The Boring PartsFederalLocal · USLocal · Canada
Travis County, TX

Travis County public meetings in 2025

64 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Fri Dec 19, 2025 · 09:00

Commissioners Court

County to approve $10.87 million Microsoft Enterprise Agreement contract

The Commissioners Court will vote on several items, including authorizing the County Treasurer to invest funds, approving budget amendments, and ratifying contracts. Notably, they will approve a $30,000 contract with Thompson Consulting for post‑disaster monitoring and a $10,870,540.77 Microsoft Enterprise Agreement with Softchoice Corporation. Additional actions include emergency services measures, a health‑human services notification revision, personnel actions, and appointments to Emergency Services District boards. An executive‑session briefing will address county security and information‑security issues.

budgetcontractsemergency-servicestechnologypersonnelhealthsecurity
✓ Decided: Commissioners approve burn ban authority through Jan. 6

The Travis County Commissioners Court unanimously approved giving the Fire Marshal or County Judge authority to issue a burn ban between now and January 6 if conditions are met. The court also approved a consent motion covering items such as claims payments, a contract modification, a Microsoft enterprise agreement, and ESD board appointments. No action was taken on disaster response, budget amendments, or security briefings.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Dec 16, 2025 · 09:00

Commissioners Court

Court reviews $750,000 sheriff recruitment contract and several budget transfers

The Commissioners Court will vote on a $750,000 contract with Belmont Icehouse Marketing for sheriff recruitment, approve multiple budget transfers and new expenditures, and consider creation of the Twin Creek Public Improvement District. Additional items include approvals for fire code amendments, child‑care funding, and a PILOT agreement with Ultra Clean Technology Systems.

budgetcontractspublic-improvement-districtfire-codechild-care
✓ Decided: Court creates Twin Creek PID, approves Turner's Crossing assessments

The Travis County Commissioners Court approved the creation of the Twin Creek Public Improvement District and approved the amended service and assessment plan for Improvement Area #3 of the Turner's Crossing Public Improvement District, including levying assessments and authorizing bond issuance preparations. The court also adopted the 2021 International Fire Code with local amendments, approved a $3.75M media and marketing contract with Belmont Icehouse, and directed staff to continue compensation analysis. All votes were unanimous.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] December 16, 2025, Minutes of the Travis County Commissioners Court Page 5 RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann…
3 yea
Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea
3 yea
Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 4 Margaret Gómez
3 yea
Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the Auditor to make outstanding payments related to the: • United Way Subaward for Childcare System Support Services. • Lifeworks Subaward for Workforce Development Services; and •…
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Dec 9, 2025 · 09:00

Commissioners Court

Travis County to approve contracts and budget amendments for FY2026

The Travis County Commissioners Court will consider approving contracts for parks engineering and road materials, budget amendments for the County Clerk's office, and interlocal agreements for emergency services and groundwater management. The meeting also includes updates on disaster response, opioid abatement, and code amendments.

budgetcontractsemergency-servicesparksroadsinterlocal-agreementscode-amendments
✓ Decided: County approved $252,005 engineering contract for RGK and Reimers Ranch Parks

The Commissioners Court approved several consent items and motions unanimously, including delegating signature authority to the County Judge and appointing Kristen Ylana to the Integral Care Board of Trustees. It also approved a nunc pro tunc order to correct clerical errors. A professional engineering services contract for the RGK Ranch and Reimers Ranch Parks Vision Plan was awarded to RVE, Inc. for $252,005.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Dec 4, 2025 · 13:30

Commissioners Court

Commissioners Court to vote on Integral Care Board appointment and district boundaries

The Commissioners Court is holding a special voting session to address board appointments and legal briefings. The body will consider an appointment to the Integral Care Board of Trustees and review a public defense study.

appointmentspublic-defensedistrictinghealthcare
✓ Decided: Court unanimously approves 2025 election precinct boundaries plan

The Commissioners Court approved adding a seventh question to the Integral Care Board of Trustees appointment questionnaire. The Court also approved the 2025 Election Precinct Boundaries Proposed Plan, with a contingency to revert to 2021 boundaries if the U.S. Supreme Court changes the congressional map. Both actions passed unanimously.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
to approve Election Precinct Boundaries Proposed Plan for 2025 (“2025 Plan”), which includes the additional changes to Precinct 100 and Precinct 108 as included in the backup. If the United States…
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Tue Dec 2, 2025 · 09:00

Commissioners Court

Court approves $12.75 million transfer to Health and Human Services budget

The Travis County Commissioners Court will vote on a $12,750,000 transfer from the Raising Travis County Special Revenue Fund to the Health and Human Services operating budget. The Court will also approve several contracts, including a $626,800 sole‑source training services contract with AgustaWestland Philadelphia Corporation and a $199,363.50 civil engineering contract to DAVCAR Inc. Additional items include a $84,966.05 purchase exemption for AB SCIEX, a $762,765 request for Microsoft 365 G5 license true‑up funding, and a public‑hearing notice for the Turner’s Crossing Public Improvement District.

budgetingcontractspublic-improvement-districthealth-human-servicestechnologyprocurement
✓ Decided: County transfers $12.75 M from reserve to health services budget

The Court unanimously delegated signing authority to the County Judge and approved a large consent agenda. It opened and closed public hearings on two development projects. The Court added to the consent agenda a $12.75 million transfer from the Raising Travis County reserve to the Health and Human Services operating budget, a new $180,000 health‑service budget, and approved the Turner’s Crossing Public Improvement District plan. It also continued the county’s 17.65% employer contribution to the Texas County and District Retirement System for 2026.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Nov 20, 2025 · 10:00

Commissioners Court

Court considers request for Texas Major Events Reimbursement Program for NASCAR events

The Commissioners Court will hold a special voting session to approve treasurer claims and a request regarding the Texas Major Events Reimbursement Program. The request concerns NASCAR events at the Circuit of the Americas facility from 2026-2028.

economic-developmentnascarcircuit-of-the-americasfinance
✓ Decided: County approves major events reimbursement request and Treasurer claim payments

The Commissioners Court unanimously approved the Circuit Events Local Organizing Committee’s request to act on behalf of the county under the Texas Major Events Reimbursement Program for National Association for Stock Car Auto Racing events at the Circuit of the Americas in 2026‑2028. The court also unanimously approved the County Treasurer’s payment of claims.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Tue Nov 18, 2025 · 09:00

Commissioners Court

County approves PILOT agreement with Applied Materials and Venkel for foreign trade zone

The Travis County Commissioners Court will vote on a range of items including proclamations, budget amendments, and several contracts. Key actions include approving a Payment in Lieu Of Taxes (PILOT) agreement with Applied Materials and Venkel Ltd for a foreign trade zone, authorizing a lease of three boat slips for the Sheriff’s Office at a cost of $17,845, and adopting budget transfers such as a $762,765 Microsoft 365 true‑up expense. The Court will also consider the approval of The Porch Townhomes multifamily project at 14356 Hunters Bend Road and a public hearing on the Twin Creek Public Improvement District.

budgethousingtechnologyintergovernmentallaw-enforcementzoning
✓ Decided: Court unanimously approves The Porch Townhomes multifamily development project

The Travis County Commissioners Court approved a resolution authorizing the Travis County Facilities Corporation to develop The Porch Townhomes at 14356 Hunters Bend Road. The Court also approved joining an amicus brief in the federal case League of Women Voters v. DHS and approved several proclamations and appointments. All votes recorded were unanimous.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
that the Commissioners take these personnel matters very seriously and are empathetic to Ms. Gray's circumstances MOTION: I move to affirm the decision of the Travis County employees serving on the…
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Nov 13, 2025 · 13:30

Commissioners Court

Court to canvass election results and consider appointments

The Travis County Commissioners Court will meet to canvass election returns from the November 4, 2025 election, consider an appointment to the SHFC Board, and receive updates on the Housing Authority of Travis County and the Diversion Center.

electionsappointmentshousingpublic-safetybudget
✓ Decided: Court approved the official canvass of the November 4 election results

The Travis County Commissioners Court unanimously approved the order canvassing the November 4, 2025 election returns. The Court also unanimously approved interview questions for the Strategic Housing Finance Corporation board vacancy. Payment of claims by the County Treasurer was approved by a 4‑1 vote. Updates from the Housing Authority of Travis County, the Diversion Center, and SHFC candidates were discussed.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 4 Margaret Gómez
9 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Tue Nov 4, 2025 · 09:00

Commissioners Court

Court to consider up to $290 million healthcare district bond issuance

The Travis County Commissioners Court will review a range of items, including public comments on easement vacates in the Thunderbird Farms and Thunderbird Village subdivisions, several proclamations, and a data‑sharing agreement with Del Valle ISD. It will also consider budget transfers, notably $239,974 for the Combined Transportation, Emergency, and Communications Center and $971,992 for the Greater Austin Travis County Regional Radio System. A major agenda item is the proposed issuance of Travis County Healthcare District certificates of obligations for up to $290 million. Additional items include multiple contract approvals and modifications.

bondsfinanceemergency-serviceshealth-datacontractsbudget
✓ Decided: Court moves $500,000 to emergency food assistance budget

The Commissioners Court unanimously reduced the public‑comment time limit to two minutes and approved a large set of consent items. It also unanimously approved a $500,000 transfer from reserves to the Central Emergency Response budget for food assistance. Additionally, the Court adopted several proclamations recognizing Equality Texas Day, Veterans Day, Home Slice Pizza Day, and other community observances.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Public Communication
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Oct 28, 2025 · 09:00

Commissioners Court

Court considers $1.5 million funding request for Sheriff’s Office staffing

The Travis County Commissioners Court will vote on a range of items including proclamations, budget amendments, contract approvals, and public‑utility easement requests. A major agenda item is a $1,501,144 funding request for the Travis County Sheriff’s Office and $187,321 for the District Clerk’s Office. The Court will also consider contract modifications, TEFRA financing certificates, and various public‑service appointments.

budgetlaw-enforcementcontractsproclamationspublic-utilitieshealth
✓ Decided: Court approves $40,200 Woollard Nichols contract for long‑term recovery

The Commissioners Court unanimously approved a large consent agenda covering dozens of items. It opened a public hearing on a utility easement request and adopted four proclamations honoring local individuals and events. The Court also approved several contracts and appointments, including a $40,200 Woollard Nichols consulting contract and a SAP contract modification.

🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
to authorize the filing of an instrument to vacate a public utility easement located along the lot lines of Lots 31 and 32 Block F, Dessau Estates Section 3, a subdivision in Precinct Two…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
8 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS October 28, 2025, Minutes of the Travis County Commissioners Court Page 3 MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 4 Margaret…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to approve a proclamation recognizing the 20th Anniversary of the Austin Spurs. (Commissioner Travillion) Members of the Court heard from: Brandon James, Senior Vice President, Strategic Growth…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate a public utility easement located along the lot lines of Lots 31 and 32 Block F, Dessau Estates Section 3, a subdivision in Precinct Two…
4 yea
Andy Brown yea · Ann Howard yea · Jeffrey Travillion yea · Brigid Shea yea
[context] RESULT: APPROVED - UNANIMOUS October 28, 2025, Minutes of the Travis County Commissioners Court Page 9 MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Tue Oct 21, 2025 · 09:00

Commissioners Court

County approves $6.39 million Roadway Recycling contract

The Travis County Commissioners Court will consider a series of items, including public comments on easement vacancies, several proclamations, and multiple budget and contract actions. Key actions include approving a $6,390,303.92 contract for roadway recycling, authorizing budget transfers of $1.3 million, $900,000 and $1,093,647 for various projects, and adopting proclamations recognizing specific dates. The Court will also review emergency‑services and health‑human‑services resolutions and appoint members to county boards.

contractsbudgetpublic-hearingsproclamationsemergency-serviceshealth-human-servicestransportationplanning
✓ Decided: Burn ban set and disaster declaration extended

The Court approved a signature motion delegating absent commissioners’ authority to the County Judge. It unanimously approved several proclamations, opened and closed multiple public hearings on easement requests, and set a burn ban while extending the October 16 disaster declaration. Additional items were added to consent, some received no action, and one item was discussed in executive session.

🗳️ How they voted (15 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
2 yea
Ann Howard yea · Margaret Gómez yea
[context] October 21, 2025, Minutes of the Travis County Commissioners Court Page 2 RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate a public utility easement located within Lot 16 Block A, a resubdivision of Lots 1, 2, and 3, Slaughter Creek Acres, a subdivision in Precinct Four…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate an electrical utility easement only located along the lot lines of Lot 10 and Lot 11 Block A, Hillside at Spanish Oaks, a subdivision in Precinct…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to abandon a section of right-of-way on Narvella Drive, located in Precinct Three. (Commissioner Howard) MOTION: Open the Public Hearing. RESULT: APPROVED -…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea
8 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea · Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate a public utility easement located within Lot 16 Block A, a resubdivision of Lots 1, 2, and 3, Slaughter Creek Acres, a subdivision in Precinct Four…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate an electrical utility easement only located along the lot lines of Lot 10 and Lot 11 Block A, Hillside at Spanish Oaks, a subdivision in Precinct…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to abandon a section of right-of-way on Narvella Drive, located in Precinct Three. (Commissioner Howard) October 21, 2025, Minutes of the Travis County…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Resolution Center at the Civil and Family Courts Facility as discussed in executive session. RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] October 21, 2025, Minutes of the Travis County Commissioners Court Page 16 RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Oct 16, 2025 · 13:30

Commissioners Court

Court considers endorsement of Formula 1 US Grand Prix for 2027-2034

The Commissioners Court will hold a special voting session to discuss housing finance and parks planning. The body will consider appointing the Circuit Events Local Organizing Committee (CELOC) as its exclusive designee for the Texas Major Events Reimbursement Program regarding the Formula 1 United States Grand Prix.

formula-1economic-developmenthousingparkstourism
✓ Decided: County approved endorsing role for Formula 1 Grand Prix 2027‑2034

The Commissioners Court unanimously approved the Circuit Events Local Organizing Committee's request for Travis County to act as the endorsing county for the Formula 1 United States Grand Prix and to appoint CELOC as the county's exclusive designee for the Texas Major Events Reimbursement Program for the 2027‑2034 events. The motion was moved by Commissioner Margaret Gómez and seconded by Commissioner Jeffrey Travillion. The updates on the Strategic Housing Finance Corporation and the Parks Draft Comprehensive Plan were only discussed and no actions were taken on them.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · County Judge yea
Tue Oct 7, 2025 · 09:00

Commissioners Court

Court to postpone $290 M healthcare district bond issuance to Nov 4

The Travis County Commissioners Court will consider postponing an order that authorizes the issuance of Travis County Healthcare District certificates of obligations up to $290,000,000, moving the action to November 4, 2025. The meeting also includes approvals for several contracts, budget allocations, and interlocal agreements, as well as public hearings on permits and records management. Additional items involve funding requests for road improvements, emergency services contracts, and music education services.

budgethealthcareinfrastructurecontractspublic-eventsemergency-services
✓ Decided: Court approved conditional permit for Seismic 8.0 outdoor music festival

The Travis County Commissioners Court unanimously approved a conditional permit for the Seismic 8.0 outdoor music festival to be held Nov 14‑16, 2025 at 8509 Burleson Rd. The court also approved proclamations for Hispanic Heritage Month and National Night Out, added numerous interlocal agreements and other items to the consent calendar, and accepted a friendly amendment appointing members to the Child Care and Out‑of‑School Time Fund Community Advisory Council.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
8 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the Travis County Risk Manager to sign all necessary settlement documents regarding Cause No. D-1-GN-23-006801, Timothy Bronaugh vs. Travis County, in the 419th Judicial District Court…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Sep 30, 2025 · 09:00

Commissioners Court

Commissioners Court to approve Travis County FY 2026 budget

The Travis County Commissioners Court will consider public comments on the Fiscal Year 2026 proposed budget and vote to adopt the FY 2026 budget. The Court will also act on a range of contracts, permits, and interlocal agreements, including emergency services measures and public health and animal services renewals. Additional items include approvals for outdoor event permits, purchasing exemptions, and budget amendment requests.

budgetcontractspermitsemergency-servicespublic-healthanimal-servicesinterlocal-agreementspurchasing
✓ Decided: Travis County Commissioners Court approved FY 2026 budget unanimously

The Court unanimously approved the Travis County Fiscal Year 2026 budget. It also approved a tax‑exempt bond for the Bellingham Park Apartments project and appointed Gabriel Padilla as Constable for Precinct 4. Numerous consent items, including interlocal agreements and budget amendments, were added to consent, and a public hearing was set for an outdoor music festival permit.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Sep 23, 2025 · 09:00

Commissioners Court

Travis County to consider $25.4 million transfer for child care services

The Commissioners Court will discuss budget amendments, including a large fund transfer for child care and disaster recovery expenditures from the July 2025 flooding. The body will also vote on various contract modifications and grant agreements for county departments.

budgetchild-caredisaster-recoverycontractspublic-safety
✓ Decided: Court bans outdoor burning in unincorporated Travis County until Oct 21, 2025

The Commissioners Court delegated signing authority to the County Judge for absent commissioners and approved a large set of consent items. It unanimously adopted proclamations for Hunger Action Month and Domestic Violence Awareness Month, and ordered a prohibition on outdoor burning in unincorporated areas until October 21, 2025. The Court also approved continuation of the General Victim Assistance Grant and authorized an interview for the Constable Precinct Four vacancy, while numerous budget and contract items were added to consent.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Thu Sep 18, 2025 · 13:30

Commissioners Court

Commissioners Court to receive security and IT briefing

The Commissioners Court will receive a briefing on Travis County security and information security issues, including facility security enhancements. The briefing may be taken into executive session under the applicable Government Code sections.

securityinformation-technologyexecutive-session
Tue Sep 16, 2025 · 09:00

Commissioners Court

County approves $6.59 million contract for Bee Creek Sports Complex Phase II

The Commissioners Court will vote on a $6,590,759 purchase order to build Phase II of the Bee Creek Sports Complex. The Court will also consider permits for the Wicked Oaks outdoor music festival, approve 911‑dispatch interlocal agreements for five cities, and adopt budget amendments, fee updates, and county tax rates for Fiscal Year 2026. Additional items include contracts for forensic analysis services, traffic‑paint work, and a lease of space at 700 Lavaca Street to Integral Care.

budgettaxescontractspermitsinterlocal-agreementsinfrastructureemergency-serviceshealth-care
✓ Decided: Court moved $1.8M from emergency reserve to Central Emergency Response budget

The Travis County Commissioners Court unanimously approved a $1.8 million transfer from the emergency reserve to the Central Emergency Response budget and created a new Deputy Emergency Management Coordinator position. It also approved FY2026 fee updates, FY2026 budget amendments, and set sound‑level conditions for the Wicked Oaks outdoor music festival permit. A series of consent items and multiple 911 dispatch interlocal agreements were added to the consent agenda.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
to accept and finalize these settlements. RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 1 Jeffrey Travillion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Sep 9, 2025 · 09:00

Commissioners Court

Court considers $13.7M health benefit fund transfer and multiple budget moves

The Commissioners Court will vote on several budget amendments, including a $13,666,906 transfer from the Employee Health Benefit Fund to cover FY 2025 health plan costs. Other items include smaller fund transfers, approval of opioid abatement contracts, and setting a public hearing for the Wicked Oaks outdoor music festival permit. The Court will also adopt proclamations for National Recovery Month and September 11 Day.

budgethealthcontractspublic-hearingelections
✓ Decided: Commissioners Court approved $13.7M budget transfer for employee health benefits

The court approved a $13,666,906 transfer from the Employee Health Benefit Fund’s reserve to cover FY 2025 health plan costs. It also approved a signature motion delegating absent commissioners’ signing authority to the County Judge, and unanimously adopted several consent items, proclamations, and contract approvals. Public hearings on a Finial Drive detour and the Wicked Oaks outdoor music festival were opened and then closed.

🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
14 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Brigid Shea yea · Ann Howard yea
to approve a proclamation recognizing September as National Recovery Month in Travis County (Judge Brown) Members of the Court heard from: Aurora Martinez Jones, Judge, 126th District Court Myron…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to approve a proclamation recognizing September 11, 2025, as National Day of Service and Remembrance (9/11 Day) in Travis County. (Judge Brown) Members of the Court heard from: Sara Millet, Justice…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: Passed (3-0) MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea AYES: Jeffrey Travillion, Brigid Shea, Ann Howard
1 abstain
Andy Brown abstain
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
to accept the settlement offer and authorize the Travis County Attorney to finalize and sign the settlement as discussed in executive session. RESULT: APPROVED - UNANIMOUS MOVER: Commissioner…
3 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
3 yea · 2 absent
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Brigid Shea absent · County Judge absent
Call to Order
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Fri Sep 5, 2025 · 09:00

Commissioners Court

Travis County Commissioners Court to conduct FY 2026 budget mark-up

The Commissioners Court is meeting to consider and take action regarding the Fiscal Year 2026 Budget Mark-Up. This process involves reviewing and adjusting the proposed budget for the upcoming fiscal year.

budgetfiscal-year-2026finance
Thu Sep 4, 2025 · 09:00

Commissioners Court

Travis County Commissioners Court to conduct FY 2026 Budget Mark-Up

The Commissioners Court will meet to consider and take action regarding the Fiscal Year 2026 Budget Mark-Up. This process involves reviewing and adjusting the proposed county budget for the upcoming fiscal year.

budgetfiscal-year-2026county-finance
Wed Sep 3, 2025 · 09:00

Commissioners Court

Commissioners Court to conduct Fiscal Year 2026 Budget Mark-Up

The Commissioners Court will meet to consider and take action regarding the budget mark-up for Fiscal Year 2026. This process determines how county funds are allocated for the upcoming fiscal year.

budgetfiscal-year-2026finance
✓ Decided: Court approves FY2026 Preliminary Budget and key funding allocations

The Commissioners Court unanimously approved the FY2026 Preliminary Budget as a baseline and the accompanying changes. It also unanimously approved the Peace Officer Pay Scale items and a series of one‑time earmarks, including $600,000 for Pflugerville EMS and $115,000 for the Dispute Resolution Center move. A motion to direct staff on compensation‑reserve planning passed 4‑1.

🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: Passed (4-1) MOVER: Commissioner Precinct 3 Ann Howard SECONDER: County Judge Andy Brown
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
that the court will proceed with one-time funding discussions for the remainder of the session. 8. Review selected items on Budget Agenda Worksheet. Members of the Court heard from: Jessica Rio…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
8 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Resolution Center (DRC) Members of the Court heard from: Aerin-Renee Pfaffenberger, Assistant Director, Administration and Planning, Facilities Management Department MOTION: Direct staff to move…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 1 Jeffrey Travillion September 3, 2025 Minutes of the Travis County Commissioners…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Aug 26, 2025 · 09:00

Commissioners Court

County approves $5.15 M Motorola lease‑purchase for emergency communications

The Travis County Commissioners Court will consider public comments on elected officials' salaries and a utility easement request, and will vote on a range of items including emergency services actions, interlocal child‑care agreements, budget amendments, and several contracts. Notable decisions include approving a $5,148,434.55 contract with Motorola Solutions for two‑way communication devices and multiple budget transfers and earmarks. The Court will also adopt service plan updates for several public improvement districts and authorize various contract modifications.

emergency-servicescontractsbudgetinterlocal-agreementspublic-improvement-districtstechnology
✓ Decided: Court approves $2 million emergency reserve transfer and EMS pay scale

The Commissioners Court delegated signing authority to County Judge Andy Brown and approved the full consent agenda. It unanimously approved a $2 million transfer from the emergency reserve to the central response budget and adopted a two‑year pay scale for Emergency Medical Services STAR Flight. The Court also approved three interlocal agreements to provide Pre‑K and after‑school child‑care services.

🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 4 Margaret Gómez
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
12 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate a public utility easement located along the lot lines of Lots 13 & 14, Apache Shores Section 6, a subdivision in Precinct Three. (Commissioner…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to authorize the filing of an instrument to vacate a public utility easement located along the lot lines of Lots 13 & 14, Apache Shores Section 6, a subdivision in Precinct Three. (Commissioner…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 2 Brigid Shea
3 yea · 3 absent
Brigid Shea yea · Ann Howard yea · Margaret Gómez yea · Andy Brown absent · Jeffrey Travillion August absent · County Judge absent
Call to Order
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Aug 19, 2025 · 09:00

Commissioners Court

Travis County to approve budget amendments and disaster response contracts

The Commissioners Court will consider budget amendments, including $10 million for child care and $4.4 million for disaster recovery, and approve contracts for emergency services and technology.

budgetemergency-serviceschild-carecontractselectionstechnologydisaster-recovery
✓ Decided: Court approved request for state water assistance and FY26 budget timeline

The Commissioners Court unanimously approved a resolution seeking financial assistance from the Texas Water Development Board and set the deadline and start date for the FY 2026 budget agenda worksheet. It also reappointed two members to the Strategic Housing Finance Corporation board and opened a call for applications for the Precinct 4 Constable position. Additional actions included authorizing a $922,408 contract for a client‑management system, transferring $10,095,159 to health services, and delegating signing authority to Commissioner Shea. All other items were approved as consent items or discussed without further action.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
15 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Fri Aug 15, 2025 · 09:00

Commissioners Court

Commissioners Court to discuss FY 2026 preliminary county budget

The Travis County Commissioners Court will hold a budget hearing to discuss the FY 2026 preliminary budget. Presentations and discussions will cover multiple county departments and offices, including the Sheriff's Office, Health and Human Services, and Transportation & Natural Resources. The item may be taken into executive session for certain security and legal matters.

budgetsheriffhealthtransportationcourts
Thu Aug 14, 2025 · 09:00

Commissioners Court

Travis County Commissioners Court to hold FY 2026 preliminary budget hearings

The Commissioners Court will discuss budget issues related to the development of the FY 2026 Travis County Preliminary Budget. The meeting includes presentations and discussions with various county departments and offices.

budgetfinancecounty-government
Wed Aug 13, 2025 · 09:00

Commissioners Court

Travis County holds budget hearing for FY 2026 Preliminary Budget

The Commissioners Court will receive public comments and discuss issues regarding the FY 2026 Travis County Preliminary Budget. The meeting includes presentations and discussions with various county departments and offices.

budgetfy-2026public-hearingcounty-government
Tue Aug 12, 2025 · 09:00

Commissioners Court

Approve $261,253.30 Change Order for County Clerk Expansion Project

The Commissioners Court will vote on a change order to increase funding for the County Clerk Expansion Project, approve several contract modifications and terminations, and consider budget transfers for Community Legal Services. Additional items include proclamations, emergency services actions, and licensing agreements for early voting sites.

budgetcontractstechnologylegal-serviceselections
✓ Decided: Court transfers $5.6 M from emergency reserve to central emergency response budget

The Commissioners Court unanimously approved a motion delegating signing authority to County Judge Andy Brown for absent members. It approved several consent items, two proclamations, and transferred $5.6 million (and later $2,352,000) from the emergency reserve to the central emergency response budget. The Court also approved an interlocal agreement with TDEM to use the Expo Center as a debris‑management site and approved a scope‑change request for a Transportation and Natural Resources project.

🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
to approve a proclamation recognizing August 12, 2025, as Pease Park Day in Travis County. (Commissioner Shea) Members of the Court heard from: Nicole Netherton, Chief Executive Officer, Pease Park…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown August 12, 2025, Minutes of the Travis County Commissioners Court Page 3 SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Aug 5, 2025 · 09:00

Commissioners Court

Court to approve $370,000 maintenance budget transfer and other fund moves

The Travis County Commissioners Court will vote on several budget amendments, including a $370,000 transfer from vacancy savings to the Facilities Management Department's Maintenance budget and a $189,590 transfer from the SMART Facility Reserve. The Court will also consider an interlocal agreement with the City of Austin that raises the city's contribution by $71,473 for the Sobering Center, and a $40,791 agreement with the University of Texas for internet services. Additional items include setting a public hearing on an Apogee Boulevard traffic detour and approving the termination of several juvenile probation contracts.

budgetingfacilitiesinterlocal-agreementtransportationpublic-hearingcontracts
✓ Decided: Court waives collection center fees until Aug 24 2025

The Commissioners Court unanimously approved a motion to continue waiving fees at the 1431 Citizens Collection Center through August 24, 2025. It also approved a signature delegation allowing the County Judge to sign documents for absent commissioners, and adopted several unanimous consent items, proclamations, and committee appointments. All actions were recorded as unanimous votes unless noted otherwise.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
to approve a proclamation recognizing Todd Osburn's retirement. (Commissioners Travillion & Gómez) Members of the Court heard from: June Mighty, Director, Human Resources Management Department (HRMD)…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
to approve a proclamation recognizing the month of August 2025 as Gun Safety Awareness Month. (Commissioners Travillion & Shea) August 5, 2025, Minutes of the Travis County Commissioners Court Page 4…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jul 29, 2025 · 09:00

Commissioners Court

County considers $11.5 million loan for affordable housing for homeless

The Travis County Commissioners Court will vote on a loan of up to $11,503,016 for affordable housing for individuals experiencing homelessness. It will also consider mass‑gathering permits, emergency‑services actions, budget amendments, and several contract awards and modifications. Public hearings and a hearing on a utility easement request are scheduled. Additional items will be discussed in executive session.

housingbudgetcontractspublic-hearingsemergency-servicesutilities
✓ Decided: County approved $11.5M loan for affordable housing for homeless

Commissioners Court unanimously approved a $11,503,016 loan to the Urban Empowerment Zone I for affordable housing for individuals experiencing homelessness. The Court also approved a mass‑gathering permit for the Sara Landry event (Aug 8‑10, 2025) at 8509 Burleson Rd., hired a social worker and case manager at the Jonestown Community Center and moved $251,432 in funds to cover their costs, and approved the FY 2026 budget hearings and an Adaptive Workplace Action Plan. Additional items were added to consent, including contracts for water‑cooler stations, insurance, and auto‑parts services.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Tue Jul 22, 2025 · 09:00

Commissioners Court

County to consider $11.5 million affordable‑housing loan for Urban Empowerment Zone

The Travis County Commissioners Court will vote on a loan of up to $11,503,016 for affordable housing for the Urban Empowerment Zone I development. It will also consider several contracts, budget amendments, and a temporary traffic detour on Brita Olson Road. Additional items include proclamations, emergency services pay scales, and public‑hearing scheduling.

housingbudgetcontractsemergency-servicestransportationpublic-hearinghealth
✓ Decided: Court approved limited outdoor burning permits in unincorporated Travis County

The Commissioners Court delegated signing authority to the County Judge for absent members. It unanimously approved two proclamations: Pretrial, Probation and Parole Supervision Week and an honor for Senator Judith Zaffirini. The Court also unanimously revised the burn ban to allow limited outdoor burning with permits and waived permitting, development and septic fees for residents affected by the July 2025 severe weather disaster. Additional actions included approval of the Grandview 620 Apartments development and a $698,900 budget transfer for pre‑trial services.

🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
to approve a proclamation recognizing the week of July 21–27, 2025 as Pretrial, Probation and Parole Supervision Week in Travis County. (Commissioner Gómez) Members of the Court heard from: Rudy…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
to approve a proclamation honoring Senator Judith Zaffirini for her historic achievements, distinguished public service, and extraordinary contributions to the State of Texas. (Judge Brown) Members…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
8 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea July 22, 2025, Minutes of the Travis County Commissioners Court…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
8 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea · Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Margaret Gómez yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Tue Jul 15, 2025 · 09:00

Commissioners Court

Travis County to consider budget amendments and traffic mitigation agreements

The Travis County Commissioners Court will meet to discuss budget transfers, including a $250,000 legal services request and a $713,744 tax rate election fund transfer. The agenda also includes public hearings on utility easements and a Mass Gathering permit, along with traffic mitigation agreements for various developments.

budgettransportationpublic-safetyhousingeasementslegal-servicesparks
✓ Decided: Court approved moving $3 million from emergency reserve to Central Emergency Response Budget

The Commissioners Court unanimously approved a $3 million transfer from the emergency reserve to the Central Emergency Response Budget Department. It also approved a delegation allowing the County Judge to sign documents for absent commissioners, and adopted a list of consent items. Additional unanimous actions included a proclamation for Parks and Recreation Month, opening and closing several public hearings, and authorizing a memorandum of understanding for the “Travis County Cares” disaster‑relief fund.

🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
motion to open the public hearing. The Court asked to acknowledge and include public comments made before formally opening the hearing to be entered for official record for item 4. MOTION: Open the…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
motion to open the public hearing. The Court asked to acknowledge and include public comments made before formally opening the hearing to be entered for official record for item 4. MOTION: Open the…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion July 15, 2025, Minutes of the Travis County Commissioners Court Page 5 SECONDER: Commissioner Precinct 2…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] July 15, 2025, Minutes of the Travis County Commissioners Court Page 13 RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 1 Jeffrey Travillion
3 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jul 8, 2025 · 09:00

Commissioners Court

Travis County considers $11.5 million loan for affordable housing

The Commissioners Court will vote on several contracts, including a significant loan for individuals experiencing homelessness. The body will also address emergency services, public street dedications, and county financial investments.

affordable-housingcontractsemergency-servicesinfrastructurelegal-expenses
✓ Decided: Court approved $4 M emergency reserve transfer and debris‑removal contracts

The Commissioners Court approved a friendly amendment to move forward with debris‑removal contracts, transfer up to $4,000,000 from the Emergency Reserve, and waive trash‑disposal fees. It also adopted a 30‑day outdoor‑burning prohibition in Northwest Austin and waived permitting fees for flood‑damage homeowners who lack insurance coverage. The Court continued the disaster declaration issued on July 5, 2025, and approved a signature‑delegation motion and several consent items, all unanimously.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Fri Jun 27, 2025 · 09:20

Commissioners Court

Court to approve $10.05 million law enforcement records and jail management system contract

The Travis County Commissioners Court will adopt a proclamation for CapMetro Day, approve payment of claims, and receive the FY2024 emergency services audit. It will consider emergency services issues, housing development approvals, and several intergovernmental grant applications. Major contract awards include a $10.05 million law enforcement records and jail management system, a $139,054 water study, a $73,514 equipment purchase, and a $2.5 million small‑business education contract. The Court will also discuss budget reallocations, FY2026 budget updates, and transportation and health matters.

contractsbudgetpublic-safetyhousingtransportationhealth
✓ Decided: County approved $10.05 M law‑enforcement records and jail management contract

The Commissioners Court unanimously approved a proclamation naming July 1 2025 as CapMetro Day and delegated signing authority to the County Judge for absent members. A contract worth $10,054,670.62 for a Law Enforcement Records Management System and Jail Management System was approved by adding it to the consent items. Several other contracts and budget transfers, including a $2.5 M small‑business education award and a $5,309,271 fund transfer, were also approved through the consent motion.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea June 27, 2025 Minutes of the Travis County Commissioners Court…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Consent Motion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jun 24, 2025 · 09:00

Commissioners Court

Travis County to vote on $10 million jail and records management system

The Commissioners Court will consider several high-value contracts and budget transfers, including a multi-family housing project and emergency services pay scales. The body will also discuss property tax exemptions for Central Health and the 89th Texas Legislative Session.

budgethousingpublic-safetycontractstax-exemptionsemergency-services
Tue Jun 17, 2025 · 09:00

Commissioners Court

Approve $6.87 million change order for Balcones Canyonland Preserve road maintenance

The Travis County Commissioners Court will vote on a series of resolutions, proclamations, budget amendments, and contract approvals. Key items include a $6,872,971.45 change order for Balcones Canyonland Preserve road work and several contracts for park services and planning. The Court will also set public hearings on a temporary detour on Brita Olson Road and the renaming of part of Cameron Road to Cameron Circle.

roadscontractsbudgetpublic-hearingsparks
✓ Decided: Court approves $6.87M road maintenance change order for Balcones Canyonland Preserve

The Travis County Commissioners Court unanimously approved three resolutions affirming immigrant due process, Juneteenth and Gun Violence Awareness Month. It added dozens of items to the consent agenda, including multiple contract awards and budget transfers. The most sizable approval was a $6,872,971.45 change order for Balcones Canyonland Preserve road maintenance. Public hearings were scheduled for a Brita Olson Road detour and a Cameron Road renaming.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Jun 12, 2025 · 13:30

Commissioners Court

Commissioners Court holds work session on health and care services

The Commissioners Court will receive a presentation from Integral Care regarding its programs and service impact. The body will also receive a briefing from Central Health on budget actuals and Fiscal Year 2026 budget development.

health-carebudgetpublic-healthintegral-carecentral-health
Tue Jun 10, 2025 · 09:00

Commissioners Court

Travis County approves budget transfers and public service contracts

The Commissioners Court will consider budget amendments transferring $15 million for facility maintenance and $60,000 for pilot training, along with contracts for housing, medical waste, and driver records. The Court will also receive public comments on road right-of-way vacates and approve resolutions regarding species conservation and child care funding.

budgetcontractshousinghealthtransportationparkspublic-safety
✓ Decided: Commissioners approved delegating signing authority to County Judge for absent members

The court unanimously approved a motion allowing the County Judge to sign documents on behalf of commissioners not physically present. Consent items covering agenda items 4‑43 were also approved unanimously. Funding for the Community Advisory Council under the Child Care and Out‑of‑School Time Fund was approved unanimously, and a resolution to conserve at‑risk species was adopted.

🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] June 10, 2025, Minutes of the Travis County Commissioners Court Page 2 RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 1 Jeffrey…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jun 3, 2025 · 09:00

Commissioners Court

Travis County considers funding for medical facility expansions

The Commissioners Court will discuss funding for primary and specialty care facility expansions in Northeast, East, and Central Travis County. The body will also review opioid abatement funding and various infrastructure and contract modifications.

healthcarebudgetroadspublic-healthcontracts
✓ Decided: Court approved opioid abatement funding for 2025‑2026, postponing 2027 request

The Commissioners Court voted 4‑0 to support the 2025 and 2026 opioid‑abatement funding requests while deferring the 2027 request. The Court also appointed Beatriz Arce to the Strategic Housing Finance Corporation board (4‑0) and unanimously approved two proclamations honoring the Lake Travis Fiddlers’ 25th anniversary and Pride Month. All consent items and several contract approvals were adopted unanimously.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: Passed (4-0) MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: Passed (4-0) MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jun 3, 2025 · 16:30

Commissioners Court

County employees will comment on compensation and benefits

The Travis County Commissioners Court will hold an employee hearing to receive comments from county employees about their compensation and benefits. No formal action or vote is scheduled; the meeting is for public comment.

employee-compensationbenefitscourthuman-resourcespublic-hearing
Tue May 20, 2025 · 09:00

Commissioners Court

County approves $544,832 contract for Network Analytics Tool

The Travis County Commissioners Court will consider public comments on drainage easements and electric easement vacancies, adopt several proclamations, and approve multiple contracts and budget items. The Court will also set public hearings on a temporary traffic detour on Williamson Road and a right-of-way vacancy on Jingle Drive. Additional items include approvals for housing development projects and health program grants.

contractsbudgettransportationpublic-hearingtechnologyhousing
✓ Decided: Court approves Thaxton Road Apartments multi‑family development (4‑0)

The Commissioners Court delegated signing authority to the County Judge and approved a large set of consent items unanimously. It opened and closed three public hearings, adopted several proclamations, and approved a no‑objection resolution for Branchview Apartments. The Court also approved the Thaxton Road Apartments multi‑family project with a 4‑0 vote (one abstention). Additional motions on childcare funding were approved unanimously.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Wed May 14, 2025 · 18:00

Commissioners Court

Commissioners Court notice for Love of Parks Festival

The provided document is a notice that a quorum of the Commissioners Court may attend the Love of Parks Festival. No official business, decisions, or legislative items are listed for this meeting.

community-eventparks
Tue May 13, 2025 · 09:00

Commissioners Court

Court approves multiple contracts including a $220,000 peer support services award

The Travis County Commissioners Court will vote on a series of contract approvals and terminations, including a $220,000 award for peer support specialist services and a $210,000 architectural services contract. It will also consider budget amendments, investment authority for county funds, and several personnel and licensing matters. Additional items include proclamations, interlocal agreements, and public‑safety related actions.

budgetcontractspublic-safetyhealthinfrastructure
✓ Decided: County Court creates healthcare data analyst role, approves budget items

The Commissioners Court approved a motion delegating signing authority to the County Judge and approved a large set of consent items covering budget amendments, contracts and terminations. It created and funded a new healthcare data analyst position, approved a university fellowship agreement, and adopted a formal compensation appeal process. The Court also filled at-large and functional seats on the Compensation Committee and took no action on outdoor burning and emergency response matters.

🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED-UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 4 Margaret Gómez
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
to approve a formal compensation appeal process for market salary surveys. (Commissioners Travillion & Gómez) Members of the Court heard from: June Mighty, Director, Human Resources Management…
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue May 6, 2025 · 09:00

Commissioners Court

Travis County approves contracts and proclamations for May 6 meeting

The Travis County Commissioners Court will consider approving contracts for legal services, toxicology testing, and a courthouse renovation, along with proclamations for Air Quality Awareness Week and Employee Recognition Day.

budgetcontractsproclamationshealthsafetyhousingtransportation
✓ Decided: Court approved $3.2M contract for Diversion Center and Central Booking project

The Commissioners Court approved a $3,223,360 contract award to Brinkley Sargent Wiginton Architects, Inc. for professional consulting services for the Diversion Center and Central Booking Intake Facility and Parking Structure. The Court also approved a restructuring of the Compensation Committee, expanding it from five to seven at‑large seats. Several proclamations and procedural motions were approved unanimously.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
to approve a proclamation declaring Tuesday, May 6, 2025, as Employee Recognition Day. (Commissioners Travillion & Gómez) Members of the Court heard from: June Mighty, Director, Human Resources…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Call to Order
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Consent Motion [Approve Consent Items 6, 8, 9. a-c, 10.b-c, 12, 13, 14 (Budget Amendments N1, A1, A2, and T1), 15, 1]
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Consent Motion [Approve Consent Items.]
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Thu May 1, 2025 · 13:30

Commissioners Court

Court to consider appointment of tenant representative for Strategic Housing Finance Corp.

The Commissioners Court will receive a briefing and update on the deployment, arrangement, and implementation of security devices and personnel. The Court will also consider and take action on appointing a tenant representative to the Strategic Housing Finance Corporation, including approving interview questions, conducting interviews, and making a final selection. Both items may be taken into executive session under applicable Government Code provisions.

securityhousingpersonnelappointmentsexecutive-session
✓ Decided: Commissioners unanimously approved interview questions for housing tenant rep

The court discussed security device deployment in executive session. Interview questions for the Strategic Housing Finance Corporation tenant representative position were approved unanimously. The court discussed conducting interviews and postponed making a final selection.

Tue Apr 29, 2025 · 09:00

Commissioners Court

Travis County considers issuing over $150 million in bonds

The Commissioners Court will vote on authorizing several bond series for roads, permanent improvements, and certificates of obligation. The body will also address wildfire preparedness and animal control regulations.

bondsbudgetanimal-controlwildfiresinfrastructurecontracts
✓ Decided: Court approves budget amendments, including EMS pay scale and CSCD support

The Travis County Commissioners Court approved several consent items and proclamations unanimously. It opened and then closed a public hearing on a utility easement in Precinct Four. The Court directed staff to develop an EMS pay scale for STAR Flight, also unanimously. Budget Amendment O3 was approved unanimously, and Budget Amendment A3 was approved 4‑0 with one abstention, adding support for the Community Supervision and Corrections Department.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 1 Jeffrey Travillion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Apr 15, 2025 · 09:00

Commissioners Court

Court approves $810,785.70 contract for Williamson Road Drainage Improvements

The Commissioners Court will hear public comments on the Branchview Apartments project and on assessments for the WildHorse Ranch Public Improvement District. The Court will adopt several proclamations recognizing awareness weeks and months, and will consider budget, emergency services, and intergovernmental grant items. It will also approve multiple contracts and set a public hearing for a Beckham Drive right‑of‑way request.

contractsbudgettransportationpublic-hearingspublic-safetyintergovernmentalplanning
✓ Decided: Travis County Court appoints Gary Howell as Fire Marshal

The Commissioners Court unanimously appointed Gary Howell as Travis County Fire Marshal for a two‑year term starting May 26, 2025. The Court also tabled the Branchview Apartments no‑objection resolution for 30 days and approved several proclamations recognizing Child Abuse Prevention Month, After‑school Professionals Week, National Public Safety Telecommunicator Week, Prescription Drug Take Back Day, and National Fair Housing Month. All listed consent items were approved unanimously.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
to approve a proclamation recognizing the week of April 21st - 25th, 2025 as After-school Professionals Week in Travis County. (Judge Brown & Commissioner Travillion) April 15, 2025, Minutes of the…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
to approve a proclamation recognizing the week of April 14th - 20th, 2025 as National Public Safety Telecommunicator Week in Travis County. (Judge Brown) Members of the Court heard from: Kristen…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 1 Jeffrey Travillion April 15, 2025, Minutes of the Travis County Commissioners Court…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · County Judge yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Tue Apr 8, 2025 · 09:00

Commissioners Court

Travis County to consider road safety funding and shelter contract modifications

The Commissioners Court will discuss contract modifications for the Camp Esperanza Emergency Shelter and safety improvements for Old Kimbro Rd and Dessau Rd. The body will also vote on several personnel appointments and grant applications.

roadshousingpublic-safetycontractszoning
✓ Decided: County approved counter‑offer to purchase 45‑acre parcel in Precinct 3

The Court unanimously approved a series of proclamations honoring Vicki Ashley’s retirement, recognizing April 2025 as Sexual Assault Awareness Month, and designating the week of April 5‑11 as the Week of the Young Child. It also approved the Camp Esperanza emergency shelter briefing, a grant letter of intent for the Outdoor Recreation Legacy Partnership, and added several items to the consent agenda. In executive session, commissioners unanimously approved the termination of county occupancy on Double Elm Drive and a counter‑offer to acquire a 45‑acre parcel near Onion Creek as part of the Strategic Parkland Bond Program.

Thu Apr 3, 2025 · 13:30

Commissioners Court

Commissioners Court to receive briefing on the future of the Travis County Exposition Center

The Travis County Commissioners Court will hold a work session on April 3, 2025. Commissioners will receive a staff briefing on the future of the Travis County Exposition Center. They will also receive an update on the Travis County Climate Action Plan for internal operations and a discussion of carbon sequestration and offsets. No formal decisions are listed; the items are informational briefings.

exposition-centerclimate-actionenvironmentcounty-governmentbriefings
Tue Apr 1, 2025 · 09:00

Commissioners Court

County considers traffic‑mitigation agreement for Cirque Estates development

The Travis County Commissioners Court will vote on a range of items, including public comments on a right‑of‑way vacating request for Rinard Road, proclamations for Earth Month and a community leader, and several contract approvals. The Court will also address emergency services policies, a residency program with Baylor Scott & White Medical Center‑Temple, budget authorizations, and licensing for yoga classes at East Metropolitan Park. Executive‑session items include a possible central‑Austin property acquisition and the appointment of a Fire Marshal.

contractsbudgettransportationhealthemergency-servicesintergovernmental-relationsplanning
✓ Decided: Travis County Court unanimously authorized litigation against Texas rule

The Commissioners Court unanimously approved a motion to authorize the Travis County Attorney to pursue litigation challenging Chapter 56 of Title I of the Texas Administrative Code. The court also appointed Kerri Dorman to the non‑tenant position on the Strategic Housing Finance Corporation board and approved a license agreement for private yoga classes at East Metropolitan Park. Additional unanimous actions included approving proclamations for Earth Month and for AFSCME member Pedro Villalobos, and authorizing the filing to vacate a section of right‑of‑way on Rinard Road.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
to approve a Proclamation recognizing April 2025 as Earth Month in Travis County. (Commissioner Gómez) Members of the Court heard from: Emily Ackland, Division Director, Environmental Quality…
3 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 2 Brigid Shea
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · County Judge yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea
Thu Mar 27, 2025 · 13:30

Commissioners Court

Commissioners Court to receive housing finance and project office updates

The Travis County Commissioners Court will hold a work session to receive an update from the Strategic Housing Finance Corporation of Travis County. The Court will also receive an update on the County Project Management Office. No decisions or actions are listed; the items are informational updates.

housingfinanceproject-managementcounty-governmentupdates
Tue Mar 25, 2025 · 09:00

Commissioners Court

County to approve up to $4.47 M affordable‑housing loan for Cairn Point Montopolis

The Travis County Commissioners Court will consider a subaward and loan documents to provide up to $4,474,947 for affordable housing for individuals experiencing homelessness at the Cairn Point Montopolis development. The Court will also hear public comments on the Community Development Block Grant and HOME program action plan, approve a proclamation for Gideon Day, and take action on several contract modifications and award approvals. Additional items include a $1,500 snack purchase for STAR Flight EMS Week and various personnel and budget matters.

affordable-housingcontractsbudgetpublic-healthtransportationprocurement
✓ Decided: Court approved $4.47M affordable‑housing subaward for homeless individuals

The Commissioners Court unanimously approved a $4,474,947 subaward to Cairn Point Montopolis for affordable housing for people experiencing homelessness. It also approved shortening public comment time to two minutes, adopted a proclamation for Gideon Day, and approved numerous contracts and modifications through consent items. The public hearing on the CDBG/HOME Action Plan was opened, tabled, reopened, and closed by unanimous vote.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Mar 18, 2025 · 09:00

Commissioners Court

County approves $3.8 million energy assistance grant for low‑income residents

The Travis County Commissioners Court will consider a series of resolutions, proclamations, grant agreements, contracts, and budget items. Items include a proclamation for World Water Day, a resolution opposing elimination of the Countywide Polling Place Program, and approval of several grant agreements totaling over $4 million for energy assistance, weatherization, and recreational trails. The Court will also approve contracts such as a $1,383,027.00 security system upgrade, a $145,007.64 change order for a public defender renovation, and a $65,000.00 marketing plan for county parks. Additional actions involve interlocal agreements for emergency response, personnel matters, and licensing for early voting sites.

grantscontractsemergency-serviceshealth-human-servicesbudgetplanningtransportation
✓ Decided: Travis County approves consent agenda with 34 items, including grants and contracts

The Travis County Commissioners Court approved a consent motion covering 34 items, including grant agreements, contracts, and resolutions, all unanimously. A proclamation recognizing World Water Day was also approved. No substantive decisions were made outside the consent agenda; the meeting was largely procedural.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Mar 13, 2025 · 15:00

Commissioners Court

County to consider $8M wildfire defense grant with $2.67M match

The Commissioners Court will consider a Letter of Intent to apply for the Community Wildfire Defense Grant – South. The grant, offered by the U.S. Forest Service, totals $8,000,000 for the Transportation, Natural Resources, and Emergency Services departments. The County would need to provide a matching contribution of $2,666,667. The Court will decide whether to proceed with the application.

grantswildfirepublic-safetybudgetemergency-services
✓ Decided: County approves $8M wildfire defense grant application

The Travis County Commissioners Court unanimously approved a Letter of Intent to apply for a $8,000,000 Community Wildfire Defense Grant from the U.S. Forest Service, with a required county match of $2,666,667. The motion was made by Commissioner Ann Howard and seconded by Judge Andy Brown. No other substantive decisions were made during this special voting session.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: County Judge Andy Brown
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · County Judge yea
Thu Mar 13, 2025 · 13:30

Commissioners Court

Commissioners Court to receive Integral Care presentation and Risk Program update

The Commissioners Court will receive a presentation from Integral Care covering its programs, performance, and finances. The Court will also receive an update on the County’s Risk Program, including key initiatives, current challenges, and future plans. No formal actions or votes are listed for these items.

healthcarerisk-managementcounty
Tue Mar 11, 2025 · 09:00

Commissioners Court

Travis County considers $4.47M loan for homeless housing development

The Commissioners Court will vote on several high-value contracts for infrastructure and social services. Key items include funding for affordable housing, childcare services, and road improvements. The body will also discuss legislative priorities and the County Safety Action Plan.

affordable-housingroadschild-caregrantspublic-safety
✓ Decided: Court approves outdoor burn ban, Central Health appointments, road safety goals

The Travis County Commissioners Court approved an order prohibiting outdoor burning in unincorporated areas, appointed Geronimo Rodriguez and Amit Motwani to the Central Health Board of Managers, and endorsed a goal of zero roadway fatalities by 2050. A large consent agenda covering contracts, grants, and personnel actions was approved unanimously. Several items were discussed in executive session with no public action.

🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 1 Jeffrey Travillion
3 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
3 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea
to approve a proclamation recognizing the month of March as Professional Social Work Month in Travis County. (Judge Brown & Commissioner Gómez) Members of the Court heard from: Melissa Shearer…
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 3 Ann Howard
3 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea
[context] RESULT: PASSED (3-1) MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 3 Ann Howard
3 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 1 Jeffrey Travillion
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS March 11, 2025, Minutes of the Travis County Commissioners Court Page 11 MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 4…
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 1 Jeffrey Travillion
3 yea
Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Call to Order
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Thu Feb 27, 2025 · 13:30

Commissioners Court

Travis County to interview Central Health Board candidates

The Travis County Commissioners Court will conduct interviews for a County appointment to the Central Health Board of Managers and receive an update from the Housing Authority of Travis County.

central-healthhiringhousingtravis-countyboard-of-managers
✓ Decided: Commissioners Court approves interview questions for Central Health appointment

The Travis County Commissioners Court held a special voting session on February 27, 2025. They unanimously approved edits to interview questions for the Central Health Board of Managers appointment. Interviews of three finalists were conducted and discussed, but no appointment was made. The court also received an update from the Housing Authority of Travis County, which was discussed without formal action.

Tue Feb 25, 2025 · 09:00

Commissioners Court

County will consider a $1 million loan to fund affordable housing development

The Commissioners Court will vote on a $1,000,000 loan agreement with the Central Texas Housing Accelerator Fund, LLC to develop affordable housing. They will also consider a range of items including mass gathering permits for the Luck Reunion event, several grant continuations and contract awards totaling several hundred thousand dollars, and a WildHorse Ranch PID Community Benefit Fee Escrow Agreement. Additional actions include approving proclamations, authorizing the County Treasurer to invest funds, and reviewing budget guidelines for FY 2026.

affordable-housingloanscontractsgrantsemergency-servicesbudgetingproclamations
✓ Decided: Travis County approves FY 2026 budget guidelines and wildfire grant application

The Commissioners Court approved the Fiscal Year 2026 Budget Guidelines and directed staff to submit a Letter of Intent for the Community Wildfire Defense Grant, with a friendly amendment prioritizing county-owned land. The court also approved a Mass Gathering Permit for Luck Reunion, several proclamations, and numerous consent agenda items including contracts for housing and early childhood services. Several items were postponed or discussed without action.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
to approve a proclamation recognizing the Alpha Kappa Zeta Chapter of Zeta Phi Beta Sorority, Inc. for 85 years of service in Austin, Texas and the Travis County community. (Commissioner Travillion)…
4 yea
Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Feb 11, 2025 · 09:00

Commissioners Court

County approves $3.4 M elevator modernization at 700 Lavaca Street

The Travis County Commissioners Court will adopt several proclamations and budget items, consider emergency services matters, and vote on multiple procurement contracts. Notable contracts include a $3,404,218 elevator upgrade at the County Administration Building and a $407,450 agreement with Killeen Glass & Mirror for window‑film and door replacements. The Court will also set a public hearing for a Mass Gathering Permit for the Luck Reunion event at 1100 Bee Creek Road and consider an annexation request for portions of Steger Lane and Cameron Road in Precinct One.

procurementinfrastructurebudgetpublic-safetyannexationgrant
✓ Decided: Travis County approves consent agenda, proclamations, and appointments

The Travis County Commissioners Court approved a large consent agenda covering payments, reports, contracts, and grants, along with three proclamations and several appointments. The court also approved an interlocal agreement for early childhood care services and extended a contract for land purchase near Onion Creek. No substantive policy decisions were made beyond routine approvals.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 2 Brigid Shea SECONDER: Commissioner Precinct 3 Ann Howard
3 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 3 Ann Howard SECONDER: Commissioner Precinct 2 Brigid Shea
7 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
to approve an Interlocal Agreement with Worksource – Greater Austin Area Workforce Board DBA Workforce Solutions for the provision of Early Childhood Care Services and Wage Stipends. (Judge Brown &…
4 yea
Andy Brown yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion [Approve Consent Items]
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion [Approve Consent Items 4, 5, 8, 9, 10, 12.a-d, 15, 16, 17, 18, 19, 20, 21, 22.a-c, 23, 24, 25, 26, 27]
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Feb 4, 2025 · 09:00

Commissioners Court

Travis County to consider eminent domain for Spicewood Springs Road project

The Travis County Commissioners Court will meet to approve payments, contracts, and budget amendments. The court will also consider authorizing the use of eminent domain to acquire land for the Spicewood Springs Low Water Crossing Project and approve various grant applications and interlocal agreements.

budgetcontractseminent-domaingrantshousingroadssecuritytransportation
✓ Decided: Travis County approves eminent domain for Spicewood Springs project

The Travis County Commissioners Court approved a resolution authorizing the use of eminent domain to acquire two parcels owned by the City of Austin for the Spicewood Springs Low Water Crossing Project. The court also approved a temporary road detour on Siesta Shores Drive for construction, and directed staff to collaborate with Central Health on financial policy amendments. Most other agenda items were approved as part of a consent motion.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: County Judge Andy Brown SECONDER: Commissioner Precinct 1 Jeffrey Travillion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Thu Jan 30, 2025 · 13:30

Commissioners Court

Commissioners Court to receive Project Management Office update

The Travis County Commissioners Court is holding a work session to discuss a specific administrative update. The meeting consists of a single agenda item regarding the Project Management Office.

county-administrationproject-management
Tue Jan 28, 2025 · 09:00

Commissioners Court

County approves $84,663 LeadsOnline software contract for criminal investigations

The Travis County Commissioners Court will vote on a range of items including a public comment period for a temporary traffic detour on Siesta Shores Drive, several proclamations, and multiple interlocal agreements. It will also consider budget exceptions, contract awards, and contract modifications affecting public health, emergency services, and youth programs. The agenda includes approval of a $84,663 contract with LeadsOnline for software, support, and services for criminal investigations.

contractsbudgetpublic-hearingsemergency-servicesinterlocal-agreementstransportation
✓ Decided: Court expands Counsel at First Appearance to two daily shifts

The Travis County Commissioners Court approved expanding the Counsel at First Appearance (CAFA) program from one to two shifts per day, authorizing the creation and posting of 43 full-time employee positions. The court also approved a large consent agenda covering numerous contracts, agreements, and appointments, and unanimously approved joining amicus briefs in two federal lawsuits challenging federal immigration actions. Several items were discussed, postponed, or required no action.

🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 1 Jeffrey Travillion SECONDER: Commissioner Precinct 4 Margaret Gómez
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
[context] RESULT: APPROVED - UNANIMOUS MOVER: Commissioner Precinct 4 Margaret Gómez SECONDER: Commissioner Precinct 2 Brigid Shea
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · County Judge yea
Call to Order
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea
Tue Jan 21, 2025 · 09:00

Commissioners Court

Travis County to approve contracts for road projects and housing construction

The Travis County Commissioners Court will consider approving contracts for road engineering and indigent burial services, as well as a $1.92 million agreement for affordable housing construction. The court will also discuss budget amendments and personnel actions.

budgetcontractshousingroadspersonnelpurchasing
Tue Jan 14, 2025 · 09:00

Commissioners Court

Commissioners Court to vote on emergency services, road projects, and contracts

The Travis County Commissioners Court will vote on reappointments for emergency services districts, approve a public hearing for a traffic restriction on Siesta Shores Dr., and consider the termination of two contracts and a modification to a design contract.

governmentemergency-servicestransportationcontractspublic-hearingbudget
✓ Decided: Court approves consent agenda, proclamations, and ESD reappointments

The Travis County Commissioners Court approved a consent motion covering 12 items, including budget amendments, contracts, and personnel actions, all unanimously. They also approved a proclamation for National Stalking Awareness Month, reappointed members to three Emergency Services District boards, and approved a new call-in process for public comment. No action was taken on outdoor burning or the Dell Medical School agreement, and several items were discussed without a vote.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Motion
4 yea
Andy Brown yea · Jeffrey Travillion yea · Ann Howard yea · Margaret Gómez yea
Tue Jan 7, 2025 · 09:00

Commissioners Court

Commissioners Court to consider $10.9 million Taser equipment contract

The Travis County Commissioners Court will vote on several high-value procurement contracts and grant agreements. The body will also hold a public hearing regarding easements on Lipan Trail and discuss emergency responses to natural disasters.

public-safetycontractszoninggrantsemergency-servicesbudget
✓ Decided: Commissioners approve consent agenda with $10.95M Taser contract

The Travis County Commissioners Court approved a 23-item consent agenda unanimously, including a $10,952,124.71 contract for law enforcement Taser equipment and a $2,646,459.00 STAR Flight parts purchase. They also approved a unanimous motion to release drainage and utility easements at 1903 and 1905 Lipan Trail. No other substantive decisions were made; several items were discussed or required no action.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Motion
5 yea
Andy Brown yea · Jeffrey Travillion yea · Brigid Shea yea · Ann Howard yea · Margaret Gómez yea