Rice County public meetings in 2021
85 substantive meetings from 2021, with official agendas or minutes and plain-English summaries.
Tue Dec 28, 2021 · 08:30
Board of Commissioners
County Board sets 2022 salaries for sheriff, attorney, commissioners
The Rice County Board of Commissioners will meet to approve routine items and set 2022 salaries for the sheriff, county attorney, and commissioners. They will also consider renewing contracts for physical therapy and registered nurse services, accepting donations for children and families, and approving a final payment for a highway construction contract.
- Setting 2022 salary for Rice County Sheriff
- Setting 2022 salary for County Attorney
- Setting 2022 Commissioner Salary & Per Diem
- Final payment to RAW Construction LLC, Contract #21-50
- Ratification of MOA to continue Emergency Paid Sick Leave
budgetsalariescontractshighwaypublic-healthsocial-services
✓ Decided: Rice County Board approves $2.27M in bills, new hires, and salary resolutions
The Rice County Board of Commissioners met on December 28, 2021, and approved a consent agenda that included $2,268,385.06 in bills, personnel appointments, and other routine items. They also approved a $26,650 annual contract for a Zix security suite, disaster abatement credits for two taxpayers, and several health and social services agreements. Resolutions were adopted to set salaries for the Sheriff, County Attorney, and Commissioners for 2022, and the board approved continuing emergency paid sick leave for both union and non-union employees. All votes were unanimous (5-0).
- Approved CIT quote for Zix security suite at $26,650/year (5-0)
- Approved disaster abatement credits for two taxpayers (5-0)
- Approved renewal agreement for home-based physical therapy with Kristin Cook (5-0)
- Approved agreements with RNs Gail Hoxie-Setterstrom and Jane Egerdal (5-0)
- Approved final payment of $28,031.04 to RAW Construction LLC (5-0)
- Approved consent agenda including $2,268,385.06 in bills and personnel appointments (5-0)
- Adopted Resolution #21-052 setting Sheriff's salary (5-0)
- Adopted Resolution #21-057 setting County Attorney's salary (5-0)
🗳️ How they voted (17 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Dave Miller, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the December 14, 2021, Board of Commissioners Meeting Minutes. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve CIT quote 013418 for Zix security suite for $26,650 per year. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Local Option Disaster Abatement and Credit for both of the taxpayers who applied: 1) Bryan & Mandy Gill, 17959 Roberds Lake Blvd…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the annual list of changes as presented by the County Assessor, to be kept on file at the Rice County Assessor's Office for public…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the renewal agreement with Kristin Cook for home based physical therapy services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the agreements between Rice County Public Health and Registered Nurses: Gail Hoxie-Setterstrom and Jane Egerdal for professional RN…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Acceptance of Donations for Children and Families in Need. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Social Services Contracts as Presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve final payment in the amount of $28,031.04 to RAW Construction LLC for work completed under contract # 21-50. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve a MOA for continuing the Emergency Paid Sick Leave for Union employees. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the adoption of continuing the Emergency Paid Sick Leave for Non-union employees. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-052 Setting the Salary for the Rice County Sheriff. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-057 Setting the Rice County Board of Commissioners Page 3 December 28, 2021 Salary for the Rice County Attorney. RESULT…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adopt Resolution #21-053 Setting the 2022 Commissioner Salary & Per Diem. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Dec 21, 2021 · 08:30
Committee of the Whole
County Board reviews 2022 salary, public safety building schedule
The Rice County Committee of the Whole will hold a work session to discuss the 2022 salary for the Attorney's Office, receive updates from Finance and Highway departments, and review the schedule for the Public Safety Building Project. Public comments are limited to two minutes per person.
- 2022 salary discussion for Attorney's Office
- Finance Department update
- Review of Public Safety Building Project schedule
- Highway updates
budgetpublic-safetyhighwaycounty-boardsalaries
Tue Dec 14, 2021 · 08:30
Board of Commissioners
County Board to adopt 2022 budget, levy, and fee schedule
The Rice County Board of Commissioners will vote on the 2022 budget and property tax levy, as well as the 2022 fee schedule. They will also consider several resolutions, including adopting the Greater Zumbro Watershed Management Plan, approving an opioid settlement, and applying for a voting equipment grant. Other items include appointments, plat waivers, and various contracts and payments.
- Resolution #21-056: Levying tax on taxable property & adopting 2022 budget
- 2022 Fee Schedule
- Resolution #21-050: Adopt Greater Zumbro Comprehensive Watershed Management Plan
- Resolution #21-055: Approving Nationwide Opioid Settlement
- Final payments for highway contracts: #2175 (Richland Township bridge), #2171 (Crane Creek asphalt), #2173 (County 6 pavement)
budgettax-levyfee-schedulewatershedopioid-settlementhighwaypublic-safety
✓ Decided: County adopts 2022 budget and tax levy
The Rice County Board of Commissioners approved the 2022 budget and tax levy, along with the 2022 fee schedule. They also approved several contracts, grants, and appointments, including a watershed management plan, a voting equipment grant application, and a conference room technology installation. All decisions were approved unanimously except for a few items where Commissioner Malecha dissented.
- Adopted Resolution #21-056 levying tax and adopting 2022 budget (5-0)
- Approved 2022 Fee Schedule (5-0)
- Adopted Greater Zumbro Comprehensive Watershed Management Plan (5-0)
- Approved conference room technology installation not to exceed $38,925.52 (5-0)
- Approved final payment of $148,834.25 to BCM Construction for bridge replacement (5-0)
- Approved final payment of $79,676.97 to Crane Creek Asphalt (5-0)
- Approved final payment of $24,075.10 to McNamara Contracting for bituminous rehab (5-0)
- Approved Public Safety Center Schematic Design (4-1)
🗳️ How they voted (31 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Galen Malecha, to approve the agenda as amended to add Acceptance of Donations letter B under Social Services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to request the approval of minutes from regular meeting on November 23, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt Resolution #21-050 and Implement the Greater Zumbro Comprehensive Watershed Management Plan. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jeff Docken, seconded by Dave Miller, to appoint Julia Hogan to the Planning Commission/Board of Adjustment for a 3-year term commencing January 1, 2022 through December 31, 2024. RESULT…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Mark Pavek. This property is located in…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Kevin Remund. The property is located in…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Preliminary Plat with the conditions and findings recommended by the Planning Commission for John Jasinski, on behalf of landowners…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve Social Services Department Grant Agreement with Minnesota Department of Public Safety. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the acceptance of donations to Social Services for children and families in need. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve installation of conference room technology in the Veterans Auditorium at the Courthouse as proposed by Tierney Brothers in quote 220207…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the continuation of the Wellness Works Program for 2022 for eligible full-time and part-time employees. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the one day gambling license for Holy Cross Catholic 6100 37th ST W Webster, MN 55088 on March 1st, 2022. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jeff Docken, to approve Resolution #21-054 for Rice County's Application for Funding from the Voting Equipment Grant. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve Final Payment on Contract # 2175, to BCM Construction, in the amount of $ 148,834.25 for the replacement of old bridge #88059, on 230th…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve Final Payment for contract # 2171 to Crane Creek Asphalt in the amount of $ 79,676.97. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve Final Payment of contract # 2173, to McNarmara Contracting Inc., in the amount of $24,075.10 for the bituminous rehabilitation of County…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve declaring the Veteran Services 2003 Dodge Caravan Van as county surplus. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the DNR Chronic Wasting Disease Management Deer Hunt. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve requesting proposals for electrical services for the county. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve requesting proposals for design services for the Sheriff's Office Storage Facility. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Thu Dec 2, 2021 · 18:00
Committee of the Whole
County board to hold 2022 Truth in Taxation public hearing
The Rice County Committee of the Whole is meeting for a work session. The only substantive item is a public hearing on the 2022 Truth in Taxation, where residents can comment on the proposed property tax levy. Public comments are limited to two minutes per person.
- 2022 Truth in Taxation public hearing
- Public comments limited to 2 minutes per person
taxespublic-hearingcounty-board
320 3rd Street NW, Faribault
Thu Dec 2, 2021 · 18:30
Board of Adjustment
Board to hear four variance requests, including large garage and ag building
The Rice County Board of Adjustment will hold a public hearing on four variance applications. The board will decide whether to approve, deny, or continue each request after hearing from staff, applicants, and the public. The items involve property in Wheatland, Morristown, and Wells townships.
- Variance for 720-sqft garage (600-sqft over limit) and 2-ft setback variance at 10845 Union Lake Trail, Montgomery (PID 01.33.2.50.001)
- Variance for 3,872-sqft agricultural storage building (2,672-sqft over limit) and 7-ft height variance (23-ft peak) in Wheatland Township (PID 01.32.2.25.001)
- Two 5-ft setback variances for new property line between buildings at 7822 and 7823 3260th St W, Morristown (PID 13.36.2.00.001)
- Four variances from 100-ft minimum lot width for replatted lots in Jasinki Landing and French Lake Park subdivisions, Wells Township (multiple PIDs)
variancezoningshorelandagriculturepublic-hearing
320 3rd Street NW, Faribault
Thu Dec 2, 2021 · 18:30
Planning Commission
Planning Commission to review three land-use requests in Rice County
The Rice County Planning Commission will hold a public hearing on three land-use applications: two waivers of plat using Transfer Development Rights and one preliminary plat for a subdivision replat. The commission will make recommendations on these items, which will then go to the County Board on December 14, 2021.
- Waiver of Plat for Mark Pavek to create a 1.65-acre parcel via TDR in Webster Township (PID 02.03.1.75.003)
- Preliminary Plat for John Jasinski to replat parts of Jasinski Landing and French Lake Park subdivisions into four lots and one outlot in Wells Township (PID 10.07.1.51.004, etc.)
- Waiver of Plat for Kevin Remund to enlarge a home parcel from 1 to 2.18 acres and separate another home onto 5 acres in Morristown Township (PID 13.36.2.00.001)
zoningplatsubdivisiontransfer-development-rightsagriculturalshoreland
320 3rd Street NW, Faribault
Tue Nov 23, 2021 · 08:30
Board of Commissioners
Rice County Board discusses solid waste plan, employee policies, and property purchases
The Board of Commissioners will consider the 2021 Rice County Solid Waste Plan and a mandatory vaccination policy for certain employees. The agenda includes several conditional use permits and a closed session to discuss a property purchase.
- Resolution #21-051: Adoption of the 2021 Rice County Solid Waste Plan
- Conditional Use Permit/Johnson (Reisinger) - Section 1, Webster Township
- Conditional Use Permit/Whispers of Hope (Metcalf-Filzen) - Section 25, Walcott Township
- Adoption of Mandatory Vaccination Policy for CMS-covered employees
- Closed Session to discuss the purchase of property
solid-wastezoningemploymentgovernment-administrationproperty-acquisition
✓ Decided: Rice County Board approves $1.3M in bills, new tech, and solid waste plan
The board approved the consent agenda including $1,306,102.50 in bills and several personnel appointments. They also approved the purchase of an Aruba Clearpass network access control system for up to $30,386 with ARPA funds, adopted the 2021 Rice County Solid Waste Plan, and approved two conditional use permits and a waiver of plat. Additionally, they set a public hearing for the 2022-2031 Transportation Improvement Plan and adopted a mandatory vaccination policy for employees covered under the CMS rule.
- Approved agenda and minutes of November 9, 2021 meeting.
- Adopted Resolution #21-049 confirming special assessments for delinquent utilities at Roberds Lake.
- Approved purchase of Aruba Clearpass system from CIT for up to $30,386 with ARPA funds.
- Adopted Resolution #21-051 adopting the 2021 Rice County Solid Waste Plan.
- Approved conditional use permits for Nick Johnson (Webster Township) and Tammy Metcalf-Filzen (Walcott Township), and a waiver of plat for Whispers of Hope.
- Set public hearing for January 11, 2022, on the 2022-2031 Transportation Improvement Plan.
- Approved consent agenda including $1,306,102.50 in bills and personnel appointments.
- Adopted Resolution #21-048 re-appointing the Veterans Services Officer, extended vacation carryovers, and adopted mandatory vaccination policy for CMS-covered employees.
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Dave Miller, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the minutes of the regular meeting from November 9, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adopt Resolution #21-049, Roberds Lake Adopting & Confirming Special Assessments for Delinquent Utilities. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve purchase of Aruba Clearpass Network Access Control system from CIT as quoted for up to $30,386 with ARPA funds. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adopt Resolution #21-051 Adoption of the 2021 Rice County Solid Waste Plan. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Nick Johnson, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Tammy Metcalf- Filzen, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Tammy Metcalf-Filzen, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, To set Tuesday, January 11, 2022, at 9:00AM as a Public Hearing on the proposed 2022-2031 Transportation Improvement Plan. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Consent Agenda as presented. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adopt Resolution #21-048 the Re- Appointment of the Veterans Services Officer. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adopt the options for extending the Maximum Year-end Vacation Carryovers for Non-Union and Pending Ratification of a MOA by any applicable Union…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Adoption of Mandatory Vaccination Policy for Employees covered under the Center for Medicare and Medicaid (CMS) Rule. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to move into CLOSED SESSION. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to move out of CLOSED SESSION. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Nov 16, 2021 · 08:30
Committee of the Whole
County board to review 10-year highway plan, safety center update
The Rice County Committee of the Whole will hear updates from the Highway Department, including a draft 10-year Transportation Improvement Program (T.I.P.), and receive an update on the Rice County Public Safety Center from Parks & Facilities. Public comments on agenda items are allowed at the start, limited to two minutes per person.
- Draft 10-year T.I.P. presentation by Dennis Luebbe
- Rice County Public Safety Center update by Matthew Verdick
- Public comment period for agenda items
highwaytransportationpublic-safetycounty-boardmeeting
✓ Decided: County board reviews public safety center draft plans
The Rice County Committee of the Whole met on November 16, 2021, and heard updates from the County Engineer on the I-35 interchange progress and a potential public hearing for the 10-year Transportation Information Plan. The board also reviewed draft plans for the Rice County Public Safety Center, presented by the Parks & Facilities Director and architects. No formal decisions were made; the meeting was adjourned with a unanimous vote.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Nov 9, 2021 · 08:30
Board of Commissioners
Rice County Board of Commissioners meeting on November 9, 2021
The Board of Commissioners will review several administrative and departmental items. Discussions include special assessments for Circle Lake Improvement, social services contracts, and sheriff salary structures.
- Resolution #21-046: Adopting and Confirming Special Assessments for 2022 Circle Lake Improvement
- Resolution #21-047: Conveyance of Tax Forfeited Property to Rice County
- Social Services Department Contract Amendment with KCQ, Inc.
- Establishment of salary and benefit payout for the Rice County Sheriff appointment
- Ratification of the 2022, 2023 & 2024 Correctional Officers Sergeant LELS Local 438 Union Contract
governmenttaxationsocial-serviceslaw-enforcementpublic-safetylabor
✓ Decided: Board approves 2022 special assessments, tax-forfeited property conveyance
The Rice County Board approved all agenda items unanimously, including resolutions for 2022 Circle Lake Improvement special assessments and conveyance of tax-forfeited property to the county. They also approved the consent agenda with bills totaling $619,987.49, personnel appointments, and a union contract for correctional officers. No items were denied or tabled.
- Approved $28,072.44 Adobe Acrobat licensing payment to CIT (4-0)
- Adopted Resolution #21-046 confirming 2022 Circle Lake Improvement special assessments (4-0)
- Adopted Resolution #21-047 conveying tax-forfeited property to Rice County (4-0)
- Approved Social Services MFIP Biennial Service Agreement (4-0)
- Approved Social Services contract amendment with KCQ, Inc. (4-0)
- Extended James Ingham's indemnification hearing for a third time (4-0)
- Approved Sheriff's sick leave trade-in, payout, leave, and pay increase (4-0)
- Approved consent agenda including $619,987.49 in bills and personnel appointments (4-0)
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the agenda as presented. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to request the approval of minutes from regular meeting on October 26, 2021. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve payment of $28,072.44 to CIT to continue Adobe Acrobat licensing for Rice County departments. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt resolution #21-046, Adopting & Confirming Special Assessments for 2022 Circle Lake Improvement. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt Resolution #21-047, Conveyance of Tax Forfeited Property to Rice County. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, Approve Social Services Department Minnesota Family Investment Program Biennial Service Agreement. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Social Services Department Contract Amendment with KCQ, Inc. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, The board is asked to extend for a third time the hearing requested by James Ingham for indemnification in civil litigation. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the participation in Rice County's Sick Leave Trade-in; payout of vacation and sick leave hours; leave of absence from current position…
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to accept and ratify the 2022, 2023 & 2024 contract for LELS Local 438 Correctional Officers Sergeants Union; and to authorize the Board…
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to adjourn the meeting. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Thu Nov 4, 2021 · 18:30
Board of Adjustment
Board to hear three variance requests for shoreland and agricultural properties
The Rice County Board of Adjustment will hold a public hearing on three variance applications. The board will decide whether to approve, deny, or continue each request after hearing staff reports, applicant presentations, and public comments.
- 12-ft variance from 50-ft road setback for porch addition at 15412 Shieldsville Blvd, Faribault (PID 10.06.2.50.004)
- 1,600-sqft and 9-ft variances for 50x56-ft machine shed at 17381 Roberds Lake Blvd, Faribault (PID 10.15.2.00.001)
- 45-ft variance from 70-ft rear yard setback for 90x55-ft building in Webster Township (PID 02.01.1.00.006)
variancezoningshorelandagriculturalpublic-hearing
✓ Decided: Board approves three variances for property additions in Rice County
The Rice County Board of Adjustment approved all three variance requests on the agenda. The first allowed a 12-ft setback variance for home additions in Wells Township, the second allowed a larger and taller agricultural shed, and the third allowed a reduced rear-yard setback for a shed in Webster Township. All votes were unanimous (5-0).
- Approved 12-ft setback variance for Kline/Harriman home additions at 15412 Shieldsville Blvd (5-0)
- Approved 1,600-sqft size and 9-ft height variance for Misgen agricultural shed (5-0)
- Approved 45-ft rear-yard setback variance for Johnson/Reisinger shed (5-0)
320 3rd Street NW, Faribault
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
Motion by None, seconded by None, Reading of the Notice, RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by John McCarthy, Approval of the Agenda. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the minutes of October 7, 2021, RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Gordy Kline, on behalf of landowner Charles Harriman, The property…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Daniel Misgen. The property is located in Section 15 of Wells…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston. Bauer, to approve the Variance request with the following conditions and findings for Nick Johnson, on behalf of landowner Jim Reisinger. The property…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Thu Nov 4, 2021 · 18:30
Planning Commission
Planning Commission to review sand/gravel mine, contractor yard, residential facility CUPs
The Rice County Planning Commission will hold public hearings on four items: a conditional use permit for a sand and gravel mining operation, a conditional use permit for a contractor's office and yard, an amendment to an existing CUP for a supervised residential facility, and a waiver of plat to create a building parcel. The commission will make recommendations to the County Board, which will consider them on November 23, 2021.
- CUP for sand and gravel mining and aggregate crushing at 13265 Kane Ave, Dennison (Section 26, Northfield Twp)
- CUP for contractor's office and yard for driveway asphalt business (Section 1, Webster Twp)
- CUP amendment to add supervised residential building at 25665 Falk Ave, Faribault (Section 25, Walcott Twp)
- Waiver of plat to create 1.6-acre parcel via Transfer Development Right at 25665 Falk Ave, Faribault
conditional-use-permitminingcontractor-yardresidential-facilitywaiver-of-platplanning-commission
✓ Decided: Planning Commission recommends denial of sand and gravel mining CUP
The Rice County Planning Commission voted 3-2 to recommend denial of a Conditional Use Permit for a sand and gravel mining and aggregate crushing operation in Northfield Township, citing inadequate information on traffic, infrastructure, and waterway impacts. The commission also unanimously recommended approval of three other items: a contractor's office and yard CUP in Webster Township, an amendment to a supervised residential facility CUP in Walcott Township, and a waiver of plat for a 1.6-acre building parcel in Walcott Township.
- Recommended denial of CUP for sand/gravel mining at 13265 Kane Ave, Dennison (3-2)
- Approved CUP for contractor's office/yard in Webster Township (5-0)
- Approved CUP amendment for Whispers of Hope residential facility in Walcott Township (5-0)
- Approved waiver of plat for 1.6-acre TDR parcel in Walcott Township (5-0)
320 3rd Street NW, Faribault
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Michael Streiff, Reading of the Notice. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Michael Streiff, seconded by John McCarthy, Approval of the Agenda. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jil] Ellingson, to approve the minutes of October 7, 2021. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion to Deny passed
2 yea
Michael Streiff yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Nick Johnson, on behalf of landowner…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Michael Streiff, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Tammy Metcalf- Filzen, on behalf of…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Jill Ellingson, to recommend approval for the Waiver of Plat request with the following conditions and findings for Tammy Metcalf-Filzen, on behalf of landowner…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Nov 2, 2021 · 08:30
Committee of the Whole
County board to review social services and quarterly finances
The Rice County Committee of the Whole will hear a social services update on licensing and housing, then review cash and pooled investments and the quarterly financial report for the period ending September 30, 2021. Public comments are accepted at the start, limited to two minutes per person.
- Social Services department update on licensing and housing services
- Cash and pooled investments report for period ending September 30, 2021
- Quarterly financial report for period ending September 30, 2021
social-servicesfinancehousinglicensingcounty-board
✓ Decided: County board hears social services and finance updates, no votes taken
The Committee of the Whole met for a work session with no formal decisions. Staff presented updates on social services licensing and the 2022 budget outlook. The only action was a motion to adjourn, which passed unanimously.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Oct 26, 2021 · 08:30
Board of Commissioners
County board to create Rural Industrial zoning district, rezone 160 acres
The Rice County Board of Commissioners will consider creating a new Rural Industrial zoning district and rezoning about 160 acres in Northfield Township from Urban Reserve to Agricultural. The board will also act on several plat waivers, contracts, and final payments, and hold a closed session to discuss a property purchase.
- Resolution #21-039: Create Rural Industrial zoning district and amend Chapter 508 (Bridgewater Township)
- Resolution #21-040: Rezone ~160 acres in Section 17, Northfield Township from Urban Reserve to Agricultural
- Waiver of Plat for Reese (Shieldsville Twp), Strese (Northfield Twp), Edel/Smisek (Wheatland Twp), Morris (Morristown Twp)
- Final payments for Contracts 2172, CP 21-70, and 2176
- Closed session to discuss property purchase under Minn. Stat. 13D.05 Subd. 3(c)(3)
zoningrezoningplat-waiverscontractsclosed-sessionhighwaysocial-services
✓ Decided: Rice County adopts new Rural Industrial zoning district and rezones Northfield Township property
The board unanimously adopted a zoning ordinance amendment creating a new Rural Industrial district and approved a related rezoning in Northfield Township. It also approved four plat waivers, several contracts and payments, and authorized negotiations to purchase property at 302 1st Avenue NW, Faribault.
- Adopted Zoning Ordinance Text Amendment creating Rural Industrial district (5-0)
- Adopted Resolution #21-040 rezoning property in Section 17, Northfield Township (5-0)
- Approved Waiver of Plat for Daniel and Sandra Reese, Shieldsville Township (5-0)
- Approved Waiver of Plat for Michael Strese, Northfield Township (5-0)
- Approved Waiver of Plat for Jake Edel/Edward Smisek, Wheatland Township (5-0)
- Approved Waiver of Plat for Debbie Korman/David Morris, Morristown Township (5-0)
- Approved $30,585 payment to Trimin Systems for software maintenance (5-0)
- Authorized negotiations to purchase property at 302 1st Avenue NW, Faribault (5-0)
🗳️ How they voted (21 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve minutes from the regular meeting on October 12, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to adopt the Zoning Ordinance Text Amendment to create a new Zoning District titled Rural Industrial and to amend Chapter 508, and table 508-1 to…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to adopt Resolution #21-040 Amendment to the Rice County Zoning Map Rezoning Property Located in Section 17 of Northfield Township. RESULT…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Daniel and Sandra Reese. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Michael Strese. The property is located…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Jake Edel, on behalf of landowner Edward…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Debbie Korman, on behalf of landowner…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, Request to approve payment in the amount of $30,585 to Trimin Systems, Inc. for annual software maintenance. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Galen Malecha, seconded by Jim Purfeerst, Approve Social Services Department Contract Amendment with Minnesota Department of Public Safety RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve a contract with Rebecca Ericson. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, Approve Rice County Treatment Court Cooperative Agreement. RESULT: Approved
5 yea
Steve Underdahl yea · Jeff Docken yea · Galen Malecha yea · Dave Miller yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, Approval of the Final Payment to Structural Specialties, Inc. in the amount of $197,279.52 for work completed under contract # 2172. RESULT…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve final payment to Crane Creek Asphalt in the amount of $162,342.71 for work completed under Contract # CP 21- 70. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, To approve final payment in the amount of $ 286,183.79 to Crane Creek Asphalt for work completed under Contract # 2176. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Request Board Approval to accept the grant agreement from 2021-2023. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl to move into CLOSED SESSION. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller to move out CLOSED SESSION. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to authorize Rice County Attorney's Office to go forward with negotiations for the purchase of property at 302 1st Avenue NW, Faribault, MN…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Oct 26, 2021 · 08:30
Housing & Redevelopment Authority
Rice County HRA to review payment standards and quarterly report
The Rice County Housing and Redevelopment Authority is holding a regular meeting to consider action items including approval of minutes and payment standards, and to receive a quarterly program report. The agenda is otherwise routine and procedural.
- Approval of meeting minutes
- Review and potential action on payment standards
- Quarterly program report and updates
housingredevelopmentpayment-standardsquarterly-report
✓ Decided: HRA approves minutes and payment standards; no other decisions
The Rice County Housing & Redevelopment Authority met on October 26, 2021, and approved the previous meeting minutes and the payment standards, both unanimously. No other substantive decisions were made; the meeting adjourned shortly after.
- Approved meeting minutes (all ayes)
- Approved payment standards (all ayes)
320 NW 3rd St, Faribault
Tue Oct 19, 2021 · 08:30
Committee of the Whole
County to hear MnDOT 10-year work plan, highway updates
The Rice County Committee of the Whole will receive a presentation from MnDOT on its 10-year work plan and hear highway updates from Dennis Luebbe. Public comments on agenda items are allowed at the start, limited to two minutes per person.
- MnDOT presentation on 10-year work plan
- Highway updates by Dennis Luebbe
highwaytransportationcounty-boardpublic-comment
✓ Decided: County board hears MnDOT 10-year road and bridge plan
The Rice County Committee of the Whole met and received a presentation from Heather Luke of MnDOT outlining the next 10 years of district roadway and bridge work, including planning updates and local project updates. Highway Department staff also updated commissioners on current projects, noting Richland Township work is nearly complete and construction season ends in October. No formal decisions were made; the meeting adjourned with a unanimous vote.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Galen Malecha, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Oct 12, 2021 · 08:30
Board of Commissioners
County to adopt 2040 Comprehensive Plan, approve union contracts
The Rice County Board of Commissioners will consider adopting the 2040 Comprehensive Plan, ratify multiple union contracts for 2022-2024, and approve various agreements and appointments. The agenda includes a conditional use permit for Ag Partners Coop, a final payment for pavement markings, and acceptance of a development proposal for the North Block.
- Resolution #21-044: Adoption of the 2040 Rice County Comprehensive Plan
- Conditional Use Permit for Ag Partners Coop, Section 30, Warsaw Township
- Final Payment, Contract No. 21-52, Pavement Markings
- Ratification of MNPEA, I.U.O.E. Local 49, Teamsters Local 320, and LELS Local 367 union contracts for 2022-2024
- Acceptance of North Block Development Proposal
comprehensive-planzoningunion-contractshighwaydevelopmentelectionspublic-safety
✓ Decided: Board adopts 2040 Rice County Comprehensive Plan
The Rice County Board of Commissioners approved the 2040 Comprehensive Plan, a conditional use permit for Ag Partners Coop, and multiple contracts and agreements, including union contracts for 2022-2024. All votes were unanimous (5-0).
- Adopted Resolution #21-044, the 2040 Rice County Comprehensive Plan (5-0)
- Approved Conditional Use Permit for Ag Partners Coop in Warsaw Township (5-0)
- Approved contract with Northfield Healthy Communities Initiative for SHIP grant (5-0)
- Approved final payment of $4,136.20 to Traffic Marking Services (5-0)
- Approved out-of-state travel for two sheriff's employees to Defensive Tactics Instructor Program (5-0)
- Approved contract with City of Lonsdale for prosecution services 2022-2023 (5-0)
- Appointed Dr. A Quinn Strobl as Medical Examiner effective Dec 1, 2021 (5-0)
- Ratified 2022-2024 union contracts for MNPEA, I.U.O.E. Local 49, Teamsters Local 320, LELS Local 367 (5-0)
🗳️ How they voted (22 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the minutes of the regular meeting from September 28, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller to move into the Community Health Board Session at 8:50 a.m. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve an agreement between Rice County Community Health Services and Northfield Healthy Communities Initiative for professional services…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller to move out of the Community Health Board Session at 8:52 a.m. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Ag Partners Coop. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jeff Docken, to adopt Resolution #21-044 Adoption of the 2040 Rice County Comprehensive Plan and authorize publication of summary. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Final Payment to Traffic Marking Services in the amount of $ 4,136.20 for work completed under Contract No. 21-52. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the out of state travel request for two employees to attend the Defensive Tactics Instructor Program in Springfield, MO from November 29 -…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Contract to Provide Prosecution Services for the City of Lonsdale, for 2022 and 2023. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to appoint Anoka County Medical Examiner Dr. A Quinn Strobl as Medical Examiner for Rice County Effective December 1, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve a contract with Anoka County to provide Medical Examiner Services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the acceptance of the North Block Development Proposal from Wold Architects and Engineers. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Rice County Park Plan Contract with HKGi. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve out of state travel for County Administrator Sara Folsted to attend the NPELRA (National Public Employer Labor Relations Association)…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to accept and ratify the 2022, 2023 & 2024 union contract for the MNPEA Deputies; and to authorize the Board Chairperson's signature on Rice County…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to accept and ratify the 2022, 2023 & 2024 union contract for the I.U.O.E. Local 49; and to authorize the Board of Chairperson's signature on the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, to approve and adopt Resolution #21- 045 Non-union Wages & Benefits for 2022, 2023 & 2024. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to accept and ratify the 2022, 2023 & 2024 union contract for Teamsters Local No. 320 Social Services; and to authorize the Board Chairperson's…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Oct 7, 2021 · 18:00
Planning Commission
Rice County Planning Commission discusses zoning changes and land use permits
The commission will hold public hearings on new zoning districts and map amendments. It will also consider several conditional use permits and waivers of plat for various townships.
- Public hearing for Resolution #21-039 to create a Rural Industrial Zoning District in Bridgewater Township
- Public hearing for Resolution #21-040 to rezone 160 acres from Urban Reserve to Agricultural in Northfield Township
- Conditional Use Permit for Ag Partners Coop to add buildings at 6676 250th St W, Morristown
- Conditional Use Permit for sand and gravel mining at 13265 Kane Ave, Dennison
- Six applications for Waiver of Plat involving Transfer Development Rights or parcel separation
zoningland-useagriculturemininggovernment
✓ Decided: Planning Commission recommends new Rural Industrial zoning district
The Rice County Planning Commission recommended approval of a zoning ordinance text amendment creating a new Rural Industrial zoning district, despite public opposition. The commission also recommended approval of a conditional use permit amendment for Ag Partners Coop and several waiver of plat requests. All recommendations will go to the County Commissioners for final action.
- Recommended approval of Rural Industrial zoning district text amendment (2-1)
- Recommended approval of Ag Partners Coop CUP amendment with conditions (3-0)
- Recommended approval of Reese waiver of plat with conditions (3-0)
- Recommended approval of Strese waiver of plat with conditions (3-0)
- Recommended approval of Korman/Morris waiver of plat with conditions (3-0)
320 3rd Street NW, Faribault
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Charlie Peters, Reading of the Notice. RESULT: Approved
2 yea
Charlie Peters yea · Jill Ellingson yea
[context] 2021 RESULT: Approved
4 yea
Charlie Peters yea · Jill Ellingson yea · Charlie Peters yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Ag Partners Coop. The property is…
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by John McCarthy, to recommend approval for the Waiver of Plat request with the following conditions and findings for Michael Strese. The property is located in…
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Jill Ellingson, to recommend approval for the Waiver of Plat request with the following conditions and findings for Debbie Korman, on behalf of landowner David…
2 yea
Charlie Peters yea · Jill Ellingson yea
Thu Oct 7, 2021 · 18:00
Board of Adjustment
Board to hear six shoreland variance requests, including lake setbacks and deck/pool additions
The Rice County Board of Adjustment will hold a public hearing on six variance requests, all involving shoreland properties. The board will decide whether to approve, deny, or continue each request after hearing staff reports, applicant presentations, and public comments.
- Variance for Thomas Dean: 25-ft lake setback variance for a deck and 8-ft after-the-fact variance for existing home at 4675 180th Ct W, Faribault (Roberds Lake)
- Variance for Dean Dolezal/Kappelmann: 50-ft road setback, 57-ft lake setback, and 2-ft height variances for a replacement garage at 3990 Cannon Lake Trail, Faribault (Cannon Lake)
- Variance for Jeremiah Forster: 42-ft lake setback and 4% impervious surface variances for a pool at 4715 180th Ct W, Faribault (Roberds Lake)
- Variance for Mike Halverson: 77-ft lake setback variance to move an existing cabin at 6551 143rd St W #3, Lonsdale (Lake Mazaska)
- Variance for Ag Partners Coop: 17% impervious surface variance for building expansions at 6676 250th St W, Morristown
zoningshorelandvariancesetbackpublic-hearing
✓ Decided: Board approves 5 of 6 shoreland variances, denies pool variance
The Rice County Board of Adjustment approved five variance requests related to shoreland properties, including setbacks, building sizes, and impervious surface coverage, and denied one request for a pool variance. All approvals were subject to conditions such as maintaining natural buffers, obtaining building permits within one year, and following approved site plans.
- Approved variance for Thomas Dean to allow existing home at 112-ft and deck at 95-ft from Roberds Lake (3-0)
- Approved variance for Dean Dolezal/Kappelmann for a 30x36-ft garage with reduced setbacks from Cannon Lake and County Road 12 (2-1, McCarthy dissenting)
- Denied variance for Workman/Forster for an in-ground pool due to impervious surface concerns (3-0)
- Approved variance for William Keilen for a 1,792-sqft shed addition with reduced side yard setback (3-0)
- Approved variance for Ag Partners Coop for 42% impervious surface coverage at agricultural site (3-0)
320 3rd Street NW, Faribault
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Motion by McCarthy, seconded by Peters, Approval of the Agenda. RESULT: Approved
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by Peters, seconded by McCarthy, to approve the minutes of September 2, 2021. RESULT: Approved
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Thomas Dean. The property is located in Section 21 of Wells…
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for William Keilen. The property is located in Section 35 of…
2 yea
Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Ag Partners Coop. The property is located in Section 30 of Warsaw…
2 yea
Charlie Peters yea · Jill Ellingson yea
Tue Oct 5, 2021 · 08:00
Committee of the Whole
County board to review grants, park plan, and financial aid updates
The Rice County Committee of the Whole will hear updates on a SHIP-related grant award for health equity data, kick off a park plan, and receive a department update on financial assistance programs. Public comments are limited to two minutes per person. The meeting is a work session, so no formal votes are expected.
- MEDA grant award for health equity data (SHIP-related)
- Park Plan kick-off
- Financial Assistance Programs update
- Public comments on agenda items (2-minute limit)
healthparkssocial-servicesgrants
✓ Decided: County selected for $82,500 state nutrition grant
The Committee of the Whole received updates on a state grant award, a park plan, and social services. No formal decisions were made; the only action was to adjourn the meeting.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Galen Malecha, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Sep 28, 2021 · 08:30
Board of Commissioners
County sets preliminary 2022 tax levy, fills sheriff vacancy
The Rice County Board of Commissioners will set the preliminary 2022 tax levy, make an interim appointment to fill the sheriff vacancy, and ratify a union contract. They will also consider several contracts, land sales, and a public safety center construction manager proposal.
- Resolution #21-041 setting preliminary 2022 tax levy
- Interim appointment to fill Rice County Sheriff vacancy
- Ratification of MNPEA Sergeants Union Contract for 2022-2024
- Resolution #21-042 classification and potential sale of non-conservation forfeited land
- Acceptance of Public Safety Center Construction Manager Proposal
tax-levysheriffunion-contractland-salepublic-safetyroadssocial-services
✓ Decided: County sets preliminary 2022 tax levy, approves union contract and interim sheriff
The Rice County Board approved the preliminary 2022 tax levy, ratified a three-year union contract for MNPEA Sergeants, and appointed Chief Deputy Jesse Thomas as interim sheriff. They also approved numerous contracts, payments, and personnel actions, all with unanimous votes except for one 4-1 decision on a construction manager.
- Adopted Resolution #21-041 setting preliminary 2022 tax levy (5-0)
- Ratified 2022-2024 union contract for MNPEA Sergeants (5-0)
- Appointed Chief Deputy Jesse Thomas as interim sheriff (5-0)
- Approved $611,552.67 in bills (5-0)
- Approved final payment of $20,310.71 to Kielmeyer Construction (5-0)
- Approved final payment of $6,582.99 to Fitzgerald Excavating (5-0)
- Accepted Contegrity proposal for Public Safety Center construction manager (4-1)
- Approved purchase of 3 Ford Escape Hybrid fleet vehicles (5-0)
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve minutes from the regular board meeting from September 14, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt Resolution #21-042, Classification and Approval for Potential Sale of Non-Conservation Forfeited Land. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve an agreement authorizing Rice County Public Health to enter into a grant agreement with the Minnesota Department of Public Safety for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve an agreement between Rice County Public Health and Kathy Cooper for professional services related to a 2022 TZD Safe Roads Grant, for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Social Services Department Work Number Participation Agreement with the Minnesota Department of Human Services and TALX…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the Appointment of Member Social Services Director Mark Shaw and Alternate Adult Mental Health Supervisor Christine Kern (or successor) to…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve Social Services Department Rice County Board of Commissioners Page 2 September 28, 2021 Contract with Healthy Community Initiative…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve Social Services Department Transportation Contracts with Local School Districts. The first includes Discovery Public School. RESULT…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve a contract with Social Services Department of Transportation and Faribault Public Schools. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve a contract with Social Services Department of Transportation and Faribault Stem School. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve a contract with Social Services Department of Transportation and TriCity United. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve a contract with Social Services Department of Transportation and Northfield Public Schools. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve final payment under contract #21-51 to Kielmeyer Construction, Inc. in the amount of $20,310.71 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve Final Payment to Fitzgerald Excavating in the amount of $ 6,582.99 for work completed under Contract # 2174. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-041 Setting the Preliminary Tax Levy for 2022. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to accept the proposal with Contegrity for the Construction Manager for the Public Safety Center. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the purchase of 3 Ford Escape Hybrid County Fleet vehicles for Rice County Government Center from Bliss RC Ford. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the declaration of 14460 Irwin Path as a Surplus Property and to be sold. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Sep 21, 2021 · 08:30
Committee of the Whole
County board to discuss preliminary levy, road transfers, and updates
The Rice County Committee of the Whole is holding a work session to discuss several county matters, including a preliminary levy discussion, jurisdictional road transfers for CR 89 and Ableman Trail, and updates from Veterans Services, Parks & Facilities, and the Highway Department. No formal decisions are being made at this work session; items are for discussion only.
- Preliminary levy discussion
- Jurisdictional road transfer discussion: CR 89 and Ableman Trail
- Veterans Services Office update
- Public Safety Center update
- Downtown Development update
budgetroadsveteransparksfacilitieshighway
✓ Decided: County board hears updates on veteran services, parks, highways, and 2022 levy
The Rice County Committee of the Whole met on September 21, 2021, and received informational updates from department heads. No formal decisions were made; the meeting was for discussion and updates only. The board heard from Veteran's Services, Parks & Facilities, Highway, and Finance departments, and then adjourned.
- Adjourned meeting (motion by Dave Miller, seconded by Jeff Docken, approved unanimously)
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Jeff Docken, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Mon Sep 20, 2021 · 18:30
Board of Commissioners
Public hearing on adoption of 2040 Rice County Comprehensive Plan
The Rice County Board of Commissioners is holding a public hearing to hear comments on the proposed adoption of the 2040 Rice County Comprehensive Plan. The draft plan was reviewed on August 17, 2021, and includes a new action item to create a Sustainability Plan. The board will consider adopting the plan after the hearing.
- Public hearing on 2040 Rice County Comprehensive Plan adoption
- New action item added to Sustainability Chapter to create a Sustainability Plan
- Plan adoption pursuant to Minnesota State Statutes 375.51 and 331A.01
comprehensive-planpublic-hearingsustainabilityplanningzoning
320 3rd Street NW, Faribault
Tue Sep 14, 2021 · 08:30
Board of Commissioners
County board to weigh rezoning, tax-forfeited land sale, tobacco license
The Rice County Board of Commissioners will consider a conditional use permit, a zoning map amendment, and a plat waiver, along with a tobacco license for a Nerstrand store and a resolution setting terms for selling tax-forfeited lands. They will also discuss a social services contract amendment, a funding request from Three Rivers, and the retirement of the county sheriff. A closed session is scheduled to discuss purchasing property.
- Conditional Use Permit/Tonjum (Witte) - Section 13, Morristown Township
- Zoning Map Amendment from Urban Reserve to Agricultural/Tussing (Snesrud) - Section 17, Northfield Township
- Tobacco License for Parkside General Store, 230 Main St Nerstrand, MN 55053 (Sept 14, 2021 thru June 30, 2022)
- Resolution #21-038: Set and Appraise Values and approve Basic Sale Prices for Tax-Forfeited Lands
- Social Services Department Contract Amendment with Minnesota Department of Human Services
zoningland-usetobacco-licensetax-forfeited-landssocial-services
✓ Decided: County approves $1.65M purchase of 109.2 acres for parks
The board approved the purchase of 109.2 acres of land for $1.65 million, following a closed session to discuss the offer. They also approved ARP funding of up to $325,000 for the Spring Creek II housing project, adopted a resolution for tax-forfeited land sales, and accepted Sheriff Troy Dunn's retirement effective November 12, 2021. All votes were unanimous (5-0).
- Approved $1.65M purchase of 109.2 acres (5-0)
- Approved up to $325,000 ARP funding for Spring Creek II housing (5-0)
- Accepted Sheriff Troy Dunn's retirement effective Nov 12, 2021 (5-0)
- Adopted Resolution #21-038 for tax-forfeited land sale values (5-0)
- Approved tobacco license for Parkside General Store (5-0)
- Approved waiver of plat for William Hein in Walcott Township (5-0)
- Approved $733,150.81 in bills and personnel appointments (5-0)
- Approved domain change to RICECOUNTYMN.GOV (5-0)
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve minutes from the regular meeting August 24, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jeff Docken, seconded by Dave Miller, to adopt the formal Findings of Fact on the denial of the Conditional Use Permit for Mary Tonjum, on behalf of landowner Witte Estate. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve publishing the Intent to Enact and setting a public hearing for 7:15 pm October 7, 2021 regarding adopting a Zoning Map Amendment to…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for William Hein. The property is located…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve registration and use of RICECOUNTYMN.GOV for Rice County business and public-facing communication while maintaining the CO.RICE.MN.US…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Social Services Department Contract Amendment with the Minnesota Department of Human Services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve a tobacco license for Parkside General Store, 230 Main St Nerstrand, MN 55053 - Sept 14th, 2021 thru June 30th 2022. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to adopt Resolution #21-038, Set and Appraise Values and approve Basic Sale Prices, Date & Terms for Sale of Tax-Forfeited Lands in Rice County. Rice…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to present the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve, and accept the retirement of Rice County Sheriff Troy Dunn effective on Friday, November 12, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve ARP funding in the amount not to exceed $325,000 for the Spring Creek II housing project. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the purchase of 109.2 acres which includes parcels: 1819100002, 1819125001, 1819150001, 1819100001, 1819175001, and 1819425001 at the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Sep 7, 2021 · 08:30
Committee of the Whole
County weighs behavioral health unit, Project Intercept expansion
The Rice County Committee of the Whole will hear updates and discuss several items, including a behavioral health unit and Project Intercept expansion, the 2022 Housing and Redevelopment Authority budget, and a funding request from Three Rivers. The meeting is a work session, so most items are for discussion rather than final decisions.
- Circle Lake Improvement District annual update
- Three Rivers funding request
- Discussion on creating a behavioral health unit and expanding Project Intercept
- 2022 Rice County Housing and Redevelopment Authority (RCHRA) budget
- GOV domain information update
healthbudgethousingpublic-safetytechnology
✓ Decided: County weighs $325K gap for Northfield Spring Creek II project
The Committee of the Whole heard a request from Three Rivers Funding for an additional $325,000 to cover a funding gap for the Spring Creek II project in Northfield, caused by pandemic-related cost increases. The County HRA has already committed 16 project-based rental subsidies for very-low-income families. No formal action was taken on this request; the meeting was a work session, and the only vote was to adjourn.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Jim Purfeerst, to adjourn the meeting. RESULT: Approved
4 yea
Jeff Docken yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Sep 2, 2021 · 18:30
Board of Adjustment
Board to hear two variance requests for shoreland and road setbacks
The Rice County Board of Adjustment will hold a public hearing on two variance applications. One seeks to exceed the lot impervious surface limit for a replacement home in Wells Township; the other requests a reduced road right-of-way setback for a home addition in Richland Township. The board may approve, deny, or continue each item.
- Variance for Bryan Gill: 5% variance from 25% impervious surface limit (30% proposed) for replacement home at 17959 Roberds Lake Blvd, Faribault (PID 10.15.4.50.012)
- Variance for Stevan & Theresa Johnson: 38-ft variance from 100-ft road right-of-way setback for 20x24-ft addition at 22682 Larson Ave, Kenyon (PID 16.12.3.25.003)
varianceshorelandsetbackzoningpublic-hearing
✓ Decided: Board approves two variances for Wells Township properties
The Rice County Board of Adjustment approved two variance requests. Bryan Gill received a 5% variance from the 25% lot impervious surface limitation to build a replacement home at 17959 Roberds Lake Blvd, Faribault, with conditions including a raingarden and one-year construction deadline. Stevan and Theresa Johnson received a variance to add a 20-ft by 24-ft addition to their existing home, located 62-ft from the Larson Ave Road Right of Way, with conditions including a one-year permit deadline. Both approvals were unanimous.
- Approved Bryan Gill's variance for a 5% impervious surface increase (to 30%) for a replacement home, with conditions including a raingarden and one-year construction deadline
- Approved Stevan and Theresa Johnson's variance for a 20-ft by 24-ft home addition, with conditions including a one-year permit deadline
- Approved the reading of the notice, agenda, and minutes of July 29, 2021, all unanimously
320 3rd Street NW, Faribault
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Bryan Gill. The property is located in Section 15 of Wells…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Ordinance regulations. 2. Approved site plan shall be followed, including relocation of the shared drive and removal of existing building. 3. A 200-sqft raingarden or other short te1m stormwater…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Thu Sep 2, 2021 · 18:30
Planning Commission
Planning Commission to weigh two zoning requests in Northfield and Walcott Townships
The Rice County Planning Commission will hold a public hearing on two items: a request to rezone land in Northfield Township from Urban Reserve to Agricultural, and a waiver of plat to create a 6.56-acre parcel in Walcott Township. The commission will make a recommendation to the County Board, which will hear the items on September 14, 2021.
- Zoning Map Amendment to rezone property from Urban Reserve to Agricultural (Tussing/Snesrud) - Section 17, Northfield Township
- Waiver of Plat/Hein to create a 6.56-acre parcel containing an existing home - Section 9, Walcott Township
- Public hearing with remote access via Zoom and phone
zoningrezoningplat-waiverpublic-hearingplanning-commission
✓ Decided: Planning Commission recommends rezoning Northfield land to Agricultural
The Rice County Planning Commission voted unanimously to recommend approval of a zoning map amendment to rezone three parcels in Section 17 of Northfield Township from Urban Reserve to Agricultural. The request was made by Andrew Tussing on behalf of landowners Lance Snesrud, Peterson Brothers LLP, and Steven Tralle Trust. No comments were received from the City of Northfield. The recommendation will go to the County Board for final action.
- Approved reading of notice (5-0)
- Approved agenda (5-0)
- Approved minutes of July 29 and August 17, 2021 (5-0)
- Recommended approval of zoning map amendment from Urban Reserve to Agricultural for Snesrud/Peterson/Tralle properties (5-0)
320 3rd Street NW, Faribault
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by Michael Streiff, Reading of the Notice. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Michael Streiff, seconded by Jill Ellingson, Approval of the Agenda. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the minutes of July 29 and August 17, 2021. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Aug 24, 2021 · 08:30
Board of Commissioners
County board to approve housing aid, solid waste plan, several land-use permits
The Rice County Board of Commissioners will consider resolutions and permits including a homeless prevention housing grant, a solid waste management plan update, multiple conditional use permits and plat waivers, a courthouse chiller replacement, a culvert contract, and liquor/gambling licenses. The board will also hold a closed session on labor negotiations strategy.
- Resolution #21-034: Accept Minnesota Housing Finance Agency Family Homeless Prevention and Assistance Program funds
- Resolution #21-037: Solid Waste Management Plan review and approval
- Conditional use permits for Langdon (Erin Twp), Carver Garden LLC (Cannon City Twp), Tonjum/Witte (Morristown Twp)
- Waivers of plat for Sirba (Webster Twp) and Johnson (Walcott Twp); final plat for Olson (Cannon City Twp)
- Contract #2177: culvert replacement; 1-day liquor license for Rotary Club of Northfield at Red Barn Farm
housingzoningland-usesolid-wastehighwaylicenseslabor
✓ Decided: County board approves $144,983 courthouse chiller replacement
The Rice County Board of Commissioners approved a $144,983 chiller replacement for the courthouse, awarded a $74,052 culvert contract, and adopted resolutions for homeless prevention funding and the solid waste management plan. They also approved several conditional use permits and plats, denied one conditional use permit, and set a public hearing for a zoning text amendment. The board entered a closed session for labor negotiations strategy, taking no action there.
- Approved $144,983 courthouse chiller replacement with Daikin (5-0)
- Awarded contract #2177 to Fitzgerald Excavating for $74,052 for CSAH 15 culvert replacement (5-0)
- Adopted Resolution #21-034 for Family Homeless Prevention and Assistance Program (5-0)
- Adopted Resolution #21-037 to submit 2021 Solid Waste Management Plan to MPCA (5-0)
- Approved conditional use permits for James Langdon and Carver Garden LLC; denied for Mary Tonjum/Witte Estate (5-0)
- Approved waivers of plat for John and Sue Ann Sirba and Garett Johnson; final plat for Robert Olson (5-0)
- Set public hearing for Oct 7, 2021 on Rural Industrial zoning district text amendment (5-0)
- Approved consent agenda including $623,039.62 in bills and personnel appointments (5-0)
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the minutes from the Rice County Board Meeting on August 10, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adopt Resolution #21-034 Authorizing Acceptance and Execution of Minnesota Housing Finance Agency Family Homeless prevention and Assistance…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt Resolution # 21-037 reviewing and approving to submit the 2021 Rice County Solid Waste Management Plan to the Commissioner of the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for James Langdon. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Carver Garden LLC, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, Second by Jim Purfeerst, for a 60 day extension of the adoption of finding of facts for the Conditional Use Permit application for Tonjum (Witte)-Section 13, Morristown…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for John and Sue Ann Sirba. The properties are…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Garett Johnson. The property is located…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Final Plat with the conditions and findings recommended by the Planning Commission for Robert Olson. The properties are located in…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve publishing the Intent to Enact and setting a public hearing for 7:00 pm October 7, 2021 regarding adopting a Zoning Ordinance Text…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Rice County Courthouse Chiller Replacement Project Proposal with Daikin in the amount of $144,983.00. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to award contract # 2177 to Fitzgerald Excavating the lowest responsible bidder, in the amount of $74,052.00 in regards to CSAH 15 Culvert…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the application for a Temporary On-Sale Liquor License for the Rotary Club of Northfield at Red Barn Farm, 10063 110th Street East…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adopt Resolution #21-036, MN Lawful Gambling Application to Conduct Off-Site Gambling by the New Market Elko Webster Lions Club at Webster Park…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Radiological Emergency Preparedness Grant Agreement; to authorize Jennifer Hauer-Schmitz as the Grantee's Authorized Representative…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution 21-035 Reimbursement for Jail/LEC Construction project. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Miller, seconded by Underdahl to move into Closed Session for Labor Negotiations Strategy (Pursuant to Minn. Stat. 13D.03) RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Aug 17, 2021 · 08:30
Committee of the Whole
Rice County board reviews solid waste plan, finances, child support
The Rice County Committee of the Whole is meeting to hear updates and discuss several county operations. Items include a draft solid waste plan for state review, financial reports for the period ending June 30, 2021, and a child support services update. The agenda also includes presentations from seven outside agencies, including the Lonsdale Public Library and Rice County Agricultural Society.
- Draft Solid Waste Plan for submission to state review and approval
- Cash & Pooled Investments report for period ending June 30, 2021
- Quarterly Financial Report for period ending June 30, 2021
- Child Support Services department update
- Presentations from 7 outside agencies including Lonsdale Public Library and SEMCAC
solid-wastefinancesocial-serviceshighwaypublic-commentcounty-board
✓ Decided: County board hears agency reports, no formal votes taken
The Rice County Committee of the Whole met on August 17, 2021, and heard presentations from several outside agencies, including the Lonsdale Public Library, Rice County Agricultural Society, Soil & Water Conservation District, Southeast MN EMS, Buckham West, and FiftyNorth. County staff also provided updates on social services, finance, environmental services, and highway projects. No formal decisions or votes were taken during the work session; the only action was a motion to adjourn, which was approved unanimously.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Jeff Docken, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Aug 17, 2021 · 18:00
Planning Commission
Planning Commission to consider waiver of plat for 2.5-acre parcel in Walcott Township
The Rice County Planning Commission will hold a public hearing on a single item: a waiver of plat application by Garett Johnson to modify a 2.5-acre building parcel in Walcott Township. The commission will take public comments and then make a recommendation to the County Board, which will hear the item on August 24, 2021.
- Waiver of Plat/Johnson – Section 30, Walcott Township (PID# 15.30.4.00.008, zoned A, Agricultural)
planning-commissionwaiver-of-platwalcott-townshipagricultural-zoningpublic-hearing
✓ Decided: Planning Commission recommends approval of Johnson waiver of plat
The Rice County Planning Commission voted unanimously to recommend approval of Garrett Johnson's waiver of plat request to modify a 2.5-acre building parcel in Walcott Township. The recommendation includes five conditions, such as limiting the parcel to one single-family dwelling and combining the residual parcel with an adjacent property owned by the applicant. The matter now goes to the county board for final action.
- Recommended approval of Johnson waiver of plat with conditions (4-0)
- Approved reading of notice (4-0)
- Approved meeting agenda (4-0)
320 3rd Street NW, Faribault
Tue Aug 17, 2021 · 18:30
Board of Commissioners
County reviews 2040 Comprehensive Plan draft at work session
The Rice County Board of Commissioners is holding a special work session to discuss the 2040 Comprehensive Draft Plan. Staff will summarize each chapter of the draft and facilitate conversation on items needing additional discussion, followed by a presentation of a possible timeline for adoption. The meeting is open to the public with remote access options.
- Discussion of 2040 Comprehensive Draft Plan chapter summaries
- Presentation of possible timeline for plan adoption
- Public remote access via Zoom and phone
comprehensive-planplanningpublic-meetingcounty-board
320 3rd Street NW, Faribault
Tue Aug 10, 2021 · 08:30
Board of Commissioners
County Board to consider contracts, licenses, and property purchase
The Rice County Board of Commissioners will review several contracts, including amendments with the Minnesota Department of Health and Northfield Healthy Community Initiative, and an operational grant for Veteran's Services. They will also consider applications for gambling and liquor licenses, and discuss a proposal for a Northfield office, followed by a closed session to discuss property purchase.
- Contract amendment with Minnesota Department of Health
- Contract amendment with Northfield Healthy Community Initiative
- Operational Enhancement Grant for Veteran's Services
- Gambling permit for Rice County Steam and Gas Engines, Inc. at 11988 Faribault Blvd, Faribault
- Temporary 3.2% malt liquor license for Church of St. Patrick Shieldsville at 7525 Dodd Rd, Faribault
contractslicensesgrantspropertysocial-services
✓ Decided: Rice County Board approves contracts, licenses, and property negotiations
The Rice County Board of Commissioners approved multiple items including social services contract amendments, a veteran services grant, several licenses and permits, a proposal for office space, and moved forward with property purchase negotiations. All votes were unanimous (5-0).
- Approved Social Services Contract Amendment with Minnesota Department of Health (5-0)
- Approved Social Services Contract Amendment with Northfield Healthy Community Initiative (5-0)
- Approved Resolution #21-033 Operational Enhancement Grant for Veteran's Services (5-0)
- Approved MN Lawful Gambling Exempt Permit for Rice County Steam and Gas Engines, Inc. (5-0)
- Approved Temporary 3.2% Malt Liquor license for Church of St. Patrick Shieldsville (5-0)
- Approved 1-Day Temporary Consumption & Display Permit for Church of St. Patrick (5-0)
- Approved MN Lawful Gambling Exempt Permit for Church of St. Patrick Shieldsville (5-0)
- Approved proposal from Bluewater Properties for NCRC Building office space (5-0)
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the minutes from the Regular meeting on July 27, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Social Services Contract Amendment with the Minnesota Department of Health. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Social Services Contract Amendment with Northfield Healthy Community Initiative. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to request approval for Resolution #21-033 Operational Enhancement Grant. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the MN Lawful Gambling Application for Exempt Permit for Rice County Steam and Gas Engines, Inc., 11988 Faribault Boulevard, Faribault…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Temporary 3.2% Malt Liquor license application for Church of St. Patrick Shieldsville, 7525 Dodd Road, Faribault, MN, 55021 for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Application & Permit for a 1- Day Temporary Consumption & Display Permit for Church of St. Patrick, Shieldsville, 7525 Dodd Road…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve MN Lawful Gambling Application for Exempt Permit for Church of St. Patrick Shieldsville, 7525 Dodd Road, Faribault, MN, 55021 for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the proposal from Bluewater Properties regarding NCRC Building in Northfield for office space. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to move forward with negotiations regarding the Purchase of Property in Rice County. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Aug 3, 2021 · 08:30
Committee of the Whole
County board to review draft solid waste plan and agency updates
The Rice County Committee of the Whole will hear updates from several outside agencies and county departments, and review a draft Solid Waste Plan from Environmental Services. Public comments are accepted at the start of the meeting. This is a work session, so items are for discussion rather than final decisions.
- Draft Solid Waste Plan presented by Environmental Services
- Updates from Buckham Memorial Library, Hope Center, Northfield Public Library, Prairie's Edge Humane Society, and Rice County Historical Society
- Parks & Facilities Department update by Matthew Verdick
- Assessor's Office update by Joshua Schoen
solid-wasteparksassessorlibrariescounty-board
✓ Decided: County board hears 2022 funding requests from five outside agencies
The Committee of the Whole heard presentations from five outside agencies requesting 2022 county funding: Buckham Memorial Library, Hope Center, Northfield Library, Prairie's Edge Humane Society, and Rice County Historical Society. No funding decisions were made; the meeting was informational only. The board also received updates from the Parks & Facilities, Assessor's, and Environmental Services departments. The meeting adjourned with a unanimous vote.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Dave Miller, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Jul 29, 2021 · 18:30
Board of Adjustment
Board to hear two variance requests for home occupation and garage
The Rice County Board of Adjustment will hold a public hearing to consider two variance requests. The first is from James Langdon for a 4,000-square-foot variance to allow a larger home occupation building in Erin Township. The second is from Bruce Williams for multiple variances related to a replacement garage in Wells Township. The board will take public comments and then vote to approve, deny, or continue each item.
- Variance/Langdon: 4,000-sqft variance from 2,000-sqft home occupation building size limit, property at 9733 Kent Ave, Montgomery, MN 56069, zoned A Agricultural
- Variance/Williams: 2-ft variance from 20-ft road setback, 1-ft variance from 14-ft accessory height limit, 6% variance from 25% impervious surface limit for a 30x38-ft garage at 3769 Chappuis Trail, Faribault, MN 55021, zoned GDS General Development Shoreland
- Public hearing procedure: staff report, applicant presentation, public comments, board discussion and vote
variancezoninghome-occupationshorelandpublic-hearing
✓ Decided: Board approves two variances for Langdon and Williams properties
The Rice County Board of Adjustment approved two variance requests. The first allows James Langdon to exceed the home occupation building size limit with a 6,000-sqft accessory structure. The second permits Bruce Williams to build a larger replacement garage near Roberds Lake. Both approvals were unanimous with conditions.
- Approved Langdon variance for 6,000-sqft accessory structure (3-0)
- Approved Williams variance for 30x38-ft replacement garage (3-0)
- Approved meeting notice, agenda, and July 1, 2021 minutes (3-0)
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Bauer, seconded by Peters, to approve the Variance request with the following conditions and findings for James Langdon. The property is located in Section 5 of Erin Township. RESULT…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Thu Jul 29, 2021 · 18:30
Planning Commission
Planning Commission to review solar farm, contractor yard, and plat waivers
The Rice County Planning Commission will hold a public hearing on several conditional use permits, plat waivers, a final plat, and a zoning text amendment. Items include a 1MW solar facility, a home occupation therapy business, a contractor's office and yard, two plat waivers, a final plat, and a new Rural Industrial zoning district. The commission will make recommendations to the County Board, which will consider final approval on August 24, 2021.
- CUP for 1MW solar energy facility by Carver Garden LLC at 3119 197th St E, Faribault (UR zoning)
- CUP for home occupation therapy business by James Langdon at 9733 Kent Ave, Montgomery (A zoning)
- CUP for contractor's office and yard with outdoor storage by Mary Tonjum for Witte Estate (A zoning)
- Waiver of Plat for 2.5-acre parcel by Garett Johnson (A zoning)
- Zoning Ordinance Text Amendment to create Rural Industrial district for Bridgewater Township
conditional-use-permitsolarzoningplat-waiverfinal-plattext-amendment
✓ Decided: Planning Commission recommends approval of solar array CUP with conditions
The Rice County Planning Commission recommended approval of a Conditional Use Permit for a 1MW community solar array on the Carver Garden LLC property in Erin Township, with 11 conditions including a $50,000 bond. They also recommended approval of a CUP for truck/trailer storage at a former gravel pit in Morristown Township, adding conditions limiting summer storage to 15 vehicles and hours of operation. A waiver of plat request was tabled due to a board member's conflict of interest, and a zoning text amendment for a new Rural Industrial district in Bridgewater Township was recommended for approval.
- Recommended approval of CUP for solar array (3-0)
- Recommended approval of CUP for truck/trailer storage with 16 conditions (3-0)
- Tabled waiver of plat request for Garett Johnson until August 17, 2021 (3-0)
- Recommended approval of final plat for Robert Olson (3-0)
- Recommended approval of zoning text amendment for Rural Industrial district (3-0)
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Charlie Peters, Reading of the Notice. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Tue Jul 27, 2021 · 08:30
Board of Commissioners
County Board to review 2020 audit, Mayo contract, landfill bids
The Rice County Board of Commissioners will hear a presentation from the Hope Center, review the 2020 Comprehensive Annual Financial Report, consider a contract amendment with Mayo Clinic Health System for social services, and take up bids for landfill repair and a park system planning proposal. The board will also approve routine consent agenda items and hold a closed session to evaluate the county administrator.
- Comprehensive Annual Financial Report for year ended Dec. 31, 2020
- Social Services contract amendment with Mayo Clinic Health System – Southeast Minnesota Region
- Final payment for Highway Facility Addition and Renovation
- Consideration of bids for landfill repair
- Closed session: performance evaluation of County Administrator Sara Folsted
financesocial-serviceshighwayparkslandfillcontractscounty-administrator
✓ Decided: Rice County approves $1.1M in bills, hires staff, awards contracts
The Rice County Board of Commissioners approved a consent agenda including $1,103,962.70 in bills, several personnel appointments, and a proclamation for County Staff Appreciation Day. They also approved a $190,487.93 final payment to Met-Con for highway renovations, a $142,000 bid from AVM Construction for landfill wall repairs, a $93,400 park planning proposal from HKGi, and a contract amendment with Mayo Clinic Health System. The board unanimously approved all actions and the annual performance review for County Administrator Sara Folsted.
- Approved $1,103,962.70 in bills (5-0)
- Approved $190,487.93 final payment to Met-Con for highway renovation (5-0)
- Approved $142,000 bid from AVM Construction for landfill precast wall repair (5-0)
- Approved $93,400 park system planning proposal from HKGi (5-0)
- Approved Social Services contract amendment with Mayo Clinic Health System (5-0)
- Approved consent agenda with personnel appointments and staff appreciation day (5-0)
- Approved annual performance review for County Administrator Sara Folsted (5-0)
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Dave Miller, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Minutes from the Regular Meeting - July 13, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, Approve Social Services Contract Amendment with Mayo Clinic Health System - Southeast Minnesota Region RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve final payment in the amount of $190,487.93 to Met-Con for the Highway Department's addition and renovation. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, approve the bid from the lowest qualified bidder, AVM Construction, in the amount of $142,000, for the precast wall repair project at the County…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, approve proposal from HKGi for park system planning in the amount of $93,400. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, Recommend proclaiming July 21, 2021 as County Staff Appreciation Day. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Annual Performance Review Summary for Sara Folsted, Rice County Administrator. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jeff Docken, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Jul 20, 2021 · 08:30
Committee of the Whole
Rice County reviews comprehensive plan and park plan updates
The Committee of the Whole will receive updates from several county departments. The session includes reviews of the county's comprehensive and park plans.
- Rice County Comprehensive Plan Update
- Park Plan Review
- Human Resources Department Update
- Highway Department Updates
planningparkshighwayshuman-resources
✓ Decided: County committee hears department updates, no votes taken
The Rice County Committee of the Whole met on July 20, 2021, and heard updates from several departments. Environmental Services presented a draft comprehensive plan for steering committee direction, while Parks & Facilities, Human Resources, and Highway departments gave status reports. No formal decisions were made on these items; the only action was a motion to adjourn, which was approved unanimously.
- Adjourned the meeting: Approved unanimously by all five commissioners.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Dave Miller, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Jul 13, 2021 · 08:30
Board of Commissioners
Rice County Board discusses social services contracts and environmental permits
The Board of Commissioners will review several conditional use permits and plat waivers across various townships. The meeting also includes discussions on social services department contracts, highway contract awards, and jail construction proposals.
- Conditional Use Permits for Bertram, Simms (Prieve), and Johnson
- Waiver of Plat applications for Anderson, Tutewohl (Nielsen), and Jacobson
- Social Services Department contracts with Allina Health System, Northfield Union of Youth, and Northfield Community Action Center
- Minnesota Lawful Gambling Application for Waterville Sportsmans Club
- Construction Manager Agency proposals for Jail/LEC
zoningsocial-servicesgovernment-contractspublic-safetyhighways
✓ Decided: Rice County Board approves jail/LEC construction manager RFP, 4-1
The Rice County Board of Commissioners approved a motion to request proposals for Construction Manager Agency Services for the Jail/LEC project, with Commissioner Galen Malecha voting against. The board also approved several conditional use permits, waivers of plat, social services contracts, and other routine items, all by unanimous vote. A closed session was held for pending litigation, after which the board approved proceeding with right-of-way negotiations.
- Approved request for proposals for Construction Manager Agency Services for the Jail/LEC project (4-1, Malecha dissenting).
- Approved request for proposals for Design Services for the Downtown Block Development Project.
- Approved conditional use permits for Joshua Bertram, Michelle Simms (for Mark & Susan Prieve), and Gary Johnson (for Max Johnson Trucking Inc.).
- Approved waivers of plat for Conrad Anderson, Corey Tutewohl, and Kari Jacobson.
- Approved waiving application fees for Bridgewater Township's zoning amendment and rezoning applications ($560 and $385).
- Approved social services contracts with Allina Health System, Northfield Union of Youth, Northfield Community Action Center, and amendments with HealthFinders and Northfield Healthy Community Initiative.
- Approved lawful gambling exempt permits for Most Holy Trinity Church and Waterville Sportsmans Club, and a temporary on-sale liquor license for Most Holy Trinity Church.
- Approved consent agenda including bills totaling $1,053,121.70 and personnel appointments.
🗳️ How they voted (27 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Minutes for Regular Meeting - June 22, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Joshua Bertram. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Galen Malecha, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Michelle Simms, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Gary Johnson, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Conrad Anderson, on behalf of landowners…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Corey Tutewohl, on behalf of landowners…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Kari Jacobson. The property is located…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve waiving the application fees related to Bridgewater Township’s Zoning Amendment & Rezoning of Property Applications of $560 and $385…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to Approve Social Services Department Contract with Allina Health System RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to Approve Social Services Department Contract with Northfield Union of Youth. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to Approve Social Services Department Contract with Northfield Community Action Center. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to Approve Social Services Department Contract Amendment with HealthFinders RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to Approve Social Services Department Contract Amendment with Northfield Healthy Community Initiative. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, Approval of application for Mn Lawful Gambling Exempt Permit for Most Holy Trinity Church, 4939 N Washington St, Veseli, MN for one day event…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Minnesota Lawful Gambling Application for Exempt Permit for Waterville Sportsmans Club at Ahlman's 9525 230th Street West…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve application & permit for a 1 day to 4 day Temporary On-Sale Liquor License for Most Holy Trinity Church, 4939 N Washington St, Veseli, Mn…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, Approval of Agreement between the University of Minnesota and Rice County for providing Extension programs locally and employing Extension Staff…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to Approve Joint Powers Agreement for Department of Corrections to reimburse Rice County for Autopsy expenses. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, Be it resolved that the Rice County Board of Commissioners approve to request proposals for Construction Manager Agency Services for the Jail/LEC…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Tue Jul 6, 2021 · 08:30
Committee of the Whole
Rice County discusses social services and jail delivery methods
The Committee of the Whole will receive updates on children's mental health and therapy. The Parks & Facilities Department will also discuss downtown updates and the Jail/LEC delivery method.
- Children's Mental Health and Therapy Update
- Jail/LEC Delivery Method discussion
- Downtown Updates
social-servicesmental-healthpublic-safetyparksgovernment-facilities
✓ Decided: County board hears mental health services update, discusses jail project options
The Rice County Committee of the Whole met on July 6, 2021, and heard a presentation from Social Services about adult and child mental health programs, including staffing and services. The board also discussed options for the Jail/LEC project and downtown development, but no formal decisions were made on these items. The meeting adjourned with a unanimous vote.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Jul 1, 2021 · 18:00
Board of Adjustment
Board of Adjustment to review eight variance requests
The Rice County Board of Adjustment is meeting to consider several variance applications. These requests involve building sizes, height limitations, and setbacks from roads and lakes.
- Variance for a 66-ft by 166-ft agricultural barn at 16829 Elmore Trail
- Variance for a 40-ft by 64-ft shed at 150th St W
- Variance for a house and garage addition at 20150 Geneva Ct
- Variance for a new home 25-ft from Clearwater Trail Road Right of Way
- Variance for 6,000-sqft of business use buildings at 9733 Kent Ave
zoningvariancesland-usebuilding-permits
✓ Decided: Rice County BOA approves all 7 variance requests at July 1 meeting
The Rice County Board of Adjustment approved all seven variance requests on the agenda, each unanimously. The variances allow for agricultural structures, home additions, a deck, a shed addition, a new home, and a patio, all with specific conditions. The board found that each request met the criteria in Section 503 of the Zoning Ordinance.
- Approved a variance for Keith Johnson to build a 10,956-sqft agricultural barn with a 19-ft peak height, subject to conditions.
- Approved a variance for Matthew Reiland (on behalf of Brian and Sandra Gora) to build a 2,560-sqft pole shed with an 18-ft peak height, subject to conditions.
- Approved a variance for Gray Companies Inc. (on behalf of Thomson Investments LLC) to add a home and garage addition 37-ft from Cedar Lake, subject to conditions.
- Approved a variance for Anthony Boerner to build a 16-ft by 43-ft deck 68-ft from Shields Lake, subject to conditions.
- Approved a variance for Kyle Fredrickson (on behalf of Chris Czapeswski) to add a 24-ft by 32-ft shed addition 22-ft from Hazelwood Ave Road Right of Way, subject to conditions.
- Approved a variance for Nathan Preston to build a new home 25-ft from Clearwater Trail Road Right of Way, subject to conditions.
- Approved a variance for Steve Pleschourt to add a 295-sqft patio 25-ft from Lake Mazaska, subject to conditions.
320 3rd Street NW, Faribault
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
Motion by Preston Bauer, seconded by Charlie Peters, Reading of the Notice. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea
Motion by John McCarthy, seconded by Charlie Peters, Approval of the Revised Agenda. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the minutes of June 3, 2021. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Keith Johnson. The property is located in Section 8 of Wells…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Matthew Reiland, on behalf of landowners Brian and Sandra Gora. The…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Preston Bauer, seconded by Michael Streiff, to approve the Variance request with the following conditions and findings for Gray Companies Inc., on behalf of landowner Thomson Investments…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Anthony Boerner. The property is located in Section 35 of Erin…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Kyle Fredrickson, on behalf of landowner Chris Czapeswski. The…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Nathan Preston. The property is located in Section 10 of Forest…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Steve Pleschourt. The property is located in Section 31 of Forest…
3 yea
Charlie Peters yea · Preston Bauer yea · Michael Streiff yea
Thu Jul 1, 2021 · 18:00
Planning Commission
Planning Commission to review solar facility and mining permit applications
The Planning Commission is reviewing several Conditional Use Permits and Waiver of Plat applications. These include requests for a solar energy facility, a gravel mining operation, and various building parcels.
- Conditional Use Permit for 1MW solar energy production facility at 18425 Belview Trail
- Conditional Use Permit for gravel mining and crushing operation in Forest Township
- Conditional Use Permit for agricultural equipment repair business at 23790 Essig Ave
- Conditional Use Permit for home occupation therapy business at 9733 Kent Ave
- Three Waiver of Plat applications to create building parcels using Transfer Development Rights
zoningsolarminingland-usepermits
✓ Decided: Planning Commission recommends approval of 5 conditional use permits and waivers
The Rice County Planning Commission met on July 1, 2021, and recommended approval of all five items on the agenda. These included conditional use permits for an agricultural equipment repair business, a solar garden, and a gravel mining operation, as well as two waivers of plat for new building parcels. All recommendations were approved unanimously (4-0) and will be forwarded to the County Board for final action.
- Recommended approval of CUP for agricultural equipment repair business at 23790 Essig Ave, Morristown (4-0)
- Recommended approval of CUP for US Fair Park Solar garden in Section 17, Warsaw Township (4-0)
- Recommended approval of CUP for gravel mining and crushing operation in Section 29, Forest Township (4-0)
- Recommended approval of Waiver of Plat for 2.5-acre TDR parcel in Section 9, Forest Township (4-0)
- Recommended approval of Waiver of Plat for 2.5-acre TDR parcel in Section 20, Wells Township (4-0)
- Tabled Langdon request to next meeting on July 29, 2021
320 3rd Street NW, Faribault
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by John McCarthy, to approve the minutes of June 3, 2021. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea
Motion by Charlie Peters, seconded by Michael Streiff, to recommend approval for the Waiver of Plat request with the following conditions and findings for Corey Tutewohl, on behalf of landowners…
3 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea
Tue Jun 29, 2021 · 08:30
Board of Commissioners
Board of Commissioners to conduct County Park Tour
The Board of Commissioners is holding a work session focused on the Parks & Facilities Department. The primary agenda item is a County Park Tour.
parksfacilitiescounty-government
320 3rd Street NW, Faribault
Tue Jun 22, 2021 · 08:30
Board of Commissioners
Board considers liquor licenses and medical examiner service proposals
The Rice County Board of Commissioners will review several liquor and tobacco license applications for local businesses. The board is also discussing land use permits and a request to bid for landfill wall repairs.
- Conditional Use Permits for Hintz (Erin Township) and Musta (Forest Township)
- Liquor license applications for Roberds Lake Resort, Grandma's Lakeside Resort, Straight River Golf LLC, and LeMeiux Resort
- Tobacco license application for Dennison Depot, LLC
- Request to go for bid for Landfill Pre-cast wall repair
- Request For Proposals for Medical Examiner and/or Crime Scene Investigation Services
liquor-licenseszoningpublic-workspublic-safetycontracts
✓ Decided: Board denies conditional use permit for Stacy Hintz in Erin Township
The Rice County Board of Commissioners denied a conditional use permit for Stacy Hintz in Erin Township, with Commissioner Purfeerst voting against. The board also approved several other permits, contracts, and licenses, including a conditional use permit for Joel Musta and a waiver of plat for Gloria Flicek. All other agenda items were approved unanimously.
- Denied conditional use permit for Stacy Hintz, Erin Township (3-1)
- Approved conditional use permit for Joel Musta, Forest Township (4-0)
- Approved waiver of plat for Gloria Flicek, Wheatland Township (4-0)
- Approved Social Services contract with Rebecca Ericson (4-0)
- Approved Laura Baker Services Association ICF needs determination (4-0)
- Approved going out for bids for landfill pre-cast wall repair (4-0)
- Approved multiple liquor and tobacco licenses for various businesses (4-0)
- Approved consent agenda including $681,969.49 in bills and personnel appointments (4-0)
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Agenda as presented. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, to approve Minutes of regular meeting June 8, 2021. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to deny the Conditional Use Permit request with findings recommended by the Planning Commission for Stacy Hintz. The property is located in Section 5…
3 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Conditional Use Permit request with the conditions and findings recommended by the Planning Commission for Joel Musta. The…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Waiver of Plat request with the conditions and findings recommended by the Planning Commission for Gloria Flicek, on behalf of…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Social Services Department Contract with Rebecca Ericson. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Laura Baker Services Association Intermediate Care Facility Needs Determination. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, approval of going out for bids for Landfill pre-cast wall repair. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve application for County On-Sale Wine License for Roberds Lake Resort, 18197 Roberds Lake Blvd, Faribault, MN 55021 for licensing period…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the application & permit for a 1 day to 4 day Temporary On-Sale Liquor License for North Morristown Community Club, 1050 215th St W…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve application for County On-Sale Wine License for Grandma's Lakeside Resort LLC, 1700 Elmore Way, Faribault, MN 55021 for licensing period…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve application for County On-Sale Wine License for Grandma's Lakeside Resort LLC, 1700 Elmore Way, Faribault, MN 55021 for licensing period…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve application for County On Sale and Sunday Liquor License for Straight River Golf LLC, 23442 Cates Ave, Faribault, MN 55021 from July 1…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, to approve application for County On- Sale Wine License for Thomas Tousignant dba LeMeiux Resort, 7710 Cedar Lake Blvd, Faribault, MN 55021 for…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve application for County On-Sale Wine License for Thomas Tousignant dba LeMeiux Resort, 7710 Cedar Lake Blvd, Faribault, MN 55021 for…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve application for Tobacco License for Dennison Depot, LLC, 12989 Dennison Blvd S, Dennison, MN 55018 for licensing period July 1, 2021…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve Extension to Schedule Hearing. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve request to issue the attached Request for Proposals to Provide Medical Examiner Services and/or Crime Scene Investigation Services…
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve Consent Agenda as presented. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adjourn the meeting. RESULT: Approved
4 yea
Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Jun 22, 2021 · 08:30
Housing & Redevelopment Authority
HRA to consider loan request from Skopos Inc.
The Rice County Housing and Redevelopment Authority is meeting to review a revolving loan request and discuss policy updates.
- Revolving Loan Request-Skopos Inc.
- Policy Updates
housingloanspolicy
✓ Decided: HRA approves Skopos Inc. loan and policy updates
The Rice County Housing & Redevelopment Authority approved a Revolving Loan Request from Skopos Inc. and approved Policy Updates. Both motions passed with all members voting Aye and no Nays. The meeting was adjourned shortly after.
- Approved the Revolving Loan Request from Skopos Inc.
- Approved the Policy Updates.
320 NW 3rd St, Faribault
Wed Jun 16, 2021 · 18:30
Board of Commissioners
Board of Commissioners to meet regarding Board of Appeal & Equalization
The Board of Commissioners is meeting to discuss the Rice County Board of Appeal & Equalization with Assessor Joshua Schoen.
- Rice County Board of Appeal & Equalization
taxesassessmentgovernment-administration
✓ Decided: County board approves 2021 property assessments totaling $7.52 billion
The Rice County Board of Appeal and Equalization approved the 2021 assessment report and valuation changes, with a grand total of $7,518,892,100. They also approved recommended changes for parcels without a local board. One public comment was heard and addressed by the county assessor.
- Approved list of recommended changes for parcels without a Local Board of Appeal and Equalization (5-0)
- Approved County Assessor's recommendations, valuation revisions, and assessment report as filed (5-0)
Tue Jun 15, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to receive department updates
The Committee of the Whole will meet to receive updates from the Information Technology, Parks & Facilities, and Highway departments. The session includes a period for public comments.
- Information Technology department update
- Jail/LEC updates from Parks & Facilities
- Highway/Transportation updates
itfacilitiesjailhighwaystransportation
✓ Decided: Committee hears IT, parks, highway updates; no votes taken
The Rice County Committee of the Whole met on June 15, 2021, and received informational updates from department heads. No formal decisions or votes were taken during the meeting. The only action was a motion to adjourn, which was approved unanimously.
- Adjourned the meeting: Approved unanimously.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Jeff Docken, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Jun 8, 2021 · 08:30
Board of Commissioners
Board considers liquor license renewals and transportation planning contracts
The Rice County Board of Commissioners is meeting to review several liquor license applications and renewals. The board will also consider transportation planning agreements and grant contracts for the Sheriff's Office.
- Professional Services Contract with Bolton & Menk for Transportation Planning
- Cooperative Transportation Planning Agreement with City of Faribault
- Liquor license applications for Roberds Lake Resort, Grandma's Lakeside Resort, Sasquatch Saloon Bar & Grill, Ettilin's Ranchero Supper Club, and Webster Sports & Rec Assn
- Resolution #21-027 to abate a public health nuisance
- Resolution #21-031 regarding the potential sale of non-conservation forfeited land
transportationliquor-licensespublic-healthland-usegrants
✓ Decided: County approves $94,500 engineering contract for I-35/County 9 interchange study
The Rice County Board approved a $94,500 contract with Bolton & Menk for engineering services to analyze a potential interchange at County 9 and I-35, and also approved a cooperative planning agreement with Faribault for the same study. Several licenses and permits were approved, including a temporary wine license for Roberds Lake Resort and liquor license renewals for multiple establishments. The board also adopted resolutions to abate a public health nuisance and to classify non-conservation forfeited land for potential sale, and approved the consent agenda including $494,965.83 in bills.
- Approved $94,500 contract with Bolton & Menk for I-35/County 9 interchange analysis (5-0)
- Approved cooperative transportation planning agreement with City of Faribault (5-0)
- Adopted Resolution #21-027 to abate public health nuisance (5-0)
- Approved temporary on-sale wine license for Roberds Lake Resort (5-0)
- Approved liquor license renewals for Grandma's Lakeside Resort, Sasquatch Saloon, Ettilin's Ranchero, and Webster Sports & Rec (5-0)
- Approved lawful gambling exempt permit for Ducks Unlimited Northfield Chapter (5-0)
- Adopted Resolution #21-031 classifying non-conservation forfeited land for potential sale (5-0)
- Approved consent agenda including $494,965.83 in bills and personnel appointment (5-0)
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to approve Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Minutes of May 25, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adopt Resolution #21-027 - Resolution to Abate Public Health Nuisance. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Cooperative Transportation Planning Agreement with the City of Faribault for an I-35/ County State Aid Highway 9 Interchange…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve a contract with Bolton & Menk, Inc. to provide professional engineering services for a transportation planning analysis of a potential…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve and sign the 2021 State of Minnesota Annual County Boat and Water Safety Grant Contract Agreement. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve and sign the 2020 Grant Contract Agreement Amendment (A-VCET-2020-RICESD-007) RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve application for County On-Sale Wine License for Roberds Lake Resort, 18197 Roberds Lake Blvd, Faribault, MN 55021 for the licensing…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approval of MN Lawful Gambling Exempt Permit for Ducks Unlimited Northfield Chapter # 113, one day event July 29, 2021 to be held at Willingers Golf…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Renewal of On-Sale and Off-Sale 3.2% Malt Liquor License for Grandma's Lakeside Resort, 17000 Elmore Way, Faribault, MN 55021 for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve Renewal of County Combination Liquor License - "On-Sale, Off-Sale & Sunday Liquor License" for Sasquatch Saloon Bar & Grill, 7170…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the application for Renewal of County Combination Liquor License - "On-Sale, Off-Sale & Sunday Liquor License" for Ettilin's Ranchero…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the application for Renewal of On-Sale 3.2% Malt Liquor License for Webster Sports & Rec Assn, 4633 40th St W, Webster, MN 55088 for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt resolution # 21-031 classifying and approving potential sale of non-conservation forfeited land. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adjourn the meeting. Rice County Board of Commissioners Page 3 June 8, 2021 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Jun 3, 2021 · 18:30
Board of Adjustment
Rice County Board of Adjustment to consider three property variances
The Board of Adjustment will review several variance requests regarding building setbacks and structure counts. These items include requests for a new home, an accessory structure replacement near Circle Lake, and a home addition.
- Variance request for a 20-ft road right of way setback at 23220 Glynview Trail, Faribault
- Variance request for an additional accessory structure and a 42-ft lake setback at 4333 120th Street West, Lonsdale
- Variance request for a 68-ft road right of way setback for a home addition at 3420 Jackson Ave, Webster
zoningvarianceshousingland-use
✓ Decided: Board denies Flom variance, approves Trnka and Bartusek variances
The Rice County Board of Adjustment denied a variance request by Kirk and Cami Flom to build a home closer to the road, approved a variance for Tom Trnka to replace an accessory structure near Circle Lake, and approved a variance for Sandra Bartusek to add a home addition closer to the road. All decisions were made with specific conditions and findings.
- Denied Flom variance for 20-ft road setback reduction (unanimous)
- Approved Trnka variance for accessory structure and 42-ft lake setback reduction (4-0, 1 abstention)
- Approved Bartusek variance for 68-ft road setback reduction for home addition (4-1)
320 3rd Street NW, Faribault
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Charlie Peters, Reading of the Notice. RESULT: Approved
3 yea
Michael Streiff yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, Approval of the Agenda. RESULT: Approved
3 yea
Jill Ellingson yea · Michael Streiff yea · Charlie Peters yea
Motion by Jill Ellingson, seconded by John McCarthy, to approve the minutes of May 6, 2021. RESULT: Approved
3 yea
Michael Streiff yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to deny the Variance request for Kirk and Cami Flom with the following findings. The property is located in Section 17 of Walcott Township…
4 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea · Mike Streiff yea
Motion by Preston Bauer, seconded by Jill Ellingson, to approve the Variance request with the following conditions and findings for Tom Trnka (Bendickson). The property is located in Section 16 of…
3 yea
Preston Bauer yea · Jill Ellingson yea · Mike Streiff yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Sandra Bartusek. The property is located in Section 3 of Wheatland…
4 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea · Mike Streiff yea
Thu Jun 3, 2021 · 18:30
Planning Commission
Rice County Planning Commission discusses several conditional use permits and a plat waiver
The Planning Commission will review multiple applications for business uses on agricultural land and a property boundary correction. These items include requests for farmstay lodging, equipment repair, and a construction office/yard.
- Conditional Use Permit: Stacy Hintz for farmstay vacation lodging at 11172 100th St W, Montgomery
- Conditional Use Permit: Joshua Bertram for agricultural equipment repair at 23790 Essig Ave, Morristown
- Conditional Use Permit: Joel Musta for a construction business office and yard at 2068 Millersburg Blvd W, Dundas
- Waiver of Plat: Gloria Flicek for a 6.71-acre parcel in Wheatland Township
zoningagriculturebusinessland-usehousing
✓ Decided: Planning Commission denies farmstay CUP for Erin Township ag tourism business
The Rice County Planning Commission denied a Conditional Use Permit for Stacy Hintz's proposed agricultural tourism farmstay with five camping domes at 11172 100th St W, Montgomery. The denial was recommended on a 3-2 vote after an earlier motion to approve with conditions failed. The commission also approved a waiver of plat for the Tuma family in Wheatland Township and tabled a CUP for an agricultural equipment repair business in Warsaw Township.
- Denied CUP for Hintz farmstay ag tourism business (3-2)
- Approved waiver of plat for Flicek (Tuma) property split in Wheatland Township (5-0)
- Tabled CUP for Bertram agricultural equipment repair business until July 1, 2021 (5-0)
- Approved CUP for Musta contractor's office and yard in Forest Township (4-0, 1 abstention)
320 3rd Street NW, Faribault
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
Motion by John McCarthy, seconded by Jill Ellingson, Reading of the Notice. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Jill Ellingson yea · Preston Bauer yea
Motion by Jill Ellingson, seconded by Michael Streiff, Approval of the Agenda. RESULT: Approved
4 yea
Jill Ellingson yea · Michael Streiff yea · Charlie Peters yea · Preston Bauer yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the minutes of May 6, 2021. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Jill Ellingson yea · Preston Bauer yea
Motion by Preston Bauer, seconded by Jill Ellingson, to recommend approval for the Conditional Use Permit request for Stacy Hintz. The property is located in Section 5 of Erin Township. RESULT: Failed
2 yea
Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to recommend denial based on findings for the Conditional Use Permit request for Stacy Hintz. The property is located in Section 5 of Erin…
2 yea
Charlie Peters yea · Michael Streiff yea
Motion by John McCarthy, seconded by Michael Streiff, to table the Conditional Use Permit for Joshua Bertram until the July 1, 2021 Planning Commission meeting. The property is located in Section 17…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Joel Musta. The property is located…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Michael Streiff, seconded by Charlie Peters, to recommend approval for the Waiver of Plat request with the following conditions and findings for Gloria Flicke, on behalf of landowners…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Jun 1, 2021 · 08:30
Housing & Redevelopment Authority
Rice County HRA to address Emergency Housing Vouchers
The Rice County Housing and Redevelopment Authority is holding a regular meeting. The body is scheduled to take action on Emergency Housing Vouchers.
- Action item: Emergency Housing Vouchers
housingvouchershra
✓ Decided: HRA approves Emergency Housing Vouchers
The Rice County Housing & Redevelopment Authority approved Emergency Housing Vouchers in a unanimous vote. No other substantive decisions were made; the meeting was otherwise procedural and adjourned shortly after.
- Approved Emergency Housing Vouchers (all ayes, no nays)
320 NW 3rd St, Faribault
Tue Jun 1, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to discuss jail construction and downtown updates
The committee will receive updates on the LEC/Jail construction delivery and downtown projects. The meeting also includes a retirement presentation and department updates from Social Services and the Sheriff's Office.
- Delivery information for LEC/Jail Construction
- Downtown updates from Parks & Facilities Department
- Investigation update by Sergeant Nathan Budin
- Social Services Department Accounting Unit update
- SMIF Presentation
jail-constructiondowntown-developmentsocial-servicespublic-safetyadministration
✓ Decided: Committee of the Whole hears updates, no formal decisions
The Rice County Committee of the Whole met on June 1, 2021, and heard presentations from the SMIF Foundation, Social Services, Sheriff's Office, and Parks & Facilities. No formal decisions were made; the only action was to adjourn the meeting.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue May 25, 2021 · 08:30
Board of Commissioners
Rice County Board to hold public hearing on liquor license ordinance changes
The Board of Commissioners will discuss liquor and tobacco license applications and hold a public hearing on changes to Liquor License Ordinance 101. The meeting also includes reviews of conditional use permits and various county contracts.
- Public hearing and adoption of Liquor License Ordinance 101
- Conditional Use Permits for Almen (Northfield Township), County Line Aggregate (Webster Township), and Speckmann (Webster Township)
- Award of Highway Contract No. 2170
- Professional services proposal from Klein McCarthy for Parks & Facilities
- Tobacco and liquor license applications for businesses including Pilot Travel Centers and Boonies Bar & Grill
liquor-licenseszoningcontractspublic-hearingtobacco-licenses
✓ Decided: Board approves multiple conditional use permits and liquor licenses
The Rice County Board of Commissioners approved three conditional use permits, a waiver of plat, a road contract, a professional services proposal, and numerous liquor and tobacco license renewals. They also adopted resolutions for liquor license ordinance, performance measures, and county assessor appointment, and approved the consent agenda including payments and personnel appointments.
- Approved conditional use permit for Colleen Almen (DuWayne Hohrman) in Northfield Twp (5-0)
- Approved conditional use permit for County Line Aggregate (Janet M Tornell Trust) in Webster Twp (5-0)
- Approved conditional use permit for Charlie Speckmann (Inez Esther Horejsi Trust) in Webster Twp (5-0)
- Approved waiver of plat for Arthur VanErp in Walcott Twp (5-0)
- Approved contract #2170 to Crane Creek Asphalt for $155,814.42 (5-0)
- Approved proposal with Klein McCarthy for professional services (4-1, Malecha nay)
- Adopted Resolution #21-029, Liquor License Ordinance 101 (5-0)
- Approved consent agenda including $926,903.55 in bills and personnel appointments (5-0)
🗳️ How they voted (27 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Minutes of May 11, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Conditional Use Permit request with the conditions and findings recommended by the Planning Commission for Colleen Almen, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for County Line Aggregate, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Charlie Speckmann, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Arthur VanErp. The property is located in…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve and sign the State of Minnesota Federal Boating Safety Supplemental Patrol Grant Contract Agreement. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to award contract # 2170 to the low responsible bidder, Crane Creek Asphalt (Div. of Mathy Constr.) in the amount of $155,814.42. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, be it resolved that the Rice County Board of Commissioners approve the proposal with Klein McCarthy for professional services. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adopt Resolution #21-029, Liquor License Ordinance 101. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the tobacco license application for Craig Finnesgard dba Lake Country Convenience & Bait, 15090 Shieldsville Boulevard, Faribault, MN…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve tobacco license application for Pilot Travel Centers LLC dba Pilot Travel Center #576, 8051 Bagley Avenue, Northfield, MN, 55057 for the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve tobacco license application for Willing Partners, Inc. dba Willingers Golf Club, 6797 Canby Trail, Northfield, MN, 55057 for the licensing…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve On-Sale, Off-Sale & Sunday liquor license renewal application for Boonies Beef & Brew, Inc. dba Boonies Bar & Grill, 3301 Millersburg…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the On-Sale & Sunday liquor license renewal application for Willing Partners Inc dba Willinger's Golf Club, 6797 Canby Trail…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the On-Sale & Sunday liquor license renewal application for Winjum, Inc. dba Winjum's Shady Acre Resort, 17759 177th Street West…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Renewal of On-Sale & Off- Sale 3.2% Malt Liquor license application for Thomas Tousignant dba LeMeiux Resort, 7710 Cedar Lake…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Renewal of On-Sale & Off- Sale 3.2% Malt Liquor license application for Roberds Lake Resort dba Roberds Lake Resort, 18197 Roberds…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Renewal of Off-Sale 3.2% Malt Liquor license application for Pilot Travel Centers LLC dba Pilot Travel Center #576, 8051 Bagley…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the Renewal of On-Sale 3.2% Malt Liquor license application for Veseli Area Lions Club Inc. dba Veseli Area Lions Club, 4951 Jackson…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue May 18, 2021 · 08:30
Committee of the Whole
Rice County discusses jail architectural firm and downtown development
The Committee of the Whole will hold a work session to discuss facilities and highway updates. The body is reviewing plans for the Jail/LEC and downtown development.
- Jail/LEC Architectural Firm discussion
- Downtown Development discussion
- Highway updates
jaildowntown-developmenthighwayspublic-facilities
✓ Decided: Committee discusses jail architect options, downtown plan
The Rice County Committee of the Whole met and heard updates from the Parks & Facilities and Highway departments. No formal decisions were made; the jail architectural firm discussion and downtown development committee formation were only discussed. The meeting adjourned with a unanimous vote.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Jim Purfeerst, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue May 11, 2021 · 08:30
Board of Commissioners
Board to discuss law enforcement jail location selection
The Rice County Board of Commissioners will meet to discuss the selection of a law enforcement jail location. The board is also reviewing various liquor and tobacco license renewals and a Department of Corrections contract.
- Law Enforcement Jail Location Selection
- Department of Corrections Contract for 2021-2022
- SAN (Storage Array Network) Replacement
- Greater Zumbro River Comprehensive Watershed Management Plan Joint Powers Agreement
- Liquor and tobacco license renewals for Brewster's Bar & Grill, Channel Inn, and Boonies Beef & Brew, Inc.
jaillaw-enforcementlicensingit-infrastructurewatershed-management
✓ Decided: Rice County Board approves moving forward with new jail and law enforcement center
The Rice County Board of Commissioners approved moving forward with the process of constructing a new Jail and Law Enforcement Center at a green site location, with a 3-2 vote. The board also approved several routine items, including a $75,000 Seagate SAN purchase, a watershed management plan agreement, and various licenses and permits. All other motions were approved unanimously.
- Approved moving forward with new Jail and Law Enforcement Center at green site (3-2)
- Approved $75,000 Seagate SAN purchase from North American Systems International
- Approved Greater Zumbro River Comprehensive Watershed Management Plan Joint Powers Agreement
- Approved clerical errors for 2020 assessment
- Approved Local Disaster Abatement of $3,344 for 2020 taxes
- Approved Local Disaster Credit of $3,452 for 2021 taxes
- Approved 2020 Emergency Management Performance Grant
- Approved consent agenda including bills totaling $521,310.17
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Minutes of April 27, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Greater Zumbro River Comprehensive Watershed Management Plan Joint Powers Agreement. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the clerical errors for the 2020 assessment. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve Local Disaster Abatement in the amount of $3,344 for 2020 taxes. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Local Disaster Credit in the amount of $3,452 for 2021 taxes. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, Approve purchase of Seagate SAN from North American Systems International for $75,000 as quoted in quote 12434 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve and sign the State of Minnesota Homeland Security and Emergency Management's 2020 Emergency Management Performance Grant. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Proclamation of National Police Week. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Radio Tower Antenna Service Work. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve change of date for the gambling license from 9/6/2020 to 9/5/2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve Application for Exempt Permit for the Church of the Annunciation, 4996 Hazelwood Avenue, Northfield, MN, 55057 on October 3, 2021…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to adopt Resolution #21-026, Premises Permit Application for Morristown Fire Relief Association at Straight River Golf Course, 23442 Cates…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Tobacco license renewal application for Boonies Beef & Brew, Inc., 3301 Millersburg Boulevard, Faribault, MN, 55021 for the licensing…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, to approve application for renewal of On-Sale, Off-Sale & Sunday liquor license for LJW Enterprises, Inc. dba Brewster's Bar & Grill, 9856 50th…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve application for renewal of On- Sale, Off-Sale & Sunday liquor license for MJVoegele, Inc. dba Channel Inn, 23219 Farwell Avenue, Warsaw…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, Request the board to approve the contract for prosecution services for cases originating at the Minnesota Correctional Facility Faribault for…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve moving forward with the process of constructing a new Jail and Law Enforcement Center at a green site location. RESULT: Approved
3 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu May 6, 2021 · 18:00
Board of Adjustment
Rice County Board of Adjustment to review ten variance requests
The Board of Adjustment will meet via electronic means to consider several land-use variances. These requests involve accessory structures, retaining walls, setbacks, and building locations across various townships.
- Shed height and size variances in Webster, Forest, and Cannon City Townships
- Retaining wall setback variances at 6869 Garfield Trail, Faribault
- Horse shed road right of way variance at 11031 Shieldsville Blvd, Montgomery
- Home and garage bluff and lake setback variances in Forest Township
- Grain bin stream setback variance at 24531 Ibson Ave, Faribault
zoningland-useagricultureresidentialshoreland
✓ Decided: Board approves all 10 variance requests at May 6 meeting
The Rice County Board of Adjustment approved all ten variance requests on the agenda, covering accessory structures, retaining walls, a grain bin, and home additions. Each approval included specific conditions, such as vegetative buffers, septic inspections, and time limits for obtaining permits. The board also approved the agenda and minutes from the previous meeting.
- Approved 8-ft height variance for Coleman shed (3-1)
- Approved retaining wall variances for Ditch Creek Landscape (unanimous)
- Approved size and height variance for Glanzer agricultural shed (unanimous)
- Approved 6-ft height variance for Gryc shed (3-1)
- Approved 80-ft setback variance for Helmers & Moudry horse shed (3-1)
- Approved 10-ft bluff setback variance for Nugent home (unanimous)
- Approved 15-ft stream setback variance for Petricka grain bin (unanimous)
- Approved bluff/steep slope variance for Sanders (unanimous)
320 3rd Street NW, Faribault
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by Preston Bauer, Reading of the Notice. RESULT: Approved
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by John McCarthy, Approval of the Agenda. RESULT: Approved
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the minutes of April 1, 2021. RESULT: Approved
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Jeff & Debra Coleman. The property is located in Section 35 of…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Ditch Creek Landscape LLC (O'Leary). The property is located in…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston Bauer to approve the Variance request with the following conditions and findings for Keith Glanzer. The property is located in Section 3 of Forest…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston Bauer to approve the Variance request with the following conditions and findings for James Gryc The property is located in Section 5 of Cannon City…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters to approve the Variance request with the following conditions and findings for Helmers & Moudry The property is located in Section 7 of Erin…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Shawn Nugent The property is located in Section 22 of Forest…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Joe Petricka. The property is located in Section 21 of Richland…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Adam Sanders. The property is located in Section 2 of Shieldsville…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the Variance request with the following conditions and findings for Robert Sommers. The property is located in Section 19 of Richland…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Matthew Reiland. The property is located in Section 31 of Forest…
3 yea
Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Thu May 6, 2021 · 18:00
Planning Commission
Rice County Planning Commission discusses land use and conditional use permits
The commission will review several applications for conditional use permits and a waiver of plat. These items include proposals for agricultural tourism, an aggregate mining operation, and an excavation company office.
- Conditional Use Permit: Agricultural tourism business at 9748 110th St E, Northfield
- Conditional Use Permit: Aggregate mining operation at 3240 Hazelwood Ave, Webster
- Conditional Use Permit: Farmstay vacation lodging at 11172 100th St W, Montgomery
- Conditional Use Permit: Excavation company office and yard at 4480 30th St W, Webster
- Waiver of Plat: 1.32-acre building parcel via Transfer Development Right in Walcott Township
zoningagricultureminingland-usetourism
✓ Decided: Planning Commission recommends approval of agricultural tourism CUP with conditions
The Rice County Planning Commission recommended approval of a conditional use permit for an agricultural tourism business at 9748 110th St E, Northfield, with conditions limiting events to 20 larger (up to 300 people) and 40 smaller (up to 50 people) per year. The commission also recommended approval of a renewal for an aggregate mining operation in Webster Township, approved a contractor's office and yard CUP, and approved a waiver of plat for a 1.32-acre parcel. A farmstay lodging CUP was tabled to the June 3, 2021 meeting.
- Recommended approval of CUP for agricultural tourism (Almen/Hohrman) with 13 conditions (4-0)
- Recommended approval of CUP renewal for aggregate mining (County Line Aggregate) with 17 conditions (4-0)
- Recommended approval of CUP for contractor's office and yard (Speckmann) with 10 conditions (4-0)
- Recommended approval of waiver of plat for 1.32-acre TDR parcel (VanErp) with 6 conditions (4-0)
- Tabled CUP for farmstay lodging (Hintz) to June 3, 2021 meeting (4-0)
320 3rd Street NW, Faribault
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by Jill Ellingson, Reading of the Notice. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, Approval of the Agenda. RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the minutes of April 1, 2021, RESULT: Approved
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Colleen Almen, on behalf of landowner…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for County Line Aggregate, on behalf of…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Jill Ellingson, to table the Conditional Use Permit for Stacy Hintz until June 3, 2021 Planning Commission meeting. The property is located in Section 5 of Erin…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Charlie Speckmann, on behalf of…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Arthur Van Erp. The property is…
3 yea
Preston Bauer yea · Charlie Peters yea · Jill Ellingson yea
Tue May 4, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to review financial and department updates
The committee will receive department updates regarding property tax, elections, and adult mental health. The body will also review cash, pooled investments, and a quarterly financial report for the period ending March 31, 2021.
- Property Tax & Elections department update
- Social Service Department update on Adult Mental Health
- Cash & Pooled Investments report for period ending March 31, 2021
- Quarterly Financial Report for period ending March 31, 2021
financetaxesmental-healthelectionsgovernment-administration
✓ Decided: Committee hears annual reports from county departments
The Rice County Committee of the Whole met on May 4, 2021, and received informational presentations from the Property Tax & Elections, Social Services, and Finance departments. No formal decisions were made; the only action was a motion to adjourn, which was approved.
- Adjourned meeting (motion by Dave Miller, seconded by Jim Purfeerst)
Tue Apr 27, 2021 · 08:30
Board of Commissioners
Rice County Board discusses bridge replacement and liquor licensing changes
The Board of Commissioners will review several departmental items including social services fees and IT equipment cycles. Discussion includes a contract for a bridge replacement on 230th Street East and potential changes to liquor sale regulations.
- Contract #2175: Bridge replacement on 230th Street East
- Resolution #21-025: Public hearing date for possible changes to 3.2% malt liquor and intoxicating liquor licensing/sales
- Agreement with Jane Egerdal for Registered Nurse Services
- Resolution #21-024 regarding title clearing
- Selection of law enforcement jail location
infrastructureliquor-lawspublic-healthlaw-enforcementgovernment-administration
✓ Decided: Board awards $154,572 road contract to BCM Construction
The Rice County Board approved a $154,572 road construction contract with BCM Construction, Inc., and approved several other items including a fee schedule, a public hearing date for liquor licensing changes, a proclamation, a nursing agreement, IT purchases, a title clearance resolution, and the consent agenda. The board also tabled jail site selection until May 11, 2021.
- Approved Social Services Department Fee Schedule (5-0)
- Awarded contract #2175 to BCM Construction, Inc. for $154,572 (5-0)
- Approved Resolution #21-025 setting public hearing for liquor licensing changes on May 25, 2021 (5-0)
- Approved Proclamation of National Correctional Officers Week (5-0)
- Approved agreement with Jane Egerdal, RN for nursing services (5-0)
- Approved IT server refresh and PC/laptop/monitor purchases from CIT (5-0)
- Approved Proactive Managed Services Agreement with CIT for $6,459.60/month (5-0)
- Tabled jail and law enforcement center site selection until May 11, 2021 (no vote recorded)
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Minutes of April 13, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve Social Services Department Fee Schedule. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, To award contract # 2175 to BCM Construction, Inc. the low responsible bidder in the amount of $ 154,572.00. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve Resolution #21-025, Setting of Public Hearing Date for Possible Changes to Regulating the Licensing and Sale of 3.2% Malt Liquor (On…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, approve the Proclamation of National Correctional Officers Week in Rice County. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve agreement between Rice County Public Health and Jane Egerdal, RN for professional registered nursing services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve refresh of four servers from CIT as quoted. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approval of purchase of PC's, laptops, and monitors from CIT for annual refresh. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Proactive Managed Services Agreement with CIT for $6459.60 per month. Rice County Board of Commissioners Page 2 April 27, 2021 RESULT…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to Adopt Resolution #21-024 to Clear title. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Apr 27, 2021 · 08:30
Housing & Redevelopment Authority
Rice County HRA to consider Fair Housing Month Proclamation
The Housing and Redevelopment Authority will meet to review minutes and a proclamation for Fair Housing Month. The body will also receive a quarterly report and an update regarding the Resident Commissioner.
- Fair Housing Month Proclamation
- Quarterly Report
- Resident Commissioner update
housingfair-housingadministration
✓ Decided: HRA meeting held; two motions approved unanimously, no details recorded
The Rice County Housing & Redevelopment Authority met on April 27, 2021, and approved two action items via unanimous votes. The minutes do not describe what the actions were, and no other substantive decisions were recorded. The meeting adjourned at 10:44 am.
- Approved action item A (motion by Jeff Docken, seconded by Steve Underdahl) — all AYES, no NAYS
- Approved action item B (motion by Dave Miller, seconded by Galen Malecha) — all AYES, no NAYS
320 NW 3rd St, Faribault
Tue Apr 20, 2021 · 08:30
Committee of the Whole
Rice County reviews future jail and law enforcement center options
The Committee of the Whole will hold a public information and feedback session regarding options for a future jail and law enforcement center. The meeting also includes updates from the highway department and a facilities proposal.
- Public Information and Feedback Session: Future Jail and Law Enforcement Center Option Review
- Cannon River Wilderness Area Buckthorn Proposal
- Highway Department updates
law-enforcementjailfacilitiesroadsenvironment
✓ Decided: County agrees to revisit buckthorn removal after studies
The Rice County Committee of the Whole heard a University of Minnesota student proposal for long-term buckthorn removal funding in the Cannon River Wilderness Area. Commissioners agreed action is needed but will revisit after more studies. Highway items (I35 planning, County Road 9, Dundas Corridor Study) were also deferred. No formal votes were taken; the meeting adjourned without recorded decisions.
- Agreed to revisit buckthorn removal plan after studies (no vote)
- Deferred I35 planning and County Road 9 updates (no vote)
- Deferred Dundas Corridor Study (no vote)
- Adjourned meeting (motion approved, no recorded votes)
Tue Apr 20, 2021 · 17:00
Committee of the Whole
Rice County discusses jail collaboration with Steele County
The Committee of the Whole will discuss potential jail collaboration considerations. The discussion includes a review of the Steele Co CJ System Assessment draft.
- Steele Co CJ System Assessment 4.15 Draft
- Steele-Rice County Jail Collaboration Considerations
jailpublic-safetygovernment-collaboration
320 3rd St. NW, Faribault
Tue Apr 20, 2021 · 18:30
Committee of the Whole
Public session on future jail and law enforcement center options
The Committee of the Whole is holding a public information and feedback session. The meeting focuses on reviewing options for a future jail and law enforcement center.
- Public Information and Feedback Session: Future Jail and Law Enforcement Center Option Review
law-enforcementjailpublic-safetyinfrastructure
320 3rd St. NW, Faribault
Tue Apr 13, 2021 · 08:30
Board of Commissioners
Rice County Board discusses zoning, social services, and highway contracts
The Board of Commissioners will review several zoning amendments and conditional use permits across various townships. The meeting also includes discussions on social services policies, highway contract awards, and regional rail service support.
- Zoning Map Amendment for Section 31, Webster Township
- Conditional Use Permit/Engel in Section 24, Wheatland Township
- Conditional Use Permit/Tempel (Hu) in Section 18, Northfield Township
- Award of Contract # 2174 Bridge Replacement
- Resolution of Support for a Regional Passenger Rail Corridor Study
zoningsocial-serviceshighwaytransportationgovernment-administration
✓ Decided: Rice County Board approves $133,545 road contract, other items
The Rice County Board of Commissioners approved a $133,545 contract with Access On Time for highway project #2174, along with several other items. The board also approved a resolution supporting a study for a passenger rail line connecting South Central Minnesota to the Twin Cities. All votes were unanimous (5-0).
🗳️ How they voted (21 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Minutes of March 23, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to deny the Zoning Map Amendment to Rezone property from Urban Reserve to Agricultural for Timothy & Kimberly Kes based on the findings as discussed…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Jared Engel. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Scott Tempel, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approve Social Services Department Social Welfare Fund Policy RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, Approve Social Services Department Contract with Alternative Resolutions, Inc. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Galen Malecha, To award contract # 2174 to Fitzgerald Excavating in the amount of $133,545.00 for project # SAP 066-598-024. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve of Resolution # 21-022 and MnDOT Agreement # 1046040 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approval of Resolution 21-023 Resolution of Support for State General Funds for a Corridor Study of Regional Passenger Rail Service Connecting South…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Renewal of Consumption & Display Permit for The Barn at Crocker's Creek LLC, 24141 Bagley Avenue, Faribault, MN, 55021 for period of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Renewal of Consumption & Display Permit for Thomas Tousignant dba LeMeiux Resort, 7710 Cedar Lake Road, Faribault, MN, 55021 for the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, To approve the MN Lawful Gambling Application for Exempt Permit for A Race Worth Winning Als at Willinger's Golf Club, 6797 Canby Trail, Northfield…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, Approve payment of $85,324.40 to SHIfor Rice County Microsoft licensing from March 2020 to March 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, Approve renewal of VMWare maintenance from Loffler for $31,038.88 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the proclamation of National Telecommunicators' Week in Rice County RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the attached amended agreement extending Hearing for James Ingham past June 1 and direct the Board Chair and County Administrator to sign…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to adopt Resolution #21-021 authorizing sponsorship of trails operated by the Faribo Sno-Go Club. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to appoint Dave Detert as the Rice County resident representative to the Mills Town Trail and SMART Board. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Apr 6, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to discuss jail study and social services
The committee will hold a work session to review updates from the Recorder's Office and Social Services. Discussions include the Social Welfare Fund Policy and a law enforcement jail study.
- Social Services Social Welfare Fund Policy
- Law Enforcement Jail Study discussion
- Child protection services report
- Recorder's Office department update
social-servicesjaillaw-enforcementcounty-administration
Thu Apr 1, 2021 · 18:00
Board of Adjustment
Board of Adjustment to review six variance requests
The Board of Adjustment will consider six separate variance applications regarding structure size, height, and setbacks. These requests affect properties in Wells, Warsaw, Shieldsville, and Morristown Townships.
- Variance for 42-ft by 60-ft pole shed at 5550 Kelly Lake Trail
- Variance for roof mounted solar array at 5396 Elkton Trail
- Variance for 40-ft by 64-ft shed setback at 9586 170th St W
- Variance for 30-ft by 40-ft garage height at 8905 Shields Lake Path
- Variance for 30-ft by 50-ft shed setback at 24616 Jackson Ave.
zoningvariancesland-usebuildings
✓ Decided: Board approves all six variance requests at April 1 meeting
The Rice County Board of Adjustment approved all six variance requests on the April 1, 2021 agenda, covering accessory structures, a solar array, and setbacks. Each approval included specific conditions, such as size and height limits, and some were approved with amendments. The board also approved the meeting minutes and agenda.
- Approved Bennett variance for 2,520-sqft pole shed with 24-ft peak height (4-1)
- Approved Gadbois (Blow) variance for roof-mounted solar array on existing shed (5-0)
- Approved Carlander variance for 40x64-ft shed at 44-ft from road right-of-way (5-0)
- Approved Graves variance for 1,200-sqft garage with 15-ft peak height (4-1)
- Approved Schema variance for 1,536-sqft garage with 16-ft peak height, amended from 18-ft (5-0)
- Approved Peroutka variance for 30x50-ft shed at 53-ft from road right-of-way (5-0)
320 3rd Street NW, Faribault
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Preston Bauer, Reading of the Notice. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by John McCarthy, Approval of the Agenda. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the minutes of March 4, 2021. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Brad & Carissa Bennett. The property is located in Section 8 of…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Nicholas Gadbois, on behalf of landowner Michael Blow. The…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Preston Bauer, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for John Carlander. The property is located in Section 15 of…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Preston Bauer, to approve the Variance request with the following conditions and findings for Jason Graves. The property is located in Section 2 of Shieldsville…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Charlie Peters, to approve the Variance request with the following conditions and findings for Anthony Schema. The property is located in Section 21 of Wells…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by Jill Ellingson, to approve the Variance request with the following conditions and findings for Joe Peroutka. The property is located in Section 21 of Morristown…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Thu Apr 1, 2021 · 18:00
Planning Commission
Planning Commission to review solar facility and zoning changes
The Planning Commission is meeting to discuss a zoning map amendment and three conditional use permits. These items involve land use changes for agriculture, business, and energy production.
- Rezoning of 141 acres from Urban Reserve to Agricultural in Webster Township (Section 31)
- Conditional Use Permit for a 1MW solar energy production facility at 7609 Dennison Blvd, Northfield
- Conditional Use Permit for an agricultural tourism business at 9748 110th St E, Northfield
- Conditional Use Permit for a contractor's office and appliance installation yard in Wheatland Township (Section 24)
zoningsolar-energyagricultureland-useconditional-use-permit
✓ Decided: Planning Commission recommends denial of Webster Township rezone request
The Rice County Planning Commission voted unanimously to recommend denial of a zoning map amendment to rezone five parcels totaling about 141 acres in Webster Township from Urban Reserve to Agricultural. The request by Timothy and Kimberly Kes was opposed by the City of Lonsdale, which cited its 2040 comprehensive plan and the purpose of the Urban Reserve district. The commission also tabled a conditional use permit for an agricultural tourism business in Northfield Township until May 6, 2021, and recommended approval of two other conditional use permits: one for a contractor's office and storage in Wheatland Township and one for a 1-MW solar facility in Northfield Township.
- Recommended denial of zoning map amendment to rezone 141 acres from Urban Reserve to Agricultural in Webster Township (Kes).
- Tabled conditional use permit for agricultural tourism business in Northfield Township (Almen/Hohrman) until May 6, 2021.
- Recommended approval of conditional use permit for contractor's office and storage in Wheatland Township (Engel) with conditions.
- Recommended approval of conditional use permit for 1-MW solar energy facility in Northfield Township (Tempel/Hu) with conditions.
- Approved the agenda and minutes of the March 4, 2021 meeting.
320 3rd Street NW, Faribault
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by Jill Ellingson, Reading of the Notice. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by John McCarthy, seconded by Michael Streiff, Approval of the Agenda. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to approve the minutes of March 4, 2021. RESULT: Approved
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Charlie Peters, seconded by John McCarthy, to recommend denial of the Zoning Map Amendment to Rezone property from Urban Reserve to Agricultural for Timothy & Kimberly Kes. The properties…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Michael Streiff, to table the Conditional Use Permit for Colleen Almen, on behalf of landowner DuWayne Hohrman, until the May 6, 2021 Planning Commission…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Michael Streiff, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Jared Engel. The property is located…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Motion by Jill Ellingson, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Scott Tempel, on behalf of landowner…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Mar 23, 2021 · 08:30
Board of Commissioners
Rice County Board discusses public health fees and vehicle purchases
The Board of Commissioners will review environmental service permits, social services coordination, and highway resolutions. Discussions also include a proposed public health nurse visit fee increase and department vehicle purchases.
- Public Health Fee Increase - Public Health Nurse Visit
- Vehicle Purchase-Facilities Truck
- Vehicle Purchase-Department of Veteran Services Transport Van
- Resolution # 21-018 MnDOT Agreement #1045697
- Resolution # 21-019 MnDOT Agreement #1045068
public-healthgovernment-vehiclesroadsenvironmental-servicessocial-services
✓ Decided: Rice County Board approves all permits, contracts, and purchases on agenda
The Rice County Board of Commissioners approved all items on the agenda, including resolutions, conditional use permits, temporary equipment placement permits, waivers of plat, a social services contract, vehicle purchases, highway agreements, a public health fee change, and the consent agenda. All votes were unanimous with no opposition.
- Adopted Resolution #21-020 supporting the Lower MN River Watershed One Watershed, One Plan project.
- Approved conditional use permits for Dale Drentlaw (Wells Twp), Ross Morrison (Forest Twp), and Randy Timm/Timm Trucking Inc. (Morristown Twp).
- Approved temporary equipment placement permits for Mitch Froehlich/Ulland Brothers (Morristown Twp) and Crane Creek Asphalt (Forest Twp).
- Approved waivers of plat for Ryan Blumhoefer (Richland Twp), Brett Marschall (Webster Twp), Eric Schweisthal (Cannon City Twp), and Paul Thielbar (Shieldsville Twp).
- Approved a contract with Blue Earth County for Social Services.
- Approved purchase of a 2021 Ram 2500 plow truck and a 2021 Toyota Sienna Hybrid van.
- Approved highway resolutions #21-018 and #21-019 with MnDOT agreements.
- Approved a change in Public Health Nurse home visit fee to $180 per visit, effective 4/1/2021, and the consent agenda including bills totaling $1,395,728.72.
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the minutes of March 9, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adopt Resolution #21-020 - Resolution to Support a Lower MN River Watershed East One Watershed, One Plan Project. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Dale Drentlaw. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Ross Morrison. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve the Conditional Use Permit with the conditions and findings recommended by the Planning Commission for Randy Timm, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Temporary Equipment Placement Permit with the conditions and findings recommended by the Planning Commission for Mitch Froehlich of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Temporary Equipment Placement Permit with the conditions and findings recommended by the Planning Commission for Crane Creek…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Ryan Blumhoefer, on Rice County Board of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Brett Marschall, on behalf of landowner…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Eric Schweisthal, on behalf of landowner…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the Waiver of Plat with the conditions and findings recommended by the Planning Commission for Paul Thielbar. The properties are…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Social Services Department Contract with Blue Earth County. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve purchase of 2021 Ram 2500 Tradesman Crew Cab 4X4 (plow truck) for Parks and Facilities Department. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the purchase of 2021 Toyota Sienna Hybrid LE AWD Van for the Department of Veteran Services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Galen Malecha, to approve of Resolution # 21-018 and MnDOT Agreement # 1045697 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve of Resolution # 21-019 and MNDOT Agreement # 1045068 RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve change in Rice County Public Health Fee for Public Health Nurse Home visit to $180.00 / visit effective 4.1.2021. Rice County Board of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve Consent Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Mar 16, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to receive highway update
The Committee of the Whole is meeting for a work session. The primary agenda item is a highway update provided by Dennis Luebbe.
- Highway update from Dennis Luebbe
highwaysinfrastructuretransportation
✓ Decided: County board hears highway updates on bridges, salt contracts, and trail extension
The Rice County Committee of the Whole met and heard a report from Highway Department's Dennis Luebbe on upcoming contracts and seasonal work. No formal decisions were made; the only action was a motion to adjourn, which was approved. Topics discussed included salt and sand contracts, bridge projects on County Roads 9, 80, 90, and 6, and a possible trail extension near Kwik Trip/Dairy Queen.
- Approved motion to adjourn the meeting.
- Heard update on salt and sand contract and future salt sourcing.
- Heard update on County Rd. 9 Bridge project with Steele County, expected completion mid-June.
- Heard update on County Rd. 80 Bridge replacement, expected completion mid-July.
- Heard update on County Rd. 90 bridge repair, currently out for bids.
- Heard update on County Rd. 6 project west of Webster, no start date set.
- Heard update on resurfacing and safety improvements for County Rd. 62 to Crane Creek.
- Discussed possible trail extension from Kwik Trip/Dairy Queen area to the Broaster.
Tue Mar 9, 2021 · 08:30
Board of Commissioners
Rice County Board to review road contracts and union contract ratification
The Board of Commissioners will consider several highway contracts and a zoning map amendment in Webster Township. The meeting includes decisions on liquor permits and the ratification of AFSCME Council 65 union contracts for 2019-2021.
- Zoning map amendment for Section 31, Webster Township from Urban Reserve to Agricultural/Kes
- Award of Contract #21-51 Aggregate Surfacing, #21-52 Pavement Markings, and #2173 CSAH 6 Rehabilitation
- Ratification of 2019, 2020 & 2021 AFSCME Council 65 Union Contract
- Consumption & Display Permit renewal for Red Barn Farm of Northfield LLC
- Temporary 3.2% Malt Liquor License for Church of St Patrick, Shieldsville
zoningroadslabor-contractsliquor-licensinggovernment-administration
✓ Decided: Board approves $2.5M road contract, sends zoning item back to commission
The Rice County Board of Commissioners approved all agenda items unanimously, including a $2.5 million road construction contract and several smaller contracts. They also voted to send a zoning map amendment request back to the Planning Commission for a reopened public hearing. The board approved the consent agenda, which included paying bills totaling $987,286.20 and ratifying a union contract.
- Approved sending the Kes zoning map amendment back to the Planning Commission for a reopened public hearing.
- Approved a 3-year ESRI software agreement for the Assessor's Office.
- Approved contract #21-51 to Keilmeyer Construction, Inc. for $408,370.80.
- Approved contract #21-52 to Traffic Marking Services, Inc. for $84,030.10.
- Approved contract #2173 to McNamara Contracting Inc. for $2,523,696.00, contingent on MN-DOT concurrence.
- Approved amendments to a Mn-DOT contract and a professional service contract with Stonebrooke Engineering.
- Approved a consumption and display permit renewal for Red Barn Farm and a temporary malt liquor license for Church of St Patrick.
- Approved the consent agenda, including $987,286.20 in bills, personnel appointments, and ratification of the AFSCME union contract.
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
Motion by Steve Underdahl, seconded by Dave Miller, to approve the Agenda as presented. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Minutes of February 23, 2021. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to send the item back to the Planning Commission's April 1, 2021 meeting to reopen the public hearing to hear the additional information from City of…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve ESRI Small Municipal and County Government Enterprise 3 year agreement. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve award contract #21-51 to Keilmeyer Construction, Inc. in the amount of $408,370.80. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve award contract #21-52 to Traffic Marking Services, Inc. in the amount of $84,030.10. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jim Purfeerst, to approve award contract #2173 , to McNamara Contracting Inc. the lowest responsible bidder, for project SAP 066-606-012/SP 066- 070-023…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve the amendment to Mn-DOT contract # 1044855, and to approve amending the professional service contract with Stonebrooke Engineering…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Renewal of Consumption & Display Permit for Red Barn Farm of Northfield LLC, 10063 100th Street East, Northfield, MN 55057 for the…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, To approve the Temporary 3.2% Malt Liquor License Application for Church of St Patrick, Shieldsville, 7525 Dodd Road, Faribault, MN 55021 for March…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve and sign the Agreement between Rice County and Advanced Correctional Healthcare, Inc. (ACH) for the Provision of Rice County Board of…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, Approve agreement with Kristen Cook for home based physical therapy services protecting, promoting and improving the health of individuals and…
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the 60 month agreement with CIT to provide managed backup services for $4380 per month. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to approve Consent Agenda as presented. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to approve Ratification of 2019, 2020 & 2021 AFSCME Council 65 Union Contract. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adjourn the meeting. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Tue Mar 9, 2021 · 08:30
Housing & Redevelopment Authority
Rice County HRA to address payment standards
The Rice County Housing and Redevelopment Authority is holding a special meeting. The body will consider action items regarding payment standards.
housingpayment-standards
✓ Decided: Rice County HRA meeting held; action item approved unanimously
The Rice County Housing & Redevelopment Authority met on March 9, 2021, and approved an unspecified action item by unanimous vote. The meeting was adjourned shortly after.
- Approved an action item (motion by Jeff Docken, seconded by Dave Miller) with all members voting in favor.
- Adjourned the meeting at 9:09 am.
320 NW 3rd St, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Jeff Docken, seconded by Dave Miller, to approve (THE ACTION) RESULT: Approved
5 yea
Jeff Docken yea · Galen Malecha yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Thu Mar 4, 2021 · 18:00
Board of Adjustment
Board of Adjustment to review two variance requests for shoreland properties
The Board of Adjustment is meeting to consider variance requests for two properties zoned as Recreational Development Shoreland. The board will determine if the applicants meet the criteria for exceptions to setback, size, and height limitations.
- Variance request for 13511 Fox Lake Trail for a 22-ft by 28-ft garage including a 5-ft road right of way setback variance
- Variance request for 15462 Shieldsville Blvd for a 40-ft by 80-ft pole shed with a 24-ft peak height
- Variance request for 15462 Shieldsville Blvd to allow business use buildings totaling 4,100-sqft
- Variance request for 15462 Shieldsville Blvd for a 2,000-sqft variance from shoreland accessory structure size limits
zoningvariancesshorelandbuilding-permits
✓ Decided: Board approves two shoreland variances in Forest and Wells Townships
The Rice County Board of Adjustment unanimously approved two variance requests. The first allowed Rod Kunkel to build a 22-ft by 28-ft garage within a bluff and steep slope area and 15-ft from the road right-of-way on Fox Lake Trail in Forest Township. The second allowed Dale Drentlaw to add a 40-ft by 80-ft pole shed with a 24-ft peak height, exceeding accessory structure limits, on Shieldsville Blvd in Wells Township. Both approvals included conditions and findings that the requests met zoning ordinance criteria.
- Approved Kunkel variance for garage in bluff/steep slope and 15-ft setback (5-0)
- Approved Drentlaw variance for 3,200-sqft accessory structure with 24-ft peak height (5-0)
- Approved reading of notice (5-0)
- Approved agenda (5-0)
- Approved minutes of Feb 4, 2021 (5-0)
- Approved minutes of Feb 18, 2021 (5-0)
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by John McCarthy, to approve the Variance request with the following conditions and findings for Rod Kunkel. The property is located in Section 27 of Forest…
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Thu Mar 4, 2021 · 18:00
Planning Commission
Planning Commission to review land use permits and plat waivers
The Planning Commission is considering several conditional use permits for businesses and temporary equipment placement. The body will also review four applications for waivers of plat to create new building parcels using Transfer Development Rights.
- CUP for dock & lift business at 15462 Shieldsville Blvd
- CUP for agricultural tourism at 3175 122nd St W
- CUP renewal for demolition landfill at 8784 240th St W
- Temporary equipment permits for aggregate screening at 10355 Morristown Township Blvd and an asphalt plant at 4995 Millersburg Blvd W
- Four Waiver of Plat requests to create building parcels in Richland, Webster, Cannon City, and Shieldsville Townships
zoningland-usepermitsagriculturalbusiness
✓ Decided: Planning Commission recommends approval of 9 permits, waivers, and a landfill expansion
The Rice County Planning Commission voted unanimously to recommend approval of all nine items on the agenda, including conditional use permits for a dock and lift business, an agricultural tourism business, a demolition landfill expansion, a temporary asphalt plant, and several waivers of plat for new building parcels. Each approval includes specific conditions, such as screening requirements, event limits, parking restrictions, and financial sureties. The recommendations will be forwarded to the County Board for final decisions.
- Approved a conditional use permit for Dale Drentlaw's dock and lift business in Wells Township, with conditions including screening of outdoor storage.
- Approved a conditional use permit for Ross Morrison's agricultural tourism business in Forest Township, with limits on events, attendees, and vehicles.
- Approved a conditional use permit for Timm Trucking Inc. to expand a demolition landfill in Morristown Township, with conditions including a $100,000 surety and operational hours.
- Approved a conditional use permit for Froehlich Construction to operate a temporary aggregate pit in Forest Township, with conditions including dust control and road signage.
- Approved a temporary equipment placement permit for Crane Creek Asphalt to operate a temporary asphalt plant in Forest Township, with a $50,000 bond requirement.
- Approved a waiver of plat for Ryan Blumhoefer (Gary Reuvers) in Richland Township to create a 2.5-acre building parcel, with conditions including a $500 park fee.
- Approved a waiver of plat for Brett Marschall (Pat Malay) in Webster Township to create a 2.5-acre building parcel, with conditions including a $500 park fee.
- Approved a waiver of plat for Paul Thielbar in Shieldsville Township to create a 1.8-acre building parcel, with conditions including a $500 park fee.
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Jill Ellingson, seconded by Charlie Peters, to recommend approval for the Conditional Use Permit request with the following conditions and findings for Ross Morrison. The property is…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Feb 23, 2021 · 08:30
Board of Commissioners
Board considers road funding applications and zoning changes
The Rice County Board of Commissioners is meeting to review several Local Road Improvement Program (LRIP) applications and zoning requests. The body will also discuss landfill equipment and liquor permits.
- Zoning map amendment to rezone property from Urban Reserve to Agricultural in Section 31, Webster Township
- Seven resolutions supporting LRIP applications for various townships and CSAH projects
- Award of Contract # 2172 for bridge replacements on CR No. 80
- 1-day temporary on-sale liquor license for St Patrick Church Shieldsville on March 20, 2021
- Resolution #21-017 regarding the Rice County Emergency Election Plan
zoningroadsliquor-licensesbridgeselections
✓ Decided: County approves $1.13M road contract, equipment purchases
The Rice County Board approved a $1,131,592.90 contract for road work, a $299,999 loader purchase, and several permits and resolutions. They also tabled a zoning map amendment for the Kes property until March 9, 2021. All votes were unanimous.
- Approved $1,131,592.90 road contract to Structural Specialties, Inc. (5-0)
- Approved $299,999 John Deere loader purchase from RDO Equipment Co. (5-0)
- Tabled zoning map amendment for Timothy & Kimberly Kes until March 9, 2021 (5-0)
- Approved temporary equipment placement permits for Corey Kielmeyer in Walcott and Webster Townships (5-0)
- Approved waiver of plat for Steven Koziolek in Northfield Township (5-0)
- Adopted resolutions supporting LRIP applications for Webster, Wells, Bridgewater, Wheatland Townships, CSAH 76, CSAH 48, and SP 6603-029 (5-0)
- Approved 1-day liquor license and consumption permit for St. Patrick Church Shieldsville (5-0)
- Approved consent agenda including $1,157,807.10 in bills and personnel appointments (5-0)
🗳️ How they voted (26 roll-call votes)
Named votes as recorded in the official record.
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the minutes of February 9, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve minutes from Rice County Special Board Meeting February 9, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to table discussion regarding Zoning Map Amendment to Rezone property from Urban Reserve to Agricultural for Timothy & Kimberly Kes until the March…
5 yea
Galen Malecha yea · Dave Miller yea · Tim Purfeerst yea · Steve Underdahl yea · Jeff Docken yea
Motion by Jim Purfeerst, seconded by Steve Underdahl, to approve the Temporary Equipment Placement Permit request with the conditions and findings recommended by the Planning Commission for Corey…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the Temporary Equipment Placement Permit request with the conditions and findings recommended by the Planning Commission for Corey…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Waiver of Plat request with the conditions and findings recommended by the Planning Commission for Steven Koziolek. The property is…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the purchase of a John Deere 844L 4WD Loader from RDO Equipment Co in the amount of $299,999.00 after trade in of the existing 2014 Volvo…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to move into the meeting of the Rice County Drainage Authority. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve the Highway Department bridge replacement on County Ditch #12. RESULT: Approved
4 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea
Motion by Galen Malecha, seconded by Dave Miller, to move out of the meeting of the Rice County Drainage Authority. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adopt Resolution #21-010-Supporting LRIP application-Webster Township. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-011 Supporting LRIP application-Wells Township. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Galen Malecha, to adopt Resolution #21-012 Supporting LRIP application-Bridgewater Township. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adopt Resolution #21-013 Supporting LRIP application-Wheatland Township. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to adopt Resolution #21-014 Supporting LRIP application-CSAH 76 Reconstruction. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-015 Supporting LRIP application-CSAH 48 Reconditioning. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adopt Resolution #21-016 Supporting LRIP application-SP 6603-029. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, To award contract # 2172, contingent upon the review and approval of the Mn-DOT civil rights office, to Structural Specialties, Inc., the low…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the Application & Permit for a 1 Day Temporary On-Sale Liquor License for St Patrick Church Shieldsville, 7525 Dodd Road, Faribault, MN…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Thu Feb 18, 2021 · 18:30
Board of Commissioners
Board of Adjustment to consider lake setback variance in Wells Township
The Rice County Board of Adjustment is meeting to review a variance request for a property on Roberds Lake. The board will determine if the applicant may deviate from standard setback and vegetation rules.
- Variance request for Barbara Mitchell (PID#: 10.21.2.26.006) to build a house 90-ft from Roberds Lake instead of the 120-ft limitation
- Request to remove lakeshore vegetation and grade the top 7-ft of elevation within the shore impact zone of Roberds Lake
zoningvariancesshorelandwells-township
✓ Decided: Board denies lakeshore grading variance for Mitchell property
The Rice County Board of Adjustment denied Barbara Mitchell's variance request to grade within the shore impact zone of Roberds Lake, while approving the meeting agenda and notice reading. The board also discussed but did not vote on a separate 30-ft setback variance for a new house, which remains pending.
- Denied variance for Barbara Mitchell to grade in Shore Impact Zone (3-0)
- Approved reading of notice (3-0)
- Approved agenda (3-0)
Tue Feb 16, 2021 · 08:30
Committee of the Whole
Rice County Committee of the Whole to review financial and health reports
The committee will review financial reports and the annual ditch inspector's report. The meeting includes updates on COVID-19 and highway transportation.
- Annual Ditch Inspector's Report
- Cash & Pooled Investments report for period ending December 31, 2020
- Quarterly Financial Report for period ending December 31, 2020
- COVID-19 Update
- Highway Transportation Update
financepublic-healthhighwaysinfrastructure
✓ Decided: Committee of the Whole discusses finance, COVID-19, highway updates
The Rice County Committee of the Whole met on February 16, 2021, and discussed several items, including the annual ditch inspector's report, cash and pooled investments, the quarterly financial report, a COVID-19 update, and a highway transportation update. No formal decisions were made; the meeting was adjourned with a motion that was approved with no recorded votes.
- Adjourned the meeting (motion by Dave Miller, seconded by Galen Malecha, approved with no recorded votes)
Tue Feb 9, 2021 · 08:00
Committee of the Whole
✓ Decided: County board holds closed session on litigation strategy
The Rice County Committee of the Whole met and, after the call to order and pledge, moved into a closed session to discuss litigation strategy under Minn. Stat. §13D.05 Subd. 3(b). The board approved motions to enter and exit the closed session, then adjourned. No substantive public decisions were made.
- Approved motion to enter closed session for litigation strategy (no recorded vote)
- Approved motion to exit closed session (no recorded vote)
- Approved motion to adjourn meeting (no recorded vote)
320 Third Street NW, Faribault
Tue Feb 9, 2021 · 08:30
Housing & Redevelopment Authority
✓ Decided: HRA approves Project Based Vouchers award
The Rice County Housing & Redevelopment Authority approved the award of Project Based Vouchers. The motion was made by Galen Malecha and seconded by Dave Miller, and the result was recorded as approved with no votes listed. The meeting was brief and adjourned shortly after.
- Approved Award of Project Based Vouchers (motion by Malecha, second by Miller)
320 NW 3rd St, Faribault
Tue Feb 9, 2021 · 09:00
Committee of the Whole
Committee of the Whole to discuss Law Enforcement Jail Study
The Committee of the Whole will meet to discuss a Law Enforcement Jail Study presented by the Facilities Department. The meeting includes a period for public comments.
- Law Enforcement Jail Study discussion
law-enforcementjailfacilities
✓ Decided: County board discusses jail study options with Steele County
The Rice County Committee of the Whole met on February 9, 2021, and discussed a law enforcement jail study. The board decided to discuss options with Steele County before moving forward. No formal decisions were made, and the meeting was adjourned.
- Discussed jail study options with Steele County (no vote)
- Adjourned meeting (approved, no recorded votes)
Thu Feb 4, 2021 · 18:30
Board of Adjustment
✓ Decided: Board approves four variances for sheds, homes, and grading
The Rice County Board of Adjustment approved all four variance requests on the agenda, including a shed setback variance in Walcott Township, a water-oriented shed variance in Wells Township, a bluff setback and grading variance in Forest Township, and an impervious surface variance in Forest Township. All approvals were unanimous except for the Trnka variance, which passed 3-1 with John McCarthy voting no.
- Approved Hager variance for 15-ft rear and side yard setbacks for a 60x80-ft shed (4-0)
- Approved Benson variance for an 8x16-ft water-oriented shed 42-ft from French Lake (4-0)
- Approved Haeckel & Campbell variance for bluff setback and grading for a new home (4-0)
- Approved Trnka variance for 5% impervious surface coverage increase (3-1)
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Charlie Peters, seconded by Preston Bauer, to approve the minutes of January 7, 2021. RESULT: Approved
4 yea
Michael Streiff yea · Charlie Peters yea · Preston Bauer yea · Jill Ellingson yea
Tue Jan 26, 2021 · 08:30
Board of Commissioners
✓ Decided: County board approves agritourism zoning, road pact, and $1.32M in bills
The Rice County Board of Commissioners approved all agenda items unanimously, including a zoning amendment allowing agricultural tourism as a conditional use in shoreland districts, a 2021-2022 road maintenance agreement with Northfield, and a bridge priority list. They also approved two waiver of plat requests, a child care licensing variance policy, a nursing services agreement, liquor license fee waivers, property purchases, and a consent agenda with $1,324,278.30 in bills and personnel appointments.
- Adopted Resolution #21-003 adding agricultural tourism as conditional use in GDS, RDS, NES shoreland districts (5-0)
- Approved waiver of plat for Tonya & Eddie Gillen, Webster Township (5-0)
- Approved waiver of plat for Brian Burkart/Linda Kopisca, Warsaw Township (5-0)
- Approved Social Services Child Care Licensing Variance Policy (5-0)
- Approved agreement with Gail Hoxie Setterstrom for RN services (5-0)
- Approved Resolution #21-006 waiving liquor license fees for 2021 (5-0)
- Approved 2021-2022 County Road Maintenance Agreement with City of Northfield (5-0)
- Approved Resolution #21-005 Bridge Priority List (5-0)
🗳️ How they voted (19 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the minutes of January 12, 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to adoption Resolution #21-003 - Resolution Amending Rice County Ordinance to Add Agricultural Tourism Business as a Conditional Use Within the GDS…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Galen Malecha, to approve the Waiver of Plat request with the conditions and findings recommended by the Planning Commission for Tonya & Eddie Gillen. The…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, to approve the Waiver of Plat request with the conditions and findings recommended by the Planning Commission for Brian Burkart, on behalf of…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approve Social Services Child Care Licensing Variance Policy. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to move into Community Health Board. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approve the appointment of Debra Purfeerst, Rice County CHS Administrator as Agent of the Board. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to move out of Community Health Board. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, Approve agreement between Rice County Public Health and Gail Hoxie Setterstrom for professional registered nursing services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve payment for MNCCC for 2021 services. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to approve Resolution #21-006/Waive Liquor License Fees for 2021. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, Ratify Purchase Agreement and Approve the purchase on 2nd Avenue NW RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, Ratify Purchase Agreement RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, Approval of the 2021- 2022 County Road Maintenance Agreement with the City of Northfield RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, Approval of Resolution #21-005 Bridge Priority List . RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to approve the consent agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jeff Docken, to approve negotiated litigation settlement. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Tue Jan 26, 2021 · 08:30
Housing & Redevelopment Authority
✓ Decided: HRA approves prior meeting minutes, hears quarterly report
The Rice County Housing & Redevelopment Authority met and approved the minutes from four prior meetings (July 21, 2020, August 25, 2020, December 8, 2020, and January 12, 2021) by motion. No other substantive decisions were made; the board received a quarterly and year-end report and adjourned. The minutes record no vote tallies for the approval, listing AYES: None, NAYS: None.
- Approved minutes of July 21, 2020, August 25, 2020, December 8, 2020, and January 12, 2021 (motion by Malecha, seconded by Underdahl)
320 NW 3rd St, Faribault
Tue Jan 19, 2021 · 08:30
Committee of the Whole
✓ Decided: Committee of the Whole discusses child care licensing and COVID-19
The Rice County Committee of the Whole met on January 19, 2021, for a work session. They discussed a child care licensing variance policy and received a COVID-19 update. No formal decisions were made; the only action was to adjourn the meeting.
- Adjourned meeting (motion by Dave Miller, seconded by Jeff Docken, approved)
Tue Jan 12, 2021 · 08:30
Housing & Redevelopment Authority
✓ Decided: HRA approves 2021 officers and 5-year plan
The Rice County Housing & Redevelopment Authority approved the election of officers for 2021 and approved its 5-year plan. Both motions passed unanimously with all five present members voting in favor; Commissioner Tjosaas was absent. No public comments were made on the 5-year plan.
- Approved election of HRA officers for 2021 (5-0)
- Approved the 5-year plan (5-0)
320 NW 3rd St, Faribault
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Motion by Galen Malecha, seconded by Dave Miller, to approve the Election of the HRA Officers for 2021. RESULT: Approved
5 yea
Jeff Docken yea · Galen Malecha yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Galen Malecha, to approve the 5 year plan. No comments were made by the public. RESULT: Approved
5 yea
Jeff Docken yea · Galen Malecha yea · Dave Miller yea · Steve Underdahl yea · Jim Purfeerst yea
Thu Jan 7, 2021 · 18:30
Board of Adjustment
Board to hear four variance requests, including lake setback and bluff cases
The Rice County Board of Adjustment will hold a remote meeting to elect officers, set the 2021 schedule, and hear four variance applications. Each request involves a property owner seeking relief from county zoning rules, such as setbacks and slope limits. The board will take public comment and vote to approve, deny, or continue each item.
- Variance for 25-ft bluff setback reduction for new home at 9368 Dodd Rd, Kilkenny (Shieldsville Twp)
- Variance for driveway on slope exceeding 18% in Webster Twp
- Variance for 15-ft rear yard setback reduction for shed at 4507 250th St E, Faribault (Walcott Twp)
- Variance for 30-ft Roberds Lake setback reduction and vegetation/grading in shore impact zone (Wells Twp)
- Election of 2021 chair, vice chair, and secretary
zoningvarianceshorelandsetbackagriculturalpublic-hearing
320 3rd Street NW, Faribault
Thu Jan 7, 2021 · 18:30
Planning Commission
Planning Commission to weigh ag tourism zoning, three property requests
The Rice County Planning Commission will hold a public hearing on a proposed zoning ordinance amendment to allow agricultural tourism businesses as conditional uses in certain shoreland districts. The commission will also consider three property requests: a rezoning in Webster Township, and two waiver of plat applications in Webster and Warsaw Townships. The meeting will be conducted electronically due to the COVID-19 pandemic.
- Public hearing on Resolution #21-003 to add 'Agricultural Tourism Business' as conditional use in GDS, RDS, NES Shoreland Districts
- Rezone request by Timothy & Kimberly Kes: three parcels from Urban Reserve to Agricultural, Section 31, Webster Township (PIDs 02.31.2.00.002, 02.31.2.75.001, 02.31.2.75.002)
- Waiver of Plat by Tonya & Eddie Gillen: create 2.5-acre parcel via TDR, Section 21, Webster Township (PID 02.21.2.50.002)
- Waiver of Plat by Brian Burkart for Linda Kopisca: create 1.7-acre and 21-acre parcels, 21750 Morristown Blvd, Faribault (PID 14.03.3.50.003)
- Election of 2021 Planning Commission Chair, Vice Chair, and Secretary
zoningpublic-hearingagricultureshorelandwaiver-of-platrezoning
320 3rd Street NW, Faribault
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by John McCarthy, seconded by Jill Ellingson, to approve the withdrawal of the Zoning Map Amendment for Timothy & Kimberly Kes. The properties are located in Section 31 of Webster Township…
4 yea
Preston Bauer yea · Charlie Peters yea · Michael Streiff yea · Jill Ellingson yea
Tue Jan 5, 2021 · 08:30
Board of Commissioners
Rice County Board sets 2021 officers, contracts, and banking authority
The Rice County Board of Commissioners is holding its first regular meeting of 2021, with organizational items including election of chair and vice chair, committee appointments, and setting meeting dates. The board will also act on a social services contract, a resolution granting the chief financial officer annual banking authority, incidental fund appropriations, and appointments to the Planning Commission.
- Election of 2021 Chairperson and Vice Chairperson
- Social Services contract with South Central Community Based Initiative
- Resolution #21-004 granting annual banking authority to Chief Financial Officer
- Resolution #21-001 designating official newspaper for public notices
- Appointment to Planning Commission/Board of Adjustment
board-of-commissionersappointmentscontractsfinancepublic-notices
🗳️ How they voted (15 roll-call votes)
Named votes as recorded in the official record.
Motion by Jeff Docken, seconded by Jim Purfeerst, to approve the agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Jeff Docken, to approve the minutes of December 22, 2020. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Steve Underdahl, to cast a unanimous vote to appoint Jeff Docken as the 2021 Chairperson for the Rice County Board of Commissioners. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to cast a unanimous vote to appoint Jim Purfeerst as the 2021 Vice Chairperson for the Rice County Board of Commissioners. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to appoint the 2021 Rice County Commissioner Committee Appointments as presented: RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to set all the Committee of the Whole Work Sessions for the first and third Tuesday of each month; Regular Board of Commissioner Meetings on the…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, Approve Social Services Department Contract with South Central Community Based Initiative RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Jim Purfeerst, Be it Resolved of the Rice County Board of Commissioners approve the hiring of two full time and 1 half time custodian and to also promote Rice…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Steve Underdahl, seconded by Dave Miller, to adopt Resolution #21-004 - Granting Annual Authority to the Chief Financial Officer to Designate Depositories & Authorize others to Conduct…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to approve the Incidental Fund Appropriations up to the following: Postage & Communications - $120,000; Utilities - $300,000; Attorney Contingency…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to approve the consent agenda as presented. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Jim Purfeerst, seconded by Dave Miller, to adopt Resolution # 21-001- Official Newspaper for the publication of Official Proceedings in Summary Form & Public Notices. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Dave Miller, seconded by Steve Underdahl, to adopt Resolution #21-002 Designating Rice County Website as the 2021 Official Publication for Transportation Projects. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Dave Miller, to appoint John McCarthy to both the Rice County Planning Commission & Board of Adjustment for the remainder of the 2019-2021 term formerly served by…
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea
Motion by Galen Malecha, seconded by Jim Purfeerst, to adjourn the meeting. RESULT: Approved
5 yea
Jeff Docken yea · Dave Miller yea · Steve Underdahl yea · Galen Malecha yea · Jim Purfeerst yea