances and tabled 2 related to a proposed pole barn at 6787 E. 83rd Ave. All approvals were unanimous (4-0). The tabled petitions (21-16 and 21-16A) were deferred to allow the petitioner to provide revised aesthetics with landscaping.

Wed May 5, 2021

Board of Public Works and Safety

Board to consider two development agreements and traffic sign requests

The Hobart Board of Public Works and Safety is meeting to handle routine approvals and several property-related requests. They will consider two development agreements with local LLCs, a traffic study request for caution signs, and various permits and waivers. The agenda also includes approval of claims and minutes from the previous meeting.

development-agreementstrafficpermitspublic-workssafety
✓ Decided: Board approves two development agreements for 69th Ave projects

The Board approved two development agreements (Resolutions 2021-04 and 2021-05) with entities related to 2100 E. 69th Ave, contingent on City Council approval. It also denied a request for Children at Play signs, issued an order to appear with an additional $500 fine for a property owner, and approved several waivers and permits.

Wed May 5, 2021

City Council

Hobart City Council discusses tax abatements, zoning changes, and golf cart use

The City Council will consider several ordinances including the establishment of an ARP Coronavirus Local Fiscal Recovery Grant Fund. The meeting includes public hearings regarding economic revitalization areas and resolutions for development agreements.

zoningtax-abatementbudgetpublic-safetyeconomic-developmentgovernment-ordinances
✓ Decided: Council adopts golf cart ordinance allowing use on streets (4-2)

The Hobart Common Council adopted Ordinance 2021-11, permitting golf carts and recreational off-road vehicles on city streets under specified conditions, with a 4-2 vote. The council also approved several other items, including ordinances for budget transfers, a zoning change, and tax abatement resolutions, as well as a development agreement and the Parks and Recreation Master Plan.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
that the public as a whole is not behind permitting these vehicles on the roads. Mr. Wells stated the enforcement issues are important if they are fair and implemented correctly, The question was…
4 yea
Kopil yea · Huddlestun yea · Maggio yea · Waldrop yea
Wed Apr 28, 2021

Maria Reiner Center Board

Maria Reiner Center board to discuss reopening, bus ribbon cutting, and finances

The Maria Reiner Center Board of Directors is holding a regular meeting to discuss the center's reopening progress, a bus ribbon cutting event on May 12, and bus driver scheduling. The board will also review financial reports and claims, and discuss plans for meals, sponsors, and board member replacement.

senior-centertransportationbudgetreopeningboard-meeting
✓ Decided: Board approves minutes, agenda, claims, and financial report

The Maria Reiner Center Board held a routine meeting, approving the March minutes, the agenda, claims totaling $604.62, and the March financial report of $115,959.02, all unanimously. The Executive Director reported on reopening activities, a bus ribbon-cutting event, and recommended three names to replace a board member. No other substantive decisions were made.

Tue Apr 27, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to consider pool sewer project, sewer extension, appraisals

The Hobart Sanitary District/Storm Water Management Board is meeting to discuss and consider several infrastructure items, including a pool storm sewer project inspection, a sewer connection extension, appraisals for 37th Avenue, and a lift station safety ladder quote. The board will also review financial reports and a wastewater billing adjustment.

sewerstormwaterinfrastructurecontractsbilling
✓ Decided: Board approves sewer rehab RFP, extends tie-in deadline, adds equipment to auction

The Hobart Sanitary District Board approved several actions, including issuing an RFP for the 2021 sewer rehabilitation project, extending the sewer tie-in deadline for 6th and Fleming Streets to May 31, 2021, and authorizing the auction of a 2004 Pelican sweeper and 1998 backhoe. The board also approved a $7,500 inspection contract for the Hobart Pool Storm Sewer Project, re-instituted late fees for sanitary billing starting with the June 2021 bill, and approved financial reports and invoices. All votes were unanimous (4-0).

Wed Apr 21, 2021

Board of Public Works and Safety

Board to consider bridge change orders, gravel driveway extension, paving extension

The Hobart Board of Public Works and Safety is meeting to handle routine business, including approving claims and minutes. They will also consider change orders for the 3rd St. Bridge project, a gravel driveway extension request, and extending the yearly asphalt paving contract through 2021.

public-worksbridgespavingsubdivisiondriveway
✓ Decided: Board approves $83K stormwater change order for 3rd St. Bridge

The Board of Public Works and Safety approved two change orders for the 3rd St. Bridge project: Change Order #10, a no-cost time extension to end of May 2021, and Change Order #15, a $83,354.92 stormwater treatment system change, 80% covered by federal funds. They also removed from the table and approved the signing of mylars for the Hawks Crossing 6-lot subdivision, accepted a letter of credit, approved a gravel driveway extension at 1191 S. Hobart Rd, and renewed the yearly asphalt paving contract with Walsh & Kelly (Milestone) for 2021. All votes were 2-0.

Wed Apr 21, 2021

City Council

Council to consider zoning changes, tax abatement, and budget transfers

The Hobart Common Council will hold a regular meeting with several zoning ordinance changes, a public hearing on a tax abatement, and budget transfers. Items tabled from previous meetings, including a use variance for a storage facility and contractor licensing, will also be addressed.

zoningtax-abatementbudgetpublic-hearingordinance
✓ Decided: Council adopts two rezonings and approves use variance for machining shop

The Hobart Common Council adopted two zoning ordinance amendments (2021-06 and 2021-07) changing zones at 208 S. Linda St. and 8203 Utah St., and approved a use variance for machining and painting at 8203 Utah St. contingent on the rezone. The council also approved a tax abatement resolution for 7190 Grand Blvd. (5-1), approved compliance statements for three businesses, passed two ordinances on first reading, and approved a one-year temporary laydown yard variance.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Mr. Maggio, seconded by Mr. Huddlestun, to approve Resolution 2021-03 as presented. Mr. Kopil asked for an update from the City Planner as to the site plan and compliance issues. City…
5 yea
Huddlestun yea · Maggio yea · Wells yea · Waldrop yea · Claussen yea
🏢 Building at this address: 5 m tall
Tue Apr 20, 2021

Board of Zoning Appeals

BZA to consider variances for laydown yard and parking southeast of 61st Ave & Wisconsin St

The Board of Zoning Appeals will hold a special meeting to discuss a use variance and two developmental standards variances. These requests concern a 2.72-acre R-1 zoned property southeast of the 61st Ave. & Wisconsin St. roundabout.

zoningvariancesparkingconstruction
✓ Decided: BZA recommends NIPSCO pipeline laydown yard variance to council

The Board of Zoning Appeals held a special meeting and voted unanimously (4-0) to recommend approval to the Common Council for a use variance allowing a temporary laydown yard and construction trailers for a NIPSCO gas pipeline project. The board also approved two related development standard variances for a temporary gravel parking area and parking for vehicles over 11,000 lbs, both by 4-0 votes. All approvals are for a one-year period.

Tue Apr 20, 2021

Historic Preservation Commission

Historic commission to review siding, awning permits and mural discussion

The Hobart Historic Preservation Commission will consider two certificates of appropriateness for property changes and discuss a mural. The meeting includes routine items like approving prior minutes and public comment.

historic-preservationcertificates-of-appropriatenesssidingawningmural
✓ Decided: Commission discusses mural on Art Theater, defers formal approval

The Hobart Historic Preservation Commission discussed a proposed mural on the Art Theater building, with members expressing support but cautioning against setting a precedent for painting on historic surfaces. No formal decision was made; the commission requested additional materials, including color palette and examples of the artist's work, for a future review. The BZA will review the mural on May 6, and the commission may consider it again on May 18.

Mon Apr 19, 2021

Board of Park Commissioners

Park board to consider adopting master plan, pickleball renovation

The Hobart Board of Park Commissioners will hold a public hearing on adopting the 2017-2021 master plan and discuss a pickleball renovation project. The meeting also includes routine approvals of minutes and claims.

parksmaster-planpickleballpublic-hearing
✓ Decided: Park Board adopts 2017-2021 Master Plan for Hobart parks

The Board of Park Commissioners approved the 2017-2021 Master Plan after a public hearing, and accepted the register of claims including final payment for the pool house. They also discussed a proposal to upgrade and expand pickleball courts at Pennsy Park, but took no formal action on it.

Mon Apr 19, 2021

Redevelopment Commission

Commission to amend economic development plans for two areas

The Hobart Redevelopment Commission will hold public hearings and consider resolutions to amend the economic development plans for the 61st Avenue/SR 51 and US 30/69th Avenue areas. The agenda also includes bid openings, project status reports, change orders, and grant approvals.

economic-developmentpublic-hearinghousingroadsgrantsbudget
✓ Decided: RDC approves EDA plan amendments for 61st Ave and US 30 roundabout projects

The Hobart Redevelopment Commission approved two resolutions amending Economic Development Area plans to add parcels to acquisition lists for future right-of-way needs related to roundabout projects on 61st Avenue and at US 30/69th Avenue. The commission also approved a $605,500 bid from Steiner Homes for a 71-lot housing subdivision, multiple pay estimates and change orders for road projects, a facade grant, and several education grant reports. All votes were unanimous (5-0).

Wed Apr 14, 2021

Plan Commission

Plan Commission to review pipeline laydown site and tabled rezone

The Hobart Plan Commission is holding a special meeting to consider two items: a site plan review for a temporary pipeline construction laydown area near the Wisconsin Street & 61st Avenue roundabout, and a tabled petition to rezone 44.19 acres at 5441 E. Lincoln Highway from B-3, R-2, and PBP to PUD.

plan-commissionzoningsite-plan-reviewpipelinerezoning
✓ Decided: Plan Commission approves pipeline laydown site, recommends PUD rezone

The Hobart Plan Commission granted site plan approval for a temporary pipeline construction laydown yard, contingent on BZA approval of variances. The commission also gave a favorable recommendation to the Common Council for a proposed rezone to PUD at 5441 E. Lincoln Highway, with revised conditions on building heights and lot coverage.

Tue Apr 13, 2021

Sanitary and Stormwater District Board

Board to discuss sewer cleaning, creek restoration, and contracts

The Hobart Sanitary District and Storm Water Management Board is meeting to discuss and consider several infrastructure items, including sewer cleaning, a restoration proposal, and a mowing contract. The agenda also includes a discussion on quotes for awnings at the HSD building.

sewerstormwaterinfrastructurecontractsrestoration
✓ Decided: Hobart sanitary board awards $227,500 Duck Creek restoration project

The Hobart Sanitary District Board approved several contracts and projects at its April 13, 2021 meeting. The board awarded the Duck Creek Tributary restoration project to Baxter & Woodman for $227,500, approved an addendum to the Red Zone sewer cleaning contract to include sewer main cleaning, and approved a $4,280 quote from Merrillville Awning for building awnings. The board also discussed but did not vote on a sewer rehabilitation RFP, requesting legal review before the next meeting.

Thu Apr 8, 2021

Hobart Fire Civil Service Commission

Hobart Fire Civil Service Commission April 8 meeting cancelled

The regularly scheduled Hobart Civil Service Fire Commission meeting for April 8, 2021, has been cancelled. No business will be conducted.

firecivil-servicemeeting-cancelled
Wed Apr 7, 2021

Board of Public Works and Safety

Board to buy 7 garbage trucks as special purchase

The Hobart Board of Public Works will consider Resolution 2021-03 to authorize the acquisition of four Labrie Automizer Helping Hands, two Leach 2R-III Rear Loader Freightliners, and a Stellar Hooklift Freightliner as a special purchase. The board will also review several property maintenance violations, including unsafe buildings and a kennel code violation, and hear requests for traffic signs, speed bumps, and easement use.

✓ Decided: Board approves $300K trash truck purchase after VW grant

The Board approved Resolution 2021-03 to buy four Labrie Automizer Helping Hands, two Leach 2R-III Rear Loader Freightliners, and a Stellar Hooklift Freightliner as a special purchase. The cost is reduced from $2,000,000 to $300,000 due to an 80/20 cost share plus VW funds. The Board also approved several other items, including a driveway waiver, irrigation repair, tree removal, and a public auction.

Wed Apr 7, 2021

City Council

Council to consider tax abatements and storage facility variance

The Hobart Common Council will hold its regular meeting, including unfinished business on a tabled use variance for a climate-controlled storage facility at 7305 Grand Blvd. and a second reading of an ordinance amending contractor licensing. New business includes resolutions designating economic revitalization areas for real and personal property tax abatements at 2100 E. 69 Ave. The agenda also includes routine items such as minutes, a proclamation, and reports.

zoningtax-abatementcontractor-licensingeconomic-developmentstorage
✓ Decided: Council approves tax abatements for distribution facility at 2100 E. 69th Ave.

The Hobart City Council approved two resolutions designating an Economic Revitalization Area for real and personal property tax abatements for Indiana Becknell Investors 2011, LLC, at 2100 E. 69th Ave., with public hearings set for May 5, 2021. The council also passed first readings of two rezoning ordinances (208 S. Linda St. and 8203 Utah St.) and tabled a use variance for 8203 Utah St. pending the rezone. A contractor licensing ordinance was tabled for further discussion.

🏢 Building at this address: 5 m tall
Thu Apr 1, 2021

Board of Zoning Appeals

Board of Zoning Appeals discusses fence variances and a machine shop proposal

The Board will consider two variance requests regarding existing chain link fences at 7305 Grand Blvd. Additionally, the Board will hear a request for a use variance to allow a machine shop and paint booth at 8203 Utah St.

zoningfencingbusiness-usedevelopmental-standards
✓ Decided: BZA tables two fence variance petitions for Alka Properties

The Board of Zoning Appeals tabled two variance requests from Alka Properties LLC regarding fences at 7305 Grand Blvd., pending the Plan Commission's site plan decision. The board also gave a favorable recommendation to a use variance for a machine shop and paint booth at 8203 Utah St., contingent on a rezone. Minutes from the previous meeting and the agenda were approved.

Thu Apr 1, 2021

Plan Commission

Plan Commission to review 13 site plans, rezones, and subdivisions

The Hobart Plan Commission will hold public hearings and site plan reviews on 13 items, including rezones, subdivisions, and development proposals. Several items were previously tabled and are being reconsidered. The meeting also includes a discussion on a right-of-access for a property at Colorado Street and US 30.

zoningsite-plan-reviewsubdivisionrezonepublic-hearing
✓ Decided: Plan Commission tables multiple site plans, approves preliminary plats and rezones

The Hobart Plan Commission tabled several site plan petitions, including 20-03 (concrete recycling), 20-25A (office/warehouse), and 21-10 (rezone to PUD for light manufacturing), due to incomplete information. It granted preliminary plat approval for 21-07B (Northwind Crossings South Replat) and 21-09 (Saddle Brook First Resubdivision), and gave favorable recommendations for rezones 21-08 (gastropub) and 21-12 (machine shop). The commission also granted site plan approval for 21-13 (mausoleum) contingent on setback compliance, and removed petition 21-01 for lack of prosecution.

Wed Mar 31, 2021

Maria Reiner Center Board

Maria Reiner Center board to discuss reopening, bus, and fundraiser

The Maria Reiner Center Board of Directors is holding a regular meeting to discuss the center's operations, including a reopening update, future plans, a bus update, part-time employee discussions, and a bingo fundraiser. The board will also approve minutes, claims, and financial reports.

community-centerfundraiseroperationsreopening
✓ Decided: Board approves new bus, reopening updates, and August bingo fundraiser

The board approved the minutes, agenda, claims totaling $397.82, and the February financial report. The executive director reported on the center's reopening, including plans to bring back a part-time employee and the arrival of a new bus. The board set the bingo fundraiser for August 14, 2021, and discussed the 10-year anniversary celebration.

Tue Mar 30, 2021

Sanitary and Stormwater District Board

Board to consider sanitary truck purchase and Deep River outfall change order

The Hobart Sanitary District and Storm Water Management Board is holding a special meeting to discuss and consider several items, including the purchase of a sanitary truck, a change order for the Deep River outfall project, and a P.E.R. submittal. The agenda is otherwise procedural, with roll call, pledge, and agenda approval.

sanitary-districtstorm-waterpurchasinginfrastructurepublic-works
✓ Decided: Board approves truck purchase, Deep River outfall extension, SRF application

The Hobart Sanitary District Board held a special meeting and approved three items: the purchase of a Ford F250 truck for $32,981 from Boask using insurance settlement funds; Change Order #1 for the Deep River Outfall project, granting a time extension due to a 51-day delay for the 3rd Street bridge and 120 days for winter; and Sanitary Resolution 2021-02 authorizing submission of a draft SRF application and P.E.R. to the Indiana Finance Authority and SRF, with the understanding that funding would be phased based on the District's financial capacity.

Wed Mar 24, 2021

Board of Park Commissioners

Park board to consider Pool Phase 2 resolution

The Board of Park Commissioners is holding a special meeting to consider a resolution related to Pool Phase 2. The agenda includes standard procedural items such as call to order, roll call, and approval of the agenda, with the main item being the pool resolution.

parksrecreationpoolresolution
✓ Decided: Park board approves pool phase 2 reimbursement resolution

The Board of Park Commissioners approved a joint resolution with the Hobart Stormwater District authorizing reimbursement of up to $138,439.56 for sidewalk and paving improvements as part of the City of Hobart Community Pool Phase 2 project. The resolution was adopted unanimously (3-0) after discussion about inspections. All other project costs will be assumed by the Stormwater Board.

Wed Mar 24, 2021

Contractor's Licensing Board and Registration

Contractor's Licensing Board March 24 meeting cancelled

The Contractor's Licensing Board meeting scheduled for March 24, 2021 has been cancelled due to a lack of new business items. The next regularly scheduled meeting will be held on May 26, 2021.

Tue Mar 23, 2021

Sanitary and Stormwater District Board

Hobart sanitary/storm board to consider pool project contract, SCADA, and asset management deals

The Hobart Sanitary District/Storm Water Management Board is meeting to discuss and consider several contracts and resolutions, including the Community Pool Project Phase II contract award, SCADA system, asset management agreements, and various repairs. The agenda also includes a claim discussion for 32 County Line Road and routine reports.

sanitary-districtstormwatercontractspool-projectscadaasset-managementlift-stationtruck-purchase
✓ Decided: Hobart Sanitary Board awards $338,493 pool phase II contract to Milestone

The Hobart Sanitary District Board approved several contracts and expenditures, including awarding the Community Pool Phase II project to Milestone for $338,493.46 and approving a joint resolution with the Parks Department for its payment. The board also approved a $130 claim for a resident's garage door repair, a $7,200 roof repair at lift station #1, and a new truck purchase up to $32,981 contingent on additional quotes. All votes were unanimous (4-0 or 3-0) with some members voting via Zoom.

Thu Mar 18, 2021

Hobart Fire Civil Service Commission

Commission to certify new hiring list at special meeting

The Hobart Civil Service Fire Commission is holding a special meeting to consider and certify a new hiring list. The agenda includes call to order, pledge of allegiance, roll call, and approval of the agenda before the main item. The meeting is scheduled for 6:30 P.M. on March 18, 2021, in Council Chambers at Hobart City Hall.

✓ Decided: Fire Commission certifies hiring list, excludes two candidates

The Hobart Civil Service Fire Commission held a special meeting and approved the agenda. It voted to exclude two candidates from the hiring list for not meeting requirements, then accepted the completed list with 22 active candidates. The meeting adjourned after these actions.

Wed Mar 17, 2021

Board of Public Works and Safety

Hobart board to consider sidewalk dining renewals, EMS equipment purchase

The Hobart Board of Public Works and Safety will hold a regular meeting with routine items including claims approval and minutes. They will also consider renewing sidewalk dining permits for three Main Street restaurants, a refund request for a PUD amendment filing fee, and resolutions for an asset management agreement and EMS equipment purchase.

public-workssafetysidewalk-diningemsasset-managementsubdivisionrefund
✓ Decided: Board approves $269,122 EMS equipment purchase and 3 stop signs at 40th & Delaware

The Board approved Resolution 2021-02 for a special purchase of EMS equipment and maintenance totaling $269,122.04, and authorized placement of three stop signs at 40th & Delaware. It also approved sidewalk dining renewals for three businesses, a $110 refund for a PUD filing fee, and issued an order to appear for a property owner. The Hawks Crossing mylar signing was tabled to April 7.

Wed Mar 17, 2021

City Council

Hobart Council to vote on storage facility variance, golf cart ordinance, tax abatements

The Hobart Common Council will consider several items, including a use variance for a climate-controlled storage facility and outdoor RV/boat storage at 7305 Grand Blvd., and a second reading of an ordinance to allow golf carts and off-road vehicles on city streets. They will also vote on resolutions for tax abatements and economic development plan amendments, and ordinances on contractor licensing and a preliminary PUD plan.

✓ Decided: Council approves tax abatement for Grand Trunk Storage Depot after tie-break

The Hobart Common Council approved Resolution 2021-02, designating an Economic Revitalization Area for real property tax abatement at 7190 Grand Blvd. (Grand Trunk Storage Depot), after a motion to table failed on a tie-break vote by Mayor Snedecor. The council also approved a use variance for a bait/tackle shop and boat rental at 603 S. Wisconsin St., and adopted Ordinance 2021-05 for a preliminary PUD plan. The compost bag program will end bag distribution once current supplies are depleted.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Motion by Mr. Kopil, seconded by Mr. Wells, to table Resolution 2021-02. Roll Call Vote taken:
3 yea
Kopil yea · Wells yea · Vinzant yea
Motion by Mr. Claussen, seconded by Mr. Huddlestun, to approve Resolution 2021-02 as presented. Roll Call Vote taken:
4 yea
Claussen yea · Waldrop yea · Wells yea · Huddlestun yea
Motion by Mr. Wells, seconded by Mr. Huddlestun, to pass Ordinance 2021-04 on first reading as presented. Roll Call Vote taken
5 yea
Kopil yea · Huddlestun yea · Wells yea · Claussen yea · Waldrop yea
Tue Mar 16, 2021

Historic Preservation Commission

Hobart commission to review Main Street facade renovation

The Hobart Historic Preservation Commission is meeting to consider a certificate of appropriateness for a facade renovation at 347 Main Street, along with routine items like approving minutes and public comment. The meeting is held via phone and Zoom due to the pandemic.

historic-preservationcertificate-of-appropriatenessfacade-renovationmain-streetpublic-meeting
✓ Decided: Commission approves demolition of historic Hobart house

The Hobart Historic Preservation Commission voted to approve a Certificate of Appropriateness for the demolition of a house at 104 Lincoln Avenue. The decision was made after discussion, with the commission finding the structure does not contribute to the historic district. The minutes also record the approval of the previous meeting's minutes.

Tue Mar 16, 2021

Redevelopment Authority

Redevelopment Authority to elect officers, approve 2020 annual report

The Hobart Redevelopment Authority is holding its annual special meeting, primarily to elect officers and handle routine administrative business. Members will also approve the agenda and minutes from the March 16, 2020 special meeting. The main substantive item is the execution of officer's certificates related to the 2020 annual report and treasurer's report for the Redevelopment Authority/Commission.

✓ Decided: Hobart Redevelopment Authority approves 2020 annual report and officer certificates

The Hobart Redevelopment Authority held a special meeting and unanimously approved the execution of Officer's Certificates confirming compliance with 2014, 2015, and 2020 Lease Rental Revenue bonds. It also approved the joint 2020 Annual Report & Treasurer's Report, which will be submitted to the state by April 15. Officers from 2020 were retained, and the agenda and prior minutes were approved. No other substantive decisions were made.

Mon Mar 15, 2021

Redevelopment Commission

Commission to vote on selling 59.5-acre parcel at 61st and Arizona

The Hobart Redevelopment Commission is meeting to review status reports on several projects, including the TRAX, Northwind Extension, 69th Avenue, and 3rd Street Streetscape projects. They will also consider approving the 2020 annual report and a resolution authorizing the disposition of a 59.5-acre parcel at the northwest corner of 61st Avenue and Arizona Street. The meeting includes routine items like minutes, treasurer's report, and claims registers.

redevelopmentproperty-dispositioninfrastructurestreetscapeannual-reportclaims
✓ Decided: Commission approves sale process for 59.5-acre parcel at 61st and Arizona

The Commission approved Resolution 2021-03, authorizing the offering sheet and public notice for the sale of a 59.5-acre parcel at the northwest corner of 61st Avenue and Arizona Street. Proposals will be opened April 19, with a possible award on May 17. The Commission also approved the 2020 Annual Report, the register of claims ($1,310), and bond requisition No. 18 ($21,338).

Thu Mar 11, 2021

Hobart Fire Civil Service Commission

Commission to discuss firefighter test results and name new secretary

The Hobart Civil Service Fire Commission is holding its regular monthly meeting. The commission will discuss the results of the recent applicant test given on March 6, 2021, and take any necessary action. It will also discuss reserve firefighters, if Chief Smith is available, and name a new secretary.

✓ Decided: Fire Commission names new secretary, schedules special meetings

The Hobart Civil Service Fire Commission approved the agenda and prior minutes, discussed the March 6th applicant test (27 applicants, 2 off-site), and tabled a discussion on Reserve Firefighters due to Chief Smith's absence. Frank Pukoszek was named the new secretary by a 3-0 vote. The commission also scheduled an executive and special meeting for March 18th, 2021.

Tue Mar 9, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board meeting cancelled for lack of business

The Sanitary District / Storm Water Management Board meeting scheduled for March 9, 2021, has been cancelled for lack of business. No items will be discussed or decided at this meeting.

cancelled-meetingsanitary-districtstormwater
Mon Mar 8, 2021

Board of Park Commissioners

Hobart council to discuss Master Plan and Pop Warner mud volleyball

The Hobart Parks and Recreation Department is holding its regular monthly meeting. The agenda includes routine approvals of minutes, claims, and bond claims, along with reports from the Director, Plan Commission, Common Council, and School Board. Under new business, the board will discuss the Hobart Pop Warner Mud Volleyball event and a Master Plan discussion.

✓ Decided: Park board approves bond claims, sets special meeting on pool bid

The board approved the register of claims and bond proceeds claims, including payments for pool engineering, construction, and playground installation. A special meeting was scheduled for March 24 via Zoom to review the sole bid for Pool Phase 2. The splash pad will not open this season due to costly repairs, and a public hearing on the master plan was set for April 12.

Thu Mar 4, 2021

Board of Zoning Appeals

BZA to consider bait shop and pole barn variances

The Board of Zoning Appeals will hold public hearings regarding two variance requests. The board will determine if petitioners may deviate from current zoning and developmental standards for specific properties.

zoningvariancesland-usepublic-hearings
✓ Decided: Board recommends approval for bait shop variance, approves pole barn

The Board of Zoning Appeals voted 4-0 to recommend approval of a use variance for a bait shop at 603 S. Wisconsin St., with conditions including hours of operation and fencing. The board also approved a variance for a pole barn at 5501 Liverpool Rd., exceeding the accessory structure size limit, contingent on personal use only.

Thu Mar 4, 2021

Plan Commission

Plan Commission to review 9 development requests including rezone, PUD amendments, and site plans

The Hobart Plan Commission is meeting to decide or discuss nine development items, including site plan reviews, PUD amendments, a rezone, and a subdivision plat. Several items were previously tabled and are back for action. The agenda also includes approval of minutes and a resolution regarding TIF areas.

plan-commissionzoningsite-planpudrezonesubdivisiontifeconomic-development
✓ Decided: Plan Commission approves Becknell warehouse site plan and TIF amendments

The Hobart Plan Commission approved a favorable recommendation for a revised PUD and site plan for a 280,000 sq. ft. conduit warehouse at 69th Ave. & Mississippi St., contingent on plat corrections, berms, sidewalk, and hydrants. It also approved amendments to two TIF economic development plans, adding parcels for road and intersection projects. Several other petitions were tabled or removed due to petitioner absences or incomplete documentation.

Wed Mar 3, 2021

Board of Public Works and Safety

Hobart board to weigh stop signs, code violations, and asset program

The Hobart Board of Public Works and Safety will hold a regular meeting to review claims, hear updates on the 3rd St. Bridge project, and discuss code violations and unsafe buildings. New business includes considering stop signs at 40th & Delaware, a planning and permitting program, and a CityWorks asset management program.

public-workssafetycode-enforcementbridgestrafficpermittingasset-management
✓ Decided: Board approves $48,800 planning and building permitting software contract

The Board approved a $48,800 contract with BF&S for a Planning & Building Permitting and Licensing program, to be paid over 6 years. They also directed the City Attorney to draft a resolution for a 60/40 cost-sharing agreement between the HSD and the Board for a separate asset management program. Several items were continued to the next meeting, including a code violation case and a stop sign request.

Wed Mar 3, 2021

City Council

Council to vote on zoning change for business park near US 30

The Hobart Common Council will consider several ordinances, including a second reading to rezone land west of Clay, south of US 30, and north of 83rd Avenue to a Planned Business Park (PBP) classification. They will also vote on transferring appropriations within the 2021 MVH Restricted Fund budget. Unfinished business includes a tabled use variance for a storage facility and a tabled ordinance on golf cart use.

zoningbudgetgolf-cartsstoragebusiness-park
✓ Decided: Council adopts rezone of Clay/US 30 area to Planned Business Park

The Common Council adopted Ordinance 2021-02, changing an R-2 and B-3 zone to a Planned Business Park (PBP) classification west of Clay, south of US 30, and north of 83rd Avenue, on a 6-0 vote. The Council also adopted Ordinance 2021-03, transferring appropriations within the 2021 MVH Restricted Fund budget, also 6-0. Two items remain tabled: a use variance for a storage facility at 7305 Grand Blvd. and Ordinance 2020-29 on golf cart/off-road vehicle use. No other substantive decisions were made.

Wed Feb 24, 2021

Maria Reiner Center Board

Maria Reiner Center board to discuss pandemic closure plans

The Maria Reiner Center Board of Directors is holding a regular meeting. The main item is a discussion of the center's closure due to the pandemic and future plans. The board will also approve minutes, claims, and review financial reports for each fund.

pandemicclosurefinancial-reportsclaimsboard-meeting
✓ Decided: Maria Reiner Center to reopen March 15 with safety restrictions

The board voted to reopen the Maria Reiner Center on March 15, 2021, with safety restrictions including temperature checks, masks, social distancing, and hand sanitizer use. The vote was 5 in favor, 2 against, and 1 abstention. Meals will not be served yet, and other activities like the exercise room and Pickle Ball will resume later. The board also approved minutes, agenda, claims totaling $576.14, and the January financial report of $184,345.81.

Tue Feb 23, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to discuss repairs, master plan updates

The Hobart Sanitary District/Storm Water Management Board is meeting to discuss and consider several operational items, including pump repairs, building repairs, and updates on the sanitary north side master plan and P.E.R. from BF&S. The board will also review the asset management program and a Duck Creek tributary restoration survey. No final decisions are listed on the agenda; most items are for discussion or consideration.

sanitary-districtstormwaterinfrastructurerepairsmaster-planlift-station
✓ Decided: Board awards Duck Creek survey to Abonmarche for $7,850

The Hobart Sanitary District Board approved several contracts and expenditures, including awarding the Duck Creek survey to Abonmarche for $7,850. The board also authorized the rebuild of a pump at Lift Station #7, replacement of pressure switches, emergency replacement of check valves and pipes at Lift Station #18, replacement of a VFP at Lift Station #21, and replacement of two doors at the HSD building. The board approved the SRF Bond Claims and the amended invoices for February 2021.

Fri Feb 19, 2021

Redevelopment Commission

✓ Decided: RDC approves Audiss landscape plans, facade grant, and TIF plan amendments

The Hobart Redevelopment Commission approved the Audiss landscape plans for a property at Colorado Street and 69th Avenue, with the owner reimbursed up to $9,500. It also approved a $9,178.50 facade grant for 345 Main Street, two resolutions amending Economic Development Area Plans to include parcels for future road projects, and multiple pay estimates and claims. All votes were unanimous (4-0).

Wed Feb 17, 2021

Board of Public Works and Safety

Board to review bridge project change order and grant agreement

The Hobart Board of Public Works and Safety will consider a change order for the 3rd Street Bridge project, review an updated INDOT grant agreement for equipment procurement, and discuss property maintenance violations. The board will also consider a waiver for a paved driveway and a request for a deer crossing sign.

public-workssafetybridgegrantproperty-maintenancetraffic
✓ Decided: Board approves two change orders for 3rd Street Bridge project

The Board of Public Works and Safety approved Change Order No. 12 for concrete sealing and anti-graffiti coating ($13,642.28) and Change Order No. 13 for a drainage gate replacement ($3,650.00) on the 3rd Street Bridge project. The board also approved a driveway waiver for 1191 S. Hobart Rd., approved an updated INDOT grant agreement, and directed Public Works to post deer crossing signs on County Line Road. All votes were unanimous (3-0).

Wed Feb 17, 2021

City Council

Council to vote on sewer use ordinance, golf cart rules, and zoning changes

The Hobart Common Council will consider several ordinances, including a second reading of a sewer use ordinance, a first reading of a golf cart ordinance, and a zoning change for a planned business park. They will also discuss a tabled request for a use variance for a storage facility and a budget transfer for the MVH Restricted Fund.

✓ Decided: Council adopts sewer use ordinance, tables golf cart rules

The Hobart City Council adopted Ordinance 2021-01, establishing rules for the sanitary sewer system and pretreatment program, on second reading with a 7-0 vote. The council also passed first readings for a zoning change to a Planned Business Park (Ordinance 2021-02) and a budget transfer (Ordinance 2021-03). A motion to suspend rules for an emergency second reading of the budget transfer failed (6-1) because it was not unanimous. The golf cart ordinance was tabled for revisions, and a use variance request for a storage facility at 7305 Grand Blvd. remains tabled.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Motion by Mr. Vinzant, seconded by Mr. Maggio, to suspend the rules, declare an emergency and proceed with the second reading of the Ordinance this evening. 6
6 yea
Kopil yea · Huddlestun yea · Maggio yea · Vinzant yea · Claussen yea · Waldrop yea
Motion by Mr. Claussen, seconded by Mr. Wells to adjourn the meeting. 6
6 yea
Kopil yea · Maggio yea · Vinzant yea · Wells yea · Claussen yea · Waldrop yea
Tue Feb 16, 2021

Historic Preservation Commission

Hobart Historic Preservation Commission meeting cancelled

The Hobart Historic Preservation Commission's February 16, 2021 meeting was cancelled with no business conducted. The next meeting is scheduled for March 16, 2021.

historic-preservationmeeting-cancelled
Thu Feb 11, 2021

Hobart Fire Civil Service Commission

Fire commission to discuss reserve firefighter resolution and new hires

The Hobart Civil Service Fire Commission is holding a regular meeting to approve the agenda and minutes, and to discuss old business including a reserve firefighter resolution and new hire applications. The meeting is open to the public via Zoom.

firecivil-servicereserve-firefightershiring
✓ Decided: Fire commission requires EMTs to finish class before job offer

The Hobart Civil Service Fire Commission voted to require all EMT students to complete their class by the time a job offer is made. The commission also tabled action on the reserve list until Chief Smith returns. No other substantive decisions were made.

Tue Feb 9, 2021

Sanitary and Stormwater District Board

Hobart sanitary board to consider bids, appraisals, and change orders

The Hobart Sanitary and Stormwater District Board will meet to discuss and potentially approve several items, including the Phase 2 advertisement for the Community Pool Project, appraisals of district property on 37th Avenue, a change order for the Deep River outfall, and revised requests for proposals related to Duck Creek. The board will also introduce a new Public Works Director and consider rescinding a storm water joint resolution.

sanitary-districtstormwaterpublic-workscommunity-poolappraisalschange-order
Mon Feb 8, 2021

Board of Park Commissioners

Park board to consider pressure washer purchase and pool phase 2

The Hobart Board of Park Commissioners is meeting to handle routine approvals and reports, and will discuss two main items: purchasing a pressure washer and a resolution for pool phase 2. No final decisions are guaranteed; these are listed under new business for consideration and discussion.

parkspurchasingpoolmeeting
✓ Decided: Park board approves $9,450 pressure washer, recommends pool RFP

The Board of Park Commissioners approved a $9,450 expenditure for a Hotsy pressure washer and recommended the Stormwater board issue an RFP for pool phase 2 without awarding the bid until a formal resolution is approved. The board also accepted the register of claims, which included a concession trailer under $30,000 and a new computer. No other substantive decisions were made; the meeting included reports on the master plan, COVID-19 pool concerns, and a failed city food and beverage tax plan.

Thu Feb 4, 2021

Board of Zoning Appeals

Board of Zoning Appeals to review variance requests for pole barn and bait shop

The Board of Zoning Appeals will hold public hearings to consider several developmental and use variances. Decisions include requests to exceed size and height limits for accessory structures and signage, as well as a request to operate a bait shop in a residential zone.

zoningvariancesland-usesignage
✓ Decided: Hobart BZA approves two variances for 40x64 pole barn

The Hobart Board of Zoning Appeals approved two variances for Brian Ooms to build a 40x64 pole barn at 5928 E. 81st Ave., allowing it to exceed accessory structure size and height limits, with stipulations for personal use only. The board also approved a signage variance for SLB Bros Properties at 801 W. Old Ridge Rd. and tabled a use variance for a proposed bait shop at 603 S. Wisconsin St. due to incomplete public notice.

Thu Feb 4, 2021

Plan Commission

Hobart Plan Commission meeting scheduled for February 4, 2021

The Plan Commission will review several site plans and rezoning requests. Most items on the agenda are listed as tabled or pending further review.

zoningdevelopmentsite-planpublic-hearinghobart
✓ Decided: Plan Commission recommends rezone for Rise Commercial District (9-0)

The Hobart Plan Commission gave a favorable recommendation to rezone 14.31 acres at Clay St., US 30, and 83rd Ave. from R-2 & B-3 to PBP for a co-warehousing facility. Several site plans were tabled due to absent petitioners or unresolved issues, while two site plans were approved. The commission also discussed Johnson's Farm's proposal to rezone to PUD.

Wed Feb 3, 2021

Board of Public Works and Safety

Board to consider crossing guard contract, parking request, unsafe buildings

The Hobart Board of Public Works and Safety meets to handle routine approvals and several specific items. They will review an update on the 3rd St. Bridge Project, discuss unsafe buildings at 512 E. 4th and 347/349 Main St., consider a residential-only parking request for 595 N. Kelly St., and vote on a 6-month crossing guard contract.

public-workssafetyparkingbridgespolicebuilding-safety
✓ Decided: Board denies residential-only parking request on N. Kelly St.

The Board of Public Works and Safety denied a request for residential-only parking at 595 N. Kelly St., citing that no such parking exists on public easements in Hobart. The board also approved a 6-month crossing guard contract for $4,058.40 and set an update on unsafe building properties for March. All decisions were made with 2-0 votes.

Wed Feb 3, 2021

City Council

Hobart Common Council Feb. 3 meeting cancelled

The regular Common Council meeting scheduled for February 3, 2021 at 6:00 p.m. has been cancelled. The Board of Public Works and Safety meeting scheduled for 3:30 p.m. that afternoon will still take place as scheduled.

meeting-cancellationcommon-councilhobart
Wed Jan 27, 2021

Maria Reiner Center Board

Maria Reiner Center board to review 2020 finances, bus, grants, pandemic closure

The Maria Reiner Center Board of Directors is holding a regular meeting to approve minutes and claims, review financial reports, and hear the executive director's report. The report includes a 2020 year-end discussion, a bus update, a 2020 grant update, and discussion of closure due to the pandemic and plans for 2021. The agenda is largely procedural, with no specific dollar amounts or project names provided.

board-meetingfinancial-reportsgrantspandemictransportation
✓ Decided: Board keeps center closed, to revisit in February

The Maria Reiner Center Board voted unanimously to approve minutes, agenda, claims, and financial reports. The board agreed to remain closed and discuss reopening in February, with members receiving vaccines. No other substantive decisions were made.

Wed Jan 27, 2021

Contractor's Licensing Board and Registration

Contractor's Licensing Board January meeting cancelled

The Contractor's Licensing Board meeting scheduled for January 27, 2021 has been cancelled due to lack of new business items. The next regularly scheduled meeting will be held on March 24, 2021.

contractorslicensingmeeting-cancellation
Tue Jan 26, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to consider sewer billing, pool work, contracts

The Hobart Sanitary District and Storm Water Management Board is meeting to discuss and consider several operational items, including a sewer billing adjustment for 314 E. 12th Street, change orders for the Deep River Outfall, Phase II of the Hobart Pool storm water improvements, a 2021 GI maintenance contract, and a lift station pump repair. The board will also review the asset management program and an RFP for Duck Creek Tributary Restoration. The agenda includes routine approvals of minutes and financial reports.

sewerstormwaterbillinginfrastructurecontractsmaintenance
Wed Jan 20, 2021

City Council

Council to consider sewer use ordinance, use variances, awards

The Hobart Common Council will hold a regular meeting on January 20, 2021, at 6:00 PM. They will consider several items, including a sewer use ordinance, two use variance requests, and a continuation of tabled items. The meeting also includes presentations of memorial awards and a report from the Economic Development Commission.

zoningsewerordinancepublic-safetyhousing
Wed Jan 20, 2021

Board of Public Works and Safety

Board to review bridge change orders and code violations

The Hobart Board of Public Works and Safety is meeting to discuss the 3rd St. Bridge Project, including change orders and an update from BF&S. They will also review an order to appear for a property violation and a code violation regarding a commercial animal establishment. A request to pave an easement for a property on E. Lincoln Highway is on the agenda.

bridgecode-enforcementpublic-workssafety
✓ Decided: Board approves two change orders for 3rd St. Bridge project

The Board of Public Works and Safety approved Change Order No. 10 ($10,909.30) for subsurface drainage work and Change Order No. 11 ($27,237.15) for consolidating service points on the 3rd St. Bridge. They also approved paving an easement at 3990 E. Lincoln Highway, subject to landscaping requirements. Two property violation cases were continued to future meetings.

Wed Jan 20, 2021

Redevelopment Commission

Commission to vote on SEH contract and Steiner Homes negotiations

The Hobart Redevelopment Commission is meeting to handle routine business including approving the agenda, minutes, and treasurer's report. They will also discuss the 69th Avenue Improvement Project and vote on several grant reports, a contract with SEH, and authorization to negotiate with Steiner Homes.

redevelopmentgrantscontractsnegotiationsroads
Tue Jan 19, 2021

Historic Preservation Commission

Commission to review Main Street facade renovation request

The Hobart Historic Preservation Commission will consider a Certificate of Appropriateness for a facade renovation at 347 Main Street, approve 2021 meeting dates, and elect officers. They will also discuss the Certified Local Government application and a National Register process template.

historic-preservationcertificate-of-appropriatenessfacade-renovationmeeting-dateselection
✓ Decided: Commission approves demolition of historic house at 123 Main St

The Hobart Historic Preservation Commission approved a Certificate of Appropriateness for the demolition of the house at 123 Main St, despite objections from the public. The commission also approved several other certificates of appropriateness for exterior alterations and discussed the city's demolition review process.

Thu Jan 14, 2021

Hobart Fire Civil Service Commission

Fire Civil Service Commission to discuss new hire applications

The Hobart Fire Civil Service Commission is holding a regular meeting to handle administrative items and discuss new hire applications for the fire department. The agenda includes election of officers, approval of minutes, and committee reports, with the main substantive item being a discussion of new hire applications.

firecivil-servicehiringmeeting
✓ Decided: Fire Commission approves new hiring, testing rules for 2021

The Hobart Civil Service Fire Commission approved several measures to fill positions and update testing. It authorized posting for Fire Inspector and EMS Director positions, set a new application period for Firefighter/Paramedic with extra credits for certain qualifications, and aligned promotion test requirements with state standards. All votes were unanimous (3-0).

Tue Jan 12, 2021

Sanitary and Stormwater District Board

Hobart sanitary/stormwater board to consider Deep River outfall change orders

The Hobart Sanitary District and Storm Water Management Board is meeting to elect officers, approve prior minutes, and discuss several infrastructure items. The board will consider change orders for the Deep River Outfall project, discuss a connection/tap fee study, and consider the Lake George Boardwalk. A resolution on the pretreatment program is also up for discussion and consideration.

sewerstormwaterinfrastructurefeesboard-meeting
✓ Decided: Board declines Lake George Boardwalk, pulls coastal grant application

The Hobart Sanitary District Board voted not to participate in the Lake George Boardwalk project and to withdraw its application for the Lake Michigan Coastal grant. The board also approved two change orders for the Deep River Outfall project, authorized forwarding an industrial pre-treatment ordinance to the Common Council, and approved the meeting agenda as amended. No other substantive decisions were made.

Mon Jan 11, 2021

Economic Development Commission

Hobart Economic Development Commission holds special meeting, annual report

The Hobart Economic Development Commission is holding a special meeting to elect officers, approve minutes, and receive the 2020 annual report. The agenda is largely procedural, with no specific action items listed under old or new business.

economic-developmentmeetingannual-reporthobart
✓ Decided: EDC approves 2020 annual report, retains officers

The Hobart Economic Development Commission held a special meeting and approved its 2020 annual report, which noted no bonds, abatements, or expenditures. The commission also retained its 2020 officers for 2021 and approved the prior meeting minutes. No other substantive decisions were made.

Mon Jan 11, 2021

Board of Park Commissioners

Hobart Board of Park Commissioners meeting on January 11, 2021

The Board will review the agenda and minutes from previous meetings. The session includes consideration of a quote for Lakefront cameras and approval of bond claims.

parkspublic-safetyfinancehobart
Thu Jan 7, 2021

Board of Zoning Appeals

Board of Zoning Appeals to review variance requests for pole barns and business uses

The Board of Zoning Appeals will hold public hearings to decide on several developmental standards and use variances. Requests include building encroachments, height exceptions for pole barns, and business operation permits.

zoningvariancespublic-hearingsland-use
Thu Jan 7, 2021

Plan Commission

Plan Commission to review 5 site plans and a rezone

The Hobart Plan Commission will hold a public meeting to consider several site plan reviews and a rezone request. Items include a concrete recycling operation, a warehouse/office development, a rezone for a commercial district, a fill permit and driveway, and a monument sign. The meeting will also include election of officers and approval of previous minutes.

plan-commissionsite-plan-reviewrezonezoningcommercial-developmentindustrialsignage
✓ Decided: Plan Commission tables all five petitions, leaving no decisions made

The Hobart Plan Commission met on January 7, 2021, and tabled all five petitions on the agenda, meaning no substantive decisions were made. The commission retained its officers, approved the previous minutes, and accepted the agenda as amended. All items were deferred for further review or information.

🏢 Building at this address: 3 m tall
Wed Jan 6, 2021

Board of Public Works and Safety

Board to consider paving easement, police policy changes

The Hobart Board of Public Works and Safety is meeting to handle routine business including claims approval and minutes. They will also discuss an unsafe building update, a request to pave an easement at 521 N. Kelly Street, and two police department policy amendments. The meeting includes a review of conflict-of-interest disclosure statements.

public-workspolicebuilding-safetyeasementpolicies
✓ Decided: Board approves paving easement, police policy updates, and conflict-of-interest filings

The Board of Public Works and Safety approved a request to pave an easement at 521 N. Kelly Street, contingent on a signed maintenance agreement. It also approved updates to two Hobart Police Department general orders (16 and 1), the latter adding a Lieutenant rank. The Board accepted conflict-of-interest disclosure statements from the Mayor and Clerk-Treasurer, with each abstaining from their own vote. All other items were routine approvals or updates.

Wed Jan 6, 2021

City Council

Council to revisit storage facility variance, golf cart and rental housing ordinances

The Hobart Common Council is meeting to handle unfinished business, including a tabled use variance request for a climate-controlled storage facility and outdoor RV/boat storage at 7305 Grand Blvd., a tabled ordinance on golf carts, and a second reading of an ordinance on rental housing properties. The agenda is otherwise largely procedural, with routine items like minutes, reports, and correspondence.

zoninghousingordinancesstoragegolf-carts