The Boring PartsFederalLocal · USLocal · Canada
Maui County, HI

Maui County public meetings in 2024

210 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Mon Dec 23, 2024 · 9:00 AM

Council of the County of Maui

Council to vote on $14M Kula land purchase and housing policy changes

The Maui County Council will consider resolutions and ordinances including a $14 million land acquisition in Kula, a flavored tobacco ban, a climate action plan, and referrals for housing and zoning changes. First readings include bills on bilingual government, private water catchment, and after-hours Kapalua Airport operations.

councilbudgethousingland-useclimatetobaccowaterpublic-safety
Thu Dec 19, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee to receive updates on Waiale Road and Kihei North-South Collector road projects

The Water and Infrastructure Committee will receive presentations and updates regarding two road projects. No legislative action will be taken during this meeting.

roadsinfrastructurepublic-works
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Dec 18, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Housing and Land Use Committee meeting canceled

The December 18, 2024 meeting of the Maui County Housing and Land Use Committee has been canceled. The agenda included a presentation from ʻĀina Hoʻopulapula on assisting Department of Hawaiian Home Lands beneficiaries, but no legislative action was planned.

meeting-cancelledhousingland-usecounty-councilhawaiian-home-landsmaui-county
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Dec 18, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to discuss urging state task force for missing persons

The Disaster, Resilience, International Affairs, and Planning Committee will discuss Resolution 23-189, which urges the State of Hawai'i to create a task force to address missing persons. No legislative action is scheduled.

missing-personsresolutiontask-forcecommittee-meetingresilience
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Dec 17, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to discuss wildfire recovery grants, Bill 184, and more

The Budget, Finance, and Economic Development Committee will discuss Bill 184, which would exempt Homeowner Programs Revolving Fund grants from certain county code provisions. They will also discuss wildfire recovery grants and reimbursements, including work by contractor Tetra Tech, Inc. Other topics include the Kula Agricultural Park Phase I Expansion and an employee retention contract with Brandcrafters LLC. No legislative action will be taken at this meeting.

budgetfinanceeconomic-developmentwildfire-recoverygrantsagricultureemployee-recruitment
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Dec 13, 2024 · 9:00 AM

Council of the County of Maui

Council discusses zoning amendments for Kīhei-Mākena Project District 9

The Council is considering first readings of bills to amend the zoning and ordinances for the approximately 670-acre Kīhei-Mākena Project District 9. Additionally, several ordinances regarding fiscal year 2025 budget amendments are scheduled for second and final reading.

zoningbudgetpoliceenvironmentwater
Fri Dec 6, 2024 · 9:00 AM

Council of the County of Maui

Council to consider $14.1M purchase of Von Tempsky Kula property

The Maui County Council will vote on several bills and resolutions at its December 6 meeting. Key items include first-reading approval of a $14.1 million bond-funded acquisition of the 273-acre Von Tempsky Kula property for conservation, a bill to create a Climate Action and Resiliency Plan, and a ban on flavored tobacco products. The council will also consider settlements in two police lawsuits and referrals of bills on agricultural tourism and mobile food trucks on farms.

budgetland-acquisitionclimatetobacco-banpolice-settlementsagriculturefood-trucksplanning
Thu Dec 5, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to hear presentation on Kula fire recovery and fuel management

The Agriculture, Diversification, Environment, and Public Transportation Committee will receive a presentation from Kyle Ellison of Mālama Kula on ongoing fire recovery efforts in Kula, Maui, and discuss resilient landscapes and sustainable fuel management. No legislative action will be taken; the item is informational only.

fire-recoverykulafuel-managementresilient-landscapesagricultureenvironment
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Dec 5, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee will consider Bill 146 to revise how domestic water demand is calculated.

The Water and Infrastructure Committee will discuss whether to recommend Bill 146, which would require the Department of Water Supply to use projected gallons‑per‑day usage rather than fixture counts in calculating domestic water demand and set a new effective date of July 1 2025. The committee will also consider Bill 180, which would permit private water catchment systems of up to 30,000 gallons in agricultural, rural, and residential districts and create a new code section. Both bills may be recommended for first reading with or without the proposed amendments.

water-codedomestic-water-demandprivate-water-catchmentinfrastructureordinancecommittee
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Dec 4, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to consider resolution urging West Maui Community Plan update after wildfires

The Disaster, Resilience, International Affairs, and Planning Committee will consider three resolutions, including urging updates to the West Maui Community Plan after the August 2023 wildfires and supporting a new West Maui hospital through state bond guarantees. The committee may recommend these resolutions be referred to the Council Chair for the term beginning January 2, 2025. It will also discuss amending the County Fire Code but will not take legislative action.

disasterresilienceplanningfire-codeelectric-vehicleswest-mauihospitalcommunity-plan
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Dec 4, 2024 · 9:00 AM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee to discuss bilingual government ordinance

The Efficiency Solutions and Circular Systems Committee will consider a bill to implement a 2022 charter amendment requiring the County to operate as a bilingual government. The body will also review a bill authorizing an intergovernmental agreement with the University of Hawai‘i for employee workshops.

bilingualhawaiian-languagecouncilordinancecharteruniversityworkshopscultural-resources
Online via Zoom: http://tinyurl.com/ESCS-Committee Remote oral testimony is also available online via the same Zoom link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Dec 3, 2024 · 1:30 PM

Housing and Land Use Committee (2023-2025)

Committee to consider amending Wailea 670 project district, removing golf course and 450 affordable units

The Housing and Land Use Committee is considering Bills 171 and 172, which would amend the Kīhei-Mākena Project District 9 (Wailea 670) ordinance. The bills eliminate references to a golf course and 450 affordable units, add cultural and educational centers as permitted uses, and update the land use map with the Phase II site plan. The committee may recommend passage on first reading or file the bills.

zoninghousingland-usekihei-makenawailea-670affordable-housinggolf-coursecultural-centers
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Dec 3, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee will consider a $1.5 million budget increase for 60 South Church St. renovations.

The Budget, Finance, and Economic Development Committee will review several pending ordinances. It may recommend Bill 93 on emergency monetary donations, Bill 128 on the managed retreat revolving fund, and Bill 170 which proposes a $1.5 million increase to the FY2025 budget for renovations at 60 South Church Street. The committee will also receive comments on the Wildfire Permanent Disposal Site and Bills 174‑176, but no legislative action will be taken on those items.

budgetfinanceemergency-donationsretreat-fundbuilding-renovationwildfireordinances
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Dec 3, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

December 3 Government Relations, Ethics, and Transparency Committee meeting canceled

The meeting scheduled for December 3, 2024, was canceled. The agenda had included the consideration of two settlement authorizations for employment discrimination and retaliation claims against the Maui County Police Department.

litigationsettlementspoliceemployment-discrimination
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Dec 2, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee to consider bill on encampment property removal and right to shelter

The Water Authority, Social Services, and Parks Committee will consider recommending passage of Bill 111 (2024), which establishes procedures for removing personal property from encampments and a right to shelter. The committee may also recommend several other bills: creating a feral animal management fund, expanding the volunteer parking enforcement program, requiring certain businesses to maintain naloxone, and authorizing a community recreational gardens program. All bills may be recommended for referral to the Council Chair for the term beginning January 2, 2025.

homelessnessencampmentspublic-safetyferal-animalsparking-enforcementnaloxonecommunity-gardenssocial-services
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Dec 2, 2024 · 1:30 PM

Housing and Land Use Committee (2023-2025)

Committee to consider recommending multiple housing bills for council referral

The Housing and Land Use Committee will review a series of housing‑related bills and may recommend them for referral to the full council for the term beginning Jan 2 2025. Items include amendments to deed‑restriction periods for workforce housing, the affordable housing fund, zoning changes in Lanai Project District 2, residential density standards, and definitions for kitchenettes and parking requirements. The committee will also address any procedural matters related to the referrals.

housingland-usezoningworkforce-housingaffordable-housinglanai
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Dec 2, 2024 · 1:45 PM

Housing and Land Use Committee (2023-2025)

Committee to decide on removing golf course, affordable units from Wailea 670

The Housing and Land Use Committee will consider two bills that would amend the Kīhei-Mākena Project District 9 (Wailea 670) ordinance. Bill 171 would eliminate references to a golf course and 450 affordable units, add cultural and educational centers, and adopt a new site plan. Bill 172 would amend conditions of zoning. The committee may recommend passage on first reading or file the bills.

housingland-usezoningwaileakihei-makenaproject-districtaffordable-housingcultural-centers
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Nov 25, 2024 · 10:00 AM

Housing and Land Use Committee (2023-2025)

Committee to consider removing golf course and affordable housing from Wailea 670 project

The Housing and Land Use Committee will consider Bills 171 and 172, which amend the Kīhei-Mākena Project District 9 (Wailea 670) ordinance. The bills eliminate references to the golf course and 450 affordable housing units, add cultural and educational centers as permitted uses, and update the land use map. The committee may recommend passage on first reading or file the bills.

housingland-usezoningwaileaaffordable-housinggolf-coursecultural-centersmaui-county
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Nov 21, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to consider $14.1 million bond for Von Tempsky Kula land acquisition

The Budget, Finance, and Economic Development Committee will consider recommending first‑reading passage of Bill 166 and Bill 167, which amend the FY 2025 budget to add $14.1 million for the Von Tempsky Kula Property Acquisition and up to $100,000 for watershed work at Haleakala Waldorf School. The bills also adjust bond authorizations and estimated revenues. The committee will also review Bill 69, which would let the Director of Finance acquire easements without Council approval when the mayor and a grant require it. No decisions have been made at the time of the agenda.

budgetbondsland-acquisitionwatershedconservation-easementsfinance
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Thu Nov 21, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to consider referring agricultural tourism bill to planning commissions

The committee will consider recommending adoption of Resolution 24-172, which would refer a proposed bill to establish agricultural tourism as an accessory use in the County Agricultural District. It will also consider Resolution 24-171, which would refer a bill to allow mobile food trucks or trailers up to 1,000 square feet as permitted accessory uses on farms. Both bills would be sent to the Lāna‘i, Maui, and Molokai Planning Commissions. The committee may adopt with revisions or file the resolutions.

agriculturezoningtourismfood-trucksplanning-commissioncommittee
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Wed Nov 20, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee to consider Bill 104 amending kitchenette, kitchen, and wet bar definitions

The Housing and Land Use Committee will review Bill 104 (2024), which proposes changes to the Maui County zoning code to add a definition for kitchenettes, update definitions of kitchens and wet bars, and add parking requirements for dwelling units with kitchenettes. The committee may recommend the bill’s first reading, with or without the Chair’s revisions that remove long‑term occupancy and parking mandates from the definition and place them in other code sections. Supporting documents include a planning department report and an amendment summary form.

zoninghousingcode-amendmentplanningcommittee
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Wed Nov 20, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee discusses West Maui Hospital and zoning changes

The Disaster, Resilience, International Affairs, and Planning Committee will discuss the establishment of a proposed West Maui Hospital and Medical Center through special purpose revenue bonds, as well as a proposed conditional zoning change for 304 acres in Pulelehua. No legislative action is scheduled.

hospitalzoningwest-mauirevenue-bondsresilienceplanningpublic-hearing
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Tue Nov 19, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Council committee to consider Army Corps technical services agreement

The Water and Infrastructure Committee will consider whether to recommend passage of two bills on first reading. Bill 135 would authorize the mayor to enter into an intergovernmental agreement with the U.S. Army Corps of Engineers for technical services. Bill 157 would amend the Maui County Code to establish new regulations on stormwater discharge and pollution controls.

waterinfrastructurestormwaterarmy-corpsordinancemaui-county
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Tue Nov 19, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee discusses Independent Nomination Board and pending legislative items

The Government Relations, Ethics, and Transparency Committee will discuss the procedures and responsibilities of the Independent Nomination Board. The committee may also recommend several bills and resolutions be referred to the Council Chair for the term beginning January 2, 2025.

ethicstransparencygovernment-relationswildfirescounty-chartergrants
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Mon Nov 18, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee considers ban on flavored tobacco products

The Water Authority, Social Services, and Parks Committee will consider whether to recommend passage of Bill 156 (2024) on first reading. The bill would prohibit retailers from selling or marketing flavored tobacco products, including menthol and cooling agents, and from mislabeling products as nicotine-free. The committee may also file the bill or take other related action. The rest of the agenda consists of procedural and administrative items.

tobaccoflavored-tobaccopublic-healthordinancemaui-county
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Mon Nov 18, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee considers bill to establish Maui County Climate Action and Resiliency Plan

The Efficiency Solutions and Circular Systems Committee will consider whether to recommend the passage of Bill 136 (2024) on first reading. This bill proposes amending Title 20 of the Maui County Code to create a plan for climate change mitigation, adaptation, and a transition to 100 percent renewable energy.

climate-actionrenewable-energyenvironmentcounty-code
Online via Zoom: http://tinyurl.com/ESCS-Committee Remote oral testimony is also available online via the same Zoom link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Fri Nov 15, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council to consider wildfire tax relief and taxi fare changes

The Council is reviewing several budget amendments and ordinances, including extensions for August 2023 wildfire real property tax relief. The body will also discuss updates to taxicab rates and affordable housing projects on Lanai and Maui.

taxeswildfire-recoverytransportationaffordable-housingbudget
Wed Oct 30, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to discuss West Maui Hospital and Pulelehua zoning

The Committee will hold discussions regarding the establishment and financing of the proposed West Maui Hospital and Medical Center. It will also discuss a proposed zoning change for the Pulelehua project. No legislative action will be taken on these items.

healthcarezoningwest-mauipulelehuaplanning
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: DPS Conference Room, 6th Floor, Kalana O Maui Building, 200 South High St., Wailuku, Maui, HI
Tue Oct 29, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers real property tax relief for August 2023 wildfire victims

The Budget, Finance, and Economic Development Committee will discuss three bills regarding real property tax exemptions. Two bills focus on extending tax relief and exemptions for properties impacted by the August 2023 wildfires, while a third proposes increasing a tax exemption for child care facilities.

taxeswildfireschild-caretax-exemptions
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Fri Oct 25, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council to consider multiple FY 2025 budget amendments

The Council will discuss several bills to amend the Fiscal Year 2025 budget and update the County Charter. The body is also reviewing water code changes and appointments to county authorities and agencies.

budgetzoningwater-managementhealthcaretaxes
Thu Oct 24, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee to consider bill on personal property removal and right to shelter

The Water Authority, Social Services, and Parks Committee will consider Bill 111 (2024). This bill proposes procedures for the removal and storage of personal property in public places and establishes a right to shelter.

homelessnesspublic-propertyshelterordinance
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Thu Oct 24, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to consider pesticide and fertilizer use on County property

The Agriculture, Diversification, Environment, and Public Transportation Committee will discuss Bill 131 (2024). This bill proposes amending the Maui County Code to allow the use of pesticides and fertilizers at the Waiehu Municipal Golf Course and County parks with grass playing surfaces.

agricultureenvironmentpesticidesparks
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Wed Oct 23, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee to consider ordinance on disaster-damaged nonconforming structures

The Maui County Housing and Land Use Committee will consider Bill 105 (2024), which amends county code regarding nonconforming structures damaged by emergencies. The committee may also discuss options for addressing the county's housing inventory without taking legislative action.

housingzoningordinancedisastervacation-rentalspublic-hearing
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Tue Oct 22, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Council to consider appointing Michael McMenemy to Maui Redevelopment Agency

The Government Relations, Ethics, and Transparency Committee will review Resolution 24-163 to appoint Michael Claud McMenemy as a member of the Maui Redevelopment Agency, with a term ending March 31, 2029. It will also consider Resolution 24-58 to reappoint Moana M. Lutey as County Clerk and Richelle M. Thomson as Deputy County Clerk for a six‑year term. The committee will receive an update from the Office of Recovery on the County’s Long‑Term Recovery Plan following the August 2023 wildfires. No legislative action is required for the recovery update.

appointmentredevelopmentclerkrecoverygovernance
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Tue Oct 22, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Taxicab fare ordinance proposes higher rates and new fees

The Budget, Finance, and Economic Development Committee will consider recommending first‑reading passage of Bill 141, which would increase taxicab driver rates, add a $10 charge for certain items, a $5 airport pick‑up fee, a $20 flat rate for trips of three miles or less, and a 20% discount for shared rides. The committee will also review Bill 138, amending the FY 2025 budget to add a $55,285 appropriation for the Alexander Academy program. Additional items include Bill 140 to authorize an intergovernmental agreement with Air Force units for fire and emergency services, and a discussion of Contract C7619 with Johnson Controls and Equipment Lease Agreement 1474 with Bank of Hawaii.

taxicab-faresbudgetintergovernmental-agreementenergy-contractfire-emergency-services
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Mon Oct 21, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to consider Bill 142, changing fire‑code notice procedures

The Disaster, Resilience, International Affairs, and Planning Committee will review Bill 142 (2024), which would amend Chapter 16.04D of the Maui County Code to require the Department of Fire and Public Safety to send fire‑code warning and violation notices to the Mayor, Managing Director, and Council Chair, and to allow the department to require violators to submit a fire‑prevention plan. The committee may recommend passage of the bill on first reading, with or without revisions. The committee will also discuss fire‑prevention matters, including relevant laws, abandoned‑vehicle abatement, sanitary maintenance of structures, and possible legislation to improve the County’s ability to prevent wildfires, though no legislative action is planned on those topics.

fire-codefire-preventionordinanceplanning-committeeemergency-managementwildfire
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Mon Oct 21, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee to consider ordinance allowing water meter reservation extensions

The Water and Infrastructure Committee will consider Bill 130 (2024), which would amend county code to allow the Director of Water Supply to administratively extend water meter reservations in limited circumstances. The committee may recommend passage or file the bill.

waterordinanceinfrastructurecounty-codemeter-reservation
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Fri Oct 11, 2024 · 9:00 AM

Council of the County of Maui

Council to accept 45.4‑acre Hāna landfill parcel and consider wildfire relief bills

The Maui County Council will consider a resolution to accept a 45.415‑acre parcel from the State of Hawaiʻi in Hāna for expansion of the Hāna Landfill. The council will also hear first‑reading bills that would allow property owners leasing to individuals displaced by the August 2023 Maui wildfires to file home or long‑term rental exemption claims by Dec 31 2025, and a bill to exempt legacy festivals from special event permits for more than five consecutive days. Committee reports recommend filing budget amendments for a professional‑services contract to prepare a feasibility study and management plan for the new East Maui Water Authority. Ordinances before the council include an intergovernmental agreement with Air Force units for fire and emergency services and amendments to taxicab and notice‑violation codes.

landfillwastehousingwateremergency-servicesbudgetzoning
Thu Oct 10, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to review draft Maui food and nutrition security plan

The Agriculture, Diversification, Environment, and Public Transportation Committee will receive a presentation on the Department of Agriculture's draft Maui County Food and Nutrition Security Plan. No legislative action is scheduled for this item.

agriculturefood-securitycommittee-meetingpublic-healthmaui-county
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Oct 10, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee considers prioritizing recycled R-1 water to save potable water for housing

The Water and Infrastructure Committee will discuss Resolution 24-161. This resolution urges the administration to expand the production and distribution of recycled R-1 water to preserve potable water for housing construction.

water-infrastructurehousingrecycled-water
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Oct 9, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee discusses draft resolution to update West Maui Community Plan after 2023 wildfires

The Disaster, Resilience, International Affairs, and Planning Committee will discuss a draft resolution urging the Administration to begin updates to the West Maui Community Plan in line with post‑wildfire infrastructure plans. Representatives from the Department of Environmental Management, Department of Planning, Department of Water Supply, and the Office of Recovery may provide comments. No legislative action is scheduled for this agenda item.

disasterplanningresiliencewildfireswest-maui
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Oct 9, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee will discuss options for County-owned housing inventory

The Housing and Land Use Committee will receive presentations from the Department of Housing and the Department of Planning about ways to address Maui County's housing inventory. Topics include developing County‑owned properties for long‑term leaseholds, deed‑restriction programs, and tax‑incentive options. No legislative action is planned for this agenda item.

housingland-useplanningpolicy
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Oct 8, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Bill 137 proposes adding $1.7 million to the FY 2025 water operations budget

The Budget, Finance, and Economic Development Committee will consider Bill 137, which seeks to increase the FY 2025 Department of Water Supply Water Operations Program by $1.7 million through carryover savings. The committee will also review Bill 138, adding $55,285 for the Alexander Academy grant in the mayor’s economic development program. A discussion will be held on the County Auditor’s fiscal impact analysis of charter amendments slated for the 2024 general election, with no legislative action planned on that item.

budgetwater-supplygrantscharter-amendmentsfinance
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Oct 8, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee to vote on charter corrections and police shooting settlement

The Government Relations, Ethics, and Transparency Committee will decide whether to recommend passage of Bill 132 (2023), which authorizes the County Clerk to correct and delete inoperative provisions in the Maui County Charter. The committee will also consider Resolution 24-162, which seeks to approve a settlement in a police shooting lawsuit involving Nathaniel Na Waʻe Waʻe Makala Ka Kai Naki.

charter-amendmentspolice-accountabilitylegal-settlementindigenous-languagegovernment-transparency
Online via Teams: http://tinyurl.com/GREAT-Committee Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Oct 7, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee considers feasibility study for County Department of Grants Management

The Efficiency Solutions and Circular Systems Committee will discuss Resolution 24-155. This resolution proposes authorizing the Council Chair to request proposals for a feasibility study regarding a County Department of Grants Management.

grants-managementgovernment-efficiencyfeasibility-study
Online via Zoom: http://tinyurl.com/ESCS-Committee Remote oral testimony is also available online via the same Zoom link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Oct 7, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee discusses sea‑level rise impacts on county beach parks

The Water Authority, Social Services, and Parks Committee will hear comments on domestic‑violence awareness from local service providers. It will also review the Department of Parks and Recreation’s Beach Parks Vulnerability and Adaptation Study, focusing on sea‑level rise and coastal threats. No legislative action is scheduled for either item.

domestic-violencesea-level-riseparksplanningcommunity-awareness
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Sep 27, 2024 · 9:00 AM

Council of the County of Maui

Council considers budget amendments and industrial rezoning in Lānaʻi City

The Council of the County of Maui is meeting to discuss several Fiscal Year 2025 budget amendments and legal settlements. The body will also consider a climate action plan and a zoning change for an industrial park in Lānaʻi City.

zoningbudgetclimate-actionlegal-settlementsparksinfrastructure
Thu Sep 26, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to discuss pesticide use on County parks and golf course

The Maui County Agriculture, Diversification, Environment, and Public Transportation Committee will receive presentations on sustainable landscape management and consider an ordinance to allow pesticide and fertilizer use on County parks and Waiehu Municipal Golf Course.

pesticidesfertilizergolf-coursesustainabilityenvironmentpublic-transportationcommittee-meeting
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Sep 26, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee to consider accepting 45.4 acres for Hāna landfill expansion

The Water and Infrastructure Committee will review Resolution 24-157, which proposes accepting a 45.415‑acre land set‑aside in Hāna for landfill expansion as directed by Executive Order 4708. The committee may recommend adoption of the resolution, with or without revisions, and consider filing it. The committee will also consider Bill 129 (2024), an ordinance amendment requiring agencies to report civil fines to the Council each quarter.

landfillzoningcivil-finesordinancewater-infrastructure
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Sep 25, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Housing committee to discuss rent stabilization impacts without voting

The Maui County Housing and Land Use Committee will meet online and in Wailuku to discuss rent stabilization, including potential adjustments to real property tax law and its effects on the county. No legislative action is scheduled for this item. The meeting follows procedural rules for remote and in-person participation, including testimony options.

housingrent-stabilizationtax-lawcommittee-meetingprocedural
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Sep 25, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to consider new rules for electric vehicle charging infrastructure

The Committee will discuss and potentially recommend actions on two items regarding electric vehicle (EV) parking and infrastructure. These include a resolution to seek planning commission recommendations and a bill to establish a new county code chapter for EV infrastructure.

electric-vehiclesparkinginfrastructurezoningpublic-accommodation
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Sep 24, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to vote on tax-exemption deadline extension for wildfire-displaced renters

The Budget, Finance, and Economic Development Committee will decide whether to recommend passage of Bill 115 (2024), which extends the deadline for property tax exemption claims by wildfire-displaced renters to May 31, 2025. The committee will also discuss real property tax exemptions and consider amendments to the Fiscal Year 2025 budget for water supply administration and a new East Maui Water Authority feasibility study.

tax-exemptionswildfire-recoverybudget-amendmentswater-supplyfiscal-year-2025
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Sep 24, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers bill to ease property leasing for affordable housing

The Government Relations, Ethics, and Transparency Committee will consider Bill 116 (2024) regarding the Maui County Grants Program and county property leases. The body will also discuss recommendations for boards and commissions from the Cost of Government Commission.

affordable-housingcounty-codegovernment-transparencypublic-property
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Sep 23, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee considers permit exemptions for Maui County legacy festivals

The Committee will consider whether to recommend the passage of Bill 117 (2024) regarding special event permit exemptions. Additionally, the body will receive comments on enhancing county mental health crisis response from representatives of Mental Health First Aid USA, Tompkins County, and the Resiliency and Justice Center.

parksfestivalsmental-healthpublic-safetyordinances
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Sep 16, 2024 · 5:30 PM

Housing and Land Use Committee (2023-2025)

Housing and Land Use Committee meeting recessed to September 25

The meeting scheduled for September 16, 2024, was recessed to September 25, 2024. The original agenda intended to discuss rent stabilization and potential real property tax law adjustments, though no legislative action was planned.

housingrent-stabilizationtaxes
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Sep 16, 2024 · 9:00 AM

Council of the County of Maui

Council considers zoning change for Grace Baptist Church in Lahaina

The Council of the County of Maui is holding a special meeting to conduct a second and final reading of a zoning ordinance. The body will decide on a specific land-use change in Lahaina.

zoninglahainaland-use
Fri Sep 13, 2024 · 9:00 AM

Council of the County of Maui

Council considers $3.5 million water fund budget increase for FY 2025

The Maui County Council will take first‑reading votes on two budget amendments that add $3.5 million each to the Water Fund—one increasing carryover savings and the other boosting operations and equipment funding. The Council will also consider a resolution to retain ES&A, Inc. as special counsel for a legal case, with compensation capped at $50,000. Additional items include several resolutions appointing members to county commissions and a first‑reading zoning change for a 200‑acre industrial park in Lānaʻi.

budgetwater-fundlegalzoningappointments
Thu Sep 12, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee to discuss water monitoring and Olowalu debris site

The Water and Infrastructure Committee will discuss a proposed agreement for water-resource monitoring and receive an update on a temporary debris storage site. No legislative action will be taken during this meeting.

water-monitoringdebris-storageenvironmental-monitoringinfrastructure
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Sep 12, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee to consider bond counsel contract and property damage settlement

The Government Relations, Ethics, and Transparency Committee will discuss the duties of the Independent Nomination Board. The body may also recommend the adoption of resolutions regarding legal counsel for bond issuance and a property damage settlement.

legal-counselbondssettlementsethicsgovernment-transparency
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Sep 10, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers budget amendments and real property tax exemption deadlines

The Budget, Finance, and Economic Development Committee will discuss amendments to the Fiscal Year 2025 budget and a bill regarding property tax exemptions. The body may recommend passage or filing for three separate bills.

budgettaxesparkshousingwildfire-recovery
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Sep 10, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee to consider board appointments and legal settlements

The Government Relations, Ethics, and Transparency Committee will review nominees for several county boards and commissions. The body will also consider the authorization of legal settlements and additional compensation for special counsel.

appointmentslegal-settlementsgovernment-ethicspublic-workspolice
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Sep 9, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee will discuss enhancing Maui County’s mental‑health crisis response.

The Water Authority, Social Services, and Parks Committee’s September 9, 2024 meeting was cancelled. The agenda item slated for discussion was “Enhancing County Mental Health Crisis Response,” which would have allowed public comments and input from mental‑health professionals about peer‑support training and crisis response initiatives. No legislative action was planned for this item.

mental-healthcrisis-responsehealthcommunitycommittee
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Sep 5, 2024 · 5:30 PM

Housing and Land Use Committee (2023-2025)

Housing and Land Use Committee meeting canceled

The Housing and Land Use Committee meeting scheduled for September 5, 2024, was canceled. The agenda included a discussion on rent stabilization, but no legislative action was to be taken.

canceledhousingrent-stabilizationland-usemaui-county
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Aug 27, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council to consider multiple zoning changes and FY2025 budget amendments

The Council will review several budget amendments for fiscal year 2025 and vote on various zoning and land use changes. The meeting includes decisions on board appointments and a proposal to operate as a bilingual government.

zoningbudgetland-usegovernment-operationselectric-vehicles
Thu Aug 22, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee to consider street improvement exemptions for wildfire-damaged properties

The Water and Infrastructure Committee will consider Bill 110 (2024). This bill proposes to exempt certain properties damaged by the August 8, 2023, Maui wildfires from public street improvement requirements.

infrastructurewildfire-recoverypublic-streetszoning
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Thu Aug 22, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to discuss ferry feasibility and Lahaina harbor repairs

The Agriculture, Diversification, Environment, and Public Transportation Committee will receive presentations on two specific projects. No legislative action will be taken during this meeting.

transportationferriesharborslahaina
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Wed Aug 21, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to discuss fire prevention measures and wildfire legislation

The Disaster, Resilience, International Affairs, and Planning Committee will hold a discussion on fire prevention, including county, state, and federal laws, enforcement, and the Department of Fire and Public Safety’s role. No legislative action is planned. The meeting will be held online and in-person at the Planning Conference Room in Wailuku.

fire-preventionwildfiredisaster-resilienceplanningcommittee-meeting
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Wed Aug 21, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee to consider district boundary and zoning changes for Ohukai Light Industrial Park

The Housing and Land Use Committee will review Bill 29 and Bill 30, which propose a district‑boundary amendment from Agricultural to Urban and a zoning change from Rural to M‑1 Light Industrial for 14.626 acres at 454 Ohukai Road, Kihei. The committee may recommend passage on first reading of the CD‑1 versions of both bills, with or without technical revisions. A presentation from applicant William Spence and planning department reports will be considered.

zoningland-useindustrialkiheiplanningcommittee
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Tue Aug 20, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers budget amendments for Department of Water Supply

The Budget, Finance, and Economic Development Committee will consider two bills to increase funding for the Department of Water Supply. The body will also discuss taxicab rates and an energy performance contract with Johnson Controls, Inc.

budgetwater-supplytaxicabsenergy-contractspublic-works
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Tue Aug 20, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers state legislative packages and special counsel appointment

The Committee is reviewing several resolutions to include proposed state bills in the 2025 legislative packages for the Hawaii State Association of Counties and the Maui County Council. These proposals cover composting, water resource management, and police retirement. The body is also considering the appointment of special legal counsel for a specific civil case.

compostingwater-managementpoliceretirementlegal-counsellegislation
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, HI
Mon Aug 19, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee to receive updates on wildfire recovery and bird‑flu prevention

The Water Authority, Social Services, and Parks Committee will receive a presentation on the Health and Social Services Recovery Support Function, covering mental health, substance abuse, and care projects after the August 8 2023 wildfires. The committee will also get an update on avian influenza (bird flu) and prevention methods from state agencies. No legislative action is planned for either item.

healthsocial-servicesbird-flurecoverypublic-testimony
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Mon Aug 19, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee to hear presentations on systemic inequality without taking action

The Efficiency Solutions and Circular Systems Committee will receive presentations on systemic inequality in economic systems from invited speakers. No legislative action is scheduled for this meeting. The committee may discuss related matters but will not vote on any proposals.

systemic-inequalityeconomic-systemscommittee-meetinghousingpublic-finance
Online via Zoom: http://tinyurl.com/ESCS-Committee Remote oral testimony is also available online via the same Zoom link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Tue Aug 13, 2024 · 9:00 AM

Council of the County of Maui

Council considers affordable housing projects and land use changes

The Maui County Council is meeting to discuss several zoning amendments for affordable housing and commercial use. The body will also consider mayoral appointments for department directors and various FY 2025 budget amendments.

zoningaffordable-housingbudgetappointmentsagriculturelahaina
Wed Aug 7, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee considers expanding emergency hours at Kapalua Airport

The Committee will consider recommending the passage of Bill 21 (2023) to expand hours for emergency airstrip operations at Kapalua Airport. The body will also discuss a potential zoning change for Grace Baptist Church in Lahaina.

zoningaviationlahainaemergency-operations
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Wed Aug 7, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee will consider rezoning 200 acres for Miki 200 Industrial Park on Lanai

The Housing and Land Use Committee will review Bill 27 (2024) and may recommend passage of the CD 2 version on first reading, with or without further revisions. The bill proposes conditional zoning changes to M‑1 Light Industrial and M‑2 Heavy Industrial for 200 acres of tax map key (2) 4‑9‑002:061 to develop the Miki 200 Industrial Park. The committee also received Bills 23, 24, and 25 concerning community‑plan and code amendments for multiple parcels in Lāna‘i City and will consider recommending passage of the CD 1 version of Bill 23, while no legislative action will be taken on Bills 24 and 25. A presentation from Pūlama Lāna‘i representatives will be heard before any recommendations.

zoningland-useindustrialcommunity-plancode-amendmentlanai
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Tue Aug 6, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to discuss $426 flood development permit application review fee

The Budget, Finance, and Economic Development Committee will discuss two bills regarding flood hazard area development permits. No legislative action will be taken during this meeting.

feesflood-developmentbudgetpublic-works
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Tue Aug 6, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee to consider water authority appointment and legal settlements

The Government Relations, Ethics, and Transparency Committee will discuss the appointment of a director for the East Maui Regional Water Authority. The body will also consider two resolutions regarding legal settlements and special counsel compensation.

appointmentslitigationwater-authoritylegal-fees
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Fri Jul 26, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers appointment of Marcy Martin as Director of Finance

The Government Relations, Ethics, and Transparency Committee will consider Resolution 24-124 regarding the appointment of Marcy Martin as Director of Finance. The Committee also intends to receive updates on wildfire recovery efforts and the Community Development Block Grant, Disaster Recovery program.

appointmentsfinancedisaster-recoverywildfiresgovernment-transparency
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Fri Jul 26, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to discuss FY 2024 revenue shortfalls and energy performance contract

The Budget, Finance, and Economic Development Committee will discuss estimated revenue shortfalls for Fiscal Year 2024 and a contract with Johnson Controls, Inc. No legislative action will be taken during this meeting.

budgetrevenuesewer-fundenergy-contractfinance
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Thu Jul 25, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to weigh composting rules and small-farm protections

The Agriculture, Diversification, Environment, and Public Transportation Committee will review two bills: Bill 100 (2024) to allow composting in Maui’s Agricultural District and Bill 17 (2022) to block private restrictions on small-scale farming and animal-keeping in rural zones. Both items are at first-reading stage; the committee may recommend passage or further revisions.

agriculturecompostingzoningsmall-farmsrural-land-use
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Thu Jul 25, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee will discuss updates on county permit‑processing efficiencies

The Water and Infrastructure Committee will receive updates from the Departments of Environmental Management, Fire and Public Safety, Housing, Planning, Public Works, Water Supply, and 4LEAF Consulting, Inc. about current county permitting processes. The discussion will focus on ways to make permitting more efficient across the county. No legislative action or vote is planned for this agenda item.

permit-processingefficiencywater-infrastructuregovernment
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Wed Jul 24, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee will consider a bill requiring EV charging stations in large parking lots.

The Disaster, Resilience, International Affairs, and Planning Committee will review Resolution 23-163, which refers a proposed bill to the Lāna‘i, Maui, and Molokai Planning Commissions. The bill would amend Maui County Code §19.36B.020 to require public accommodations with at least 50 parking spaces to provide two electric‑vehicle charging stations, plus two additional stations for each additional increment of 50 spaces. The committee may recommend adoption of the resolution, with or without revisions, and may also consider filing the resolution.

electric-vehiclesparkingplanningzoningtransportation
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Wed Jul 24, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee to discuss advisory committees and vacation rental phase-out study scope

The Housing and Land Use Committee will receive a presentation on advisory committees to the Maui Planning Commission and discuss the scope of work for a study on phasing out transient vacation rentals in the A-1 and A-2 Apartment Districts. No legislative action is planned for either item.

zoninghousingvacation-rentalsplanning-commissionprocedural
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Planning Conference Room, Kalana Pakui Building, 250 South High St., Wailuku, Maui, Hawai‘i
Mon Jul 22, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

July 22 Water Authority, Social Services, and Parks Committee meeting canceled

The meeting scheduled for July 22, 2024, was canceled. The agenda had included a presentation on the initial findings of the Maui Wildfire Exposure Cohort Study.

wildfirepublic-healthsocial-services
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Jul 19, 2024 · 9:00 AM

Council of the County of Maui

Council considers global settlement for August 2023 wildfire litigation

The Council of the County of Maui is meeting to discuss a recommended global settlement for wildfire litigation and consider various ordinances regarding residential density, kitchenettes, and water systems. The body will also review several budget amendments for fiscal year 2025.

wildfireszoningbudgetwater-systemshousinglitigation
Tue Jul 9, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers global settlement of wildfire litigation against Maui County

The Government Relations, Ethics, and Transparency Committee will consider Resolution 24-128 regarding a global settlement for all wildfire litigation against the County of Maui. The committee may discuss recommending adoption of the resolution with or without revisions.

wildfirelitigationlegalgovernment-relations
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Jul 9, 2024 · 9:00 AM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers department director appointments and various board nominees

The Committee will review several leadership appointments, including the Director of Housing and the Director of ‘Ōiwi Resources. Members will also consider multiple nominees for various county boards, committees, and commissions.

governmentappointmentshousingresource managementethics
Online via Teams: http://tinyurl.com/GREAT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Jul 5, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council discusses land acquisition, budget amendments, and equipment donations

The Council is considering several legislative items including a $950,000 land acquisition in Kula and various charter amendments. Discussion also includes food-waste composting initiatives and updates to the fiscal year 2025 budget.

budgetlandpublic safetyzoninggovernment-charteragriculture
Tue Jul 2, 2024 · 1:30 PM

Water and Infrastructure Committee (2023-2025)

Committee discussion on undergrounding utility lines

The Water and Infrastructure Committee may discuss Bill 90 (2023), which proposes amendments to the Maui County Code regarding utility lines and facilities. The bill aims to implement objectives from the Countywide Policy Plan and Maui Island Plan by requiring more utility lines to be placed underground.

utilitiesinfrastructurezoningpublic-policy
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Jul 2, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses housing funding and county financial audit reports

The Committee will discuss funding mechanisms for affordable and workforce housing through the Hawaii Housing Finance & Development Corporation. Members will also review the County of Maui's Annual Comprehensive Financial Report, Single Audit Reports, and Department of Water Supply audit reports. No legislative action will be taken during this meeting.

housingbudgetfinancewater-supplyaudit
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Jul 1, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee may receive presentation on Indigenizing Economics

The Efficiency Solutions and Circular Systems Committee may receive a presentation titled “Indigenizing Economics” from Kamuela Enos of the University of Hawai ʻi System. The committee may also discuss other related matters, but no legislative action will be taken.

economicsindigenous-knowledgeuniversity-of-hawaii
Online via Zoom: http://tinyurl.com/ESCS-Committee Remote oral testimony is also available online via the same Zoom link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawaiʻi
Fri Jun 21, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council discusses charter amendments, wildfire recovery, and budget updates

The Council is considering several charter amendments regarding board reappointments and salary commission authority. Additionally, members will discuss temporary structures in the Lahaina burn zone and various budget adjustments.

zoningbudgetwildfire-recoverytaxationgovernment-charterhousing
Thu Jun 20, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee discusses hemp industry, food innovation, and axis-deer expansion

The ADEPT Committee will receive presentations and discuss various agricultural and environmental topics. No legislative action will be taken during this meeting.

agriculturehempfood-innovationenvironmentinvasive-species
Online via Teams: http://tinyurl.com/ADEPT-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Jun 20, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee considers exempting shipping containers from building permits

The Water and Infrastructure Committee will consider Bill 96 (2024). This bill would amend the Maui County Code to exempt shipping containers from building permit requirements in industrial and agricultural zoning districts.

zoningbuilding-permitsshipping-containersindustrial-zoningagricultural-zoning
Online via Teams: http://tinyurl.com/WAI-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Jun 19, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee considers zoning change for Hāna Store Storage Building

The Committee is considering Bill 69 (2024) to change the zoning of a property in Hāna. The proposal seeks to reestablish commercial uses on approximately 21,711 square feet of land.

zoninghanacommercialland use
Online via Teams: http://tinyurl.com/HLU-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Jun 18, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses immigrant services fund and energy performance contract

The Committee may consider recommending passage of Bill 78 (2023) to establish a revolving fund for the Immigrant Services Division's passport application acceptance facility. Members will also discuss an energy performance contract with Johnson Controls, Inc. and related equipment lease agreements.

budgetgovernment-servicesenergycontractspassports
Online via Teams: http://tinyurl.com/BFED-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Jun 18, 2024 · 1:30 PM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee discusses temporary shelter and unsheltered conditions

The Committee will receive updates on the Puʻuhonua o Nēnē temporary shelter for those impacted by the August 2023 wildfires. Members will also discuss current conditions for the unsheltered on Holomua Road in Pāʻia. No legislative action is scheduled for these items.

housingshelterwildfire-recoverysocial-services
Online via Teams: http://tinyurl.com/WASSP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Jun 17, 2024 · 9:00 AM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee considers jet ski donation and fire prevention discussion

The committee will consider Resolution 24-101 to accept a donation of equipment for the Department of Fire and Public Safety. Members will also discuss fire prevention topics, including wildfire prevention legislation and safety inspections.

fire-preventionpublic-safetydonationswildfires
Online via Teams: http://tinyurl.com/DRIP-Committee Remote oral testimony is also available online via the same Teams link. In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Jun 6, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee considers temporary structures in the Lahaina burn zone

The Water and Infrastructure Committee will consider Bill 87 (2024) regarding temporary structures and uses. The bill proposes allowing these structures within the August 2023 wildfire burn zone area for up to five years.

lahainawildfirezoningtemporary-structuresland-use
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Jun 5, 2024 · 3:00 PM

Council of the County of Maui

Council discusses opposition to proposed Air Force telescope facility atop Haleakalā

The Council of the County of Maui will meet to consider a resolution regarding the construction of a proposed research facility. The item involves opposing the Air Force Maui Optical and Supercomputing Site Small Telescope Advanced Research Facility located atop Haleakalā.

haleakalaair forcetelescoperesearch facilityland use
Wed Jun 5, 2024 · 1:30 PM

Council of the County of Maui

Maui Council discusses budget, bond issuances, and wildfire recovery relief

The Council is reviewing several ordinances including the upcoming fiscal year operating and capital budgets. Discussions also cover bond authorizations, wastewater project financing, and property tax relief for August 2023 wildfire survivors.

budgetbondswildfire-recoverywastewatertaxespublic-works
Wed Jun 5, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses rezoning for Queen Kaʻahumanu Center project

The Committee is considering two bills to change land use and zoning in Kahului. These changes would allow for a mixed-use development including residential, retail, office, and green space at the Queen Kaʻahumanu Community Center.

zoningland usehousingkahuluidevelopment
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Jun 4, 2024 · 9:00 AM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee discusses charter amendments and personnel appointments

The Committee is considering several charter amendments to be placed on the next General Election ballot. Discussions also include a personnel appointment for the Director of Human Concerns.

governmentcharter-amendmentsethicspersonnelbudget
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Jun 3, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee discusses Haleakalā diesel spill and proposed telescope facility

The Efficiency Solutions and Circular Systems Committee will receive updates regarding ʻōiwi resources. Discussions include the January 29, 2023, diesel fuel spill at Haleakalā and a presentation on the proposed Air Force AMOS STAR facility. No legislative action will be taken during this meeting.

environmentenergyhaleakalaresource-management
Online via Teams: http://tinyurl.com/47pphhp9 Phone testimony: 1-808-977-4067, code 728 915 689# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawaiʻi
Mon Jun 3, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee discusses temporary shelter and unsheltered conditions

The Committee will receive updates on the Puʻuhonua o Nēnē temporary shelter for those impacted by the August 2023 wildfires. Members will also discuss the Commission on Healing Solutions for Homelessness annual report and current conditions for the unsheltered on Holomua Road in Pāʻia. No legislative action will be taken during these discussions.

housinghomelessnesswildfire-recoverysocial-services
Online via Teams: http://tinyurl.com/24u2f5nn Phone testimony: 1-808-977-4067, code 748 265 393# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed May 29, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses deadline extension for Waikapu workforce housing project

The Housing and Land Use Committee is considering Resolution 24-94 regarding the affordable workforce housing project by Waikapu Development Venture LLC. The resolution proposes modifications to the project and extends the construction completion deadline for 80 residential units to September 7, 2029.

housingworkforce-housingconstructionzoning
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed May 29, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses energy contract and police helicopter program

The committee will discuss a proposed $29,927,529 appropriation for an energy performance contract with Johnson Controls, Inc. Members may also receive a presentation regarding the Department of Police's proposed helicopter program.

budgetenergypolicepublic-safety
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue May 28, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses energy performance contract and police helicopter program

The Committee will discuss a proposed $29,927,529 appropriation for the Johnson Controls Energy Performance Contract. Members may also receive a presentation regarding the Department of Police's proposed helicopter program.

budgetenergypolicepublic-safetygovernment-contracts
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue May 28, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Extension requested for Waikapu workforce housing project deadline

The Committee is considering Resolution 24-94 regarding the affordable workforce housing project by Waikapu Development Venture LLC. The resolution proposes modifications to the project and extends the construction completion deadline to September 7, 2029.

housingworkforce-housingconstructionland-use
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue May 21, 2024 · 9:00 AM

Council of the County of Maui

Maui Council holds hearing on $102 million bond authorization for public improvements

The Council of the County of Maui is holding a public hearing to receive testimony on several items, including the 2024-2025 operating budget and capital program. The agenda also includes proposals for bond authorizations, wastewater project funding, and wildfire recovery tax relief.

budgetbondswildfire-recoveryhousingwastewatertaxes
Tue May 21, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council considers $102 million bond authorization and FY 2024-25 budget

The Maui County Council will hold first readings on the 2024-2025 operating budget and the 2025-2030 capital program. The agenda also includes several measures related to wildfire recovery, including property tax relief for survivors and debris removal standards.

budgetwildfire recoveryinfrastructurehousingtaxation
Fri May 17, 2024 · 9:00 AM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee discusses police data access, EPA settlement, and financial disclosure updates

The Committee will consider several bills regarding intergovernmental agreements and code amendments. Discussions include data sharing between the Police Department and Department of Health, a settlement with the EPA, and changes to financial disclosures and officer salaries.

policehealthenvironmentgovernment-operationsfinancelegal
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu May 16, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Updates on wildfire recovery permitting and infrastructure improvements

The Committee will receive updates regarding the expedited permitting process for wildfire-affected areas in Lahaina and Upcountry. Members will also discuss public infrastructure needs within the 2023 West Maui wildfire burn areas, including roads and connectivity. No legislative action will be taken during this meeting.

wildfirelahainainfrastructurepermittingpublic-works
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed May 15, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses budget provisions, tax credits, and housing acquisitions

The Committee will discuss the Fiscal Year 2025 General Budget Provisions. Members may also consider a bill to increase the circuit breaker tax credit and a bill to add $16,425,000 to the Homeowner Assistance Fund. Additionally, two resolutions regarding condominium unit acquisitions for affordable rental housing in Lahaina are on the agenda.

budgettaxationhousingaffordable-housinglahainawildfire-recovery
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed May 15, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Maui committee reviews bill to expand farm dwelling size limits.

The Housing and Land Use Committee will review Bill 71 (2024), which proposes amending Maui County Code Section 19.30A.050 to increase the maximum allowable size of one farm dwelling per lot from 1,000 to 1,500 square feet in the Agricultural District on Maui and Lānaʻi. The committee may recommend passage on first reading or take other related actions. This change would alter housing size limits for agricultural properties across both islands.

zoninghousingordinancesland-usemaui-county
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon May 13, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee discusses draft Wetlands Overlay Map

The Committee will receive a presentation from the Planning Department regarding the Maui County Wetlands Restoration and Protection Project's draft Wetlands Overlay Map. The meeting is intended for discussion of related matters, but no legislative action will be taken.

wetlandsenvironmentplanningmaui-county
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri May 3, 2024 · 9:00 AM

Council of the County of Maui

Maui Council discusses budget amendments, zoning changes, and tax credits

The Maui County Council is considering several ordinances including a $10 million increase for insurance programs and updates to the circuit breaker tax credit. The agenda also includes land use amendments for the University of Hawai‘i Maui College Molokai Education Center and various budget adjustments.

budgetzoningtaxationwatereducationgovernment-agreements
Wed May 1, 2024 · 9:00 AM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee discusses finance director appointment and litigation settlement

The Committee will consider the appointment of Maria Zielinski as Director of Finance. Members will also discuss the 2024 mass nominations process and a proposed legal settlement.

governmentfinanceappointmentslitigationlegal
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Apr 29, 2024 · 10:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and various county bills

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed Fiscal Year 2025 budget. Discussion includes operating and capital budgets, bond authorizations, and several ordinances related to wildfire recovery and tax exemptions.

budgetwildfire-recoveryhousinginfrastructuretaxes
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Apr 26, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and various county bills

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed Fiscal Year 2025 budget. Discussion includes operating and capital budgets, bond authorizations, and several ordinances related to tax exemptions and property transfers.

budgetfinancewildfire-recoveryhousinginfrastructuretaxes
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Apr 25, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and related ordinances

The committee is reviewing the Mayor's proposed Fiscal Year 2025 budget, which includes operating and capital programs. The agenda also contains items regarding bond authorizations, wastewater project financing, and property transfers for affordable housing.

budgetfinancehousinginfrastructurewastewatertaxation
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Apr 24, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and various county bills

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed Fiscal Year 2025 budget. Discussion includes operating budgets, capital programs, bond authorizations, and property transfers.

budgetfinancecapital-improvementshousingwastewatergovernment-operations
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Apr 23, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui Committee reviews FY 2025 budget and $61 million bond authorization

The committee will review the proposed Fiscal Year 2025 budget for Maui County, including operating and capital improvement plans. The agenda includes discussions on authorizing $61 million in bonds and financing wastewater projects through a state loan. The committee will also consider fuel tax rates and property transfer for affordable housing.

budgetfinanceinfrastructurehousingtaxationwastewater
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Apr 22, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 County of Maui budget

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed fiscal year 2025 budget. Discussion includes operating budgets, capital programs, bond authorizations, and various administrative adjustments.

budgetfinancecapital-improvementshousingwastewatergovernment-operations
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Apr 19, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 County of Maui budget

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed fiscal year 2025 budget. Discussions include operating and capital budgets, bond authorizations, and various administrative resolutions.

budgetfinancecapital-improvementshousinggovernment-operations
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Apr 19, 2024 · 9:00 AM

Council of the County of Maui

Maui Council considers $1.5 million for water supply compliance

The Maui County Council is reviewing several ordinances, including a budget amendment for lead and copper rule compliance in the water supply. The agenda also includes discussions on agricultural zoning definitions and appointments for county officials.

zoningbudgetwateragriculturefinancepublic safety
Thu Apr 18, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 Maui County budget and capital programs

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed Fiscal Year 2025 budget. The agenda includes ordinances for operating and capital budgets, bond authorizations, and wastewater project funding. The committee will also consider items regarding fuel tax rates and staff pay adjustments.

budgetfinancehousinginfrastructurewastewatertaxation
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Apr 17, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

The committee will review the proposed FY 2025 Maui County budget and $61 million bond issuance.

The Budget, Finance, and Economic Development Committee is reviewing several items related to the proposed Fiscal Year 2025 budget. This includes proposals for operating and capital budgets, bond issuances, and wastewater project financing. The committee will also consider staff pay adjustments and property transfers for affordable housing.

budgetfinancehousinginfrastructurewastewatertaxation
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Apr 16, 2024 · 1:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 County of Maui budget

The Committee is reviewing the Mayor's proposed operating and capital budgets for fiscal year 2025. Discussion includes bond authorizations, wastewater project financing, and pay adjustments for Council Services staff.

budgetfinancecapital-improvementsgovernment-operationswastewatertaxes
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Apr 15, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses proposed Fiscal Year 2025 Budget for Maui County

The Budget, Finance, and Economic Development Committee will review the Mayor's proposed FY 2025 budget and related legislation. The meeting includes discussions on operating budgets, capital programs, bond authorizations, and fuel tax rates. No legislative action will be taken during this session.

budgetfinancecapital-improvementsbondswastewatertaxes
In-Person Only: Mitchell Pauʻole Community Center, Main Hall 90 Ainoa Street Kaunakakai, Hawaiʻi
Fri Apr 12, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

The Committee reviews the proposed Fiscal Year 2025 County of Maui budget

The Budget, Finance, and Economic Development Committee is reviewing several bills and resolutions related to the upcoming fiscal year. These items include the annual operating and capital budgets, bond authorizations, and fuel tax rates.

budgetfinancecapital-improvementsbondsgovernment-operations
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Apr 11, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 Budget and related legislation

The Committee will receive public testimony regarding the Mayor's proposed FY 2025 budget, including operating and capital programs. No legislative action will be taken during this meeting.

budgetcapital-improvementsbondswastewatertaxes
In-Person Only: Kīhei Community Center, Main Hall 303 East Lipoa Street Kīhei, Hawaiʻi
Thu Apr 11, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and capital program

The committee will consider the proposed Fiscal Year 2025 budget, including operating and capital programs. This includes authorizations for general obligation bonds and financing for wastewater projects. The agenda also addresses pay adjustments for Council Services staff.

budgetfinancecapital-improvementswastewaterpublic-works
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Apr 10, 2024 · 1:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Review of the proposed Fiscal Year 2025 County of Maui budget and capital programs

The Committee is reviewing Mayor Bissen’s proposed Fiscal Year 2025 budget, including operating and capital improvement plans. Items for consideration include bond authorizations, wastewater project funding, and fuel tax rates. The meeting also addresses pay adjustments for Council Services staff.

budgetfinanceinfrastructurewastewaterwages
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Apr 9, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 Budget and related legislation

The Committee will receive public testimony regarding the Mayor's proposed FY 2025 budget, including operating and capital programs. The meeting includes discussions on bond authorizations, fuel tax rates, and wastewater project financing. No legislative action will be taken during this session.

budgetcapital-improvementsbondswastewatertaxespublic-works
In-Person Only: Lāna‘i High and Elementary School, Cafeteria 555 Fraser Avenue Lāna‘i City, Hawaiʻi
Mon Apr 8, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Review of the proposed Fiscal Year 2025 County of Maui budget

The committee will receive public testimony regarding Mayor Bissen’s proposed Fiscal Year 2025 budget. The session includes discussions on operating budgets, capital programs, and bond authorizations. No legislative action will be taken at this meeting.

budgetfinanceinfrastructuretaxeswastewater
In-Person Only: Lahaina Civic Center, Gymnasium 1840 Honoapiʻilani Highway Lahaina, Hawaiʻi
Mon Apr 8, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui County reviews FY 2025 budget, $61.37M bonds, and wastewater loans.

The Maui County Budget, Finance, and Economic Development Committee will review Mayor Richard T. Bissen Jr.’s proposed Fiscal Year 2025 budget package. Members may recommend first reading or adoption of six bills and three resolutions covering operating appropriations, a capital program through 2030, bond issuances, and wastewater financing. The agenda also includes legislation to adjust fuel tax rates and revise pay scales for Office of Council Services staff. No final votes are scheduled; the committee will only consider recommendations at this meeting.

budgetbondswastewaterfuel-taxsalariescapital-improvementsmaui-county
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Apr 5, 2024 · 2:00 PM

Housing and Land Use Committee (2023-2025)

Committee considers rezoning for 120-unit Wailuku project

The committee will discuss a strategy for permanently affordable rental units and consider Bill 28 (2024). This bill proposes rezoning 9.798 acres from agricultural to urban for the Hale Mahaolu Ke Kahua project in Wailuku. The development would include 120 multi-family units, thirteen two-story buildings, a nonprofit building, and a clubhouse.

housingzoningwailukurentalland-use
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Apr 5, 2024 · 9:00 AM

Council of the County of Maui

Maui Council discusses housing acquisitions and wildfire recovery funding

The Maui County Council is considering several residential condominium acquisitions and budget amendments. Discussions include water source development, West Maui infrastructure planning, and wildfire debris removal.

housingbudgetwaterwildfireinfrastructure
Thu Apr 4, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Review of the proposed Fiscal Year 2025 budget for Maui County

The Committee is reviewing Mayor Bissen's proposed Fiscal Year 2025 budget, including operating and capital programs. The agenda includes bond authorizations for public improvements and financing for wastewater projects. The committee will also consider adopting new fuel tax rates.

budgetfinanceinfrastructuretaxeswastewaterroads
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Apr 3, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui Committee reviews proposed Fiscal Year 2025 County budget and related bills

The committee will receive public testimony regarding the proposed Fiscal Year 2025 County of Maui budget. The agenda includes several bills concerning operating budgets, capital programs, and bond authorizations. No legislative action will be taken during this meeting.

budgetfinancecapital improvementstaxeswastewaterinfrastructure
In-Person Only: Mayor Hannibal Tavares Community Center, Social Hall 91 Pukalani Street Makawao, Hawaiʻi
Wed Apr 3, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 budget and capital program

The Committee is reviewing the Mayor's proposed operating and capital budgets for Fiscal Year 2025. Discussion includes bond authorizations, wastewater project loans, and fuel tax rates.

budgetcapital-improvementsbondswastewatertaxes
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Apr 2, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 Budget and related legislation

The Committee is reviewing the Mayor's proposed FY 2025 budget, including operating and capital programs. The meeting includes receiving public testimony on several bills regarding bond issuances, wastewater projects, and fuel tax rates. No legislative action will be taken during this meeting.

budgetcapital-improvementsbondswastewatertaxespublic-works
In-Person Only: Pāʻia Community Center, Social Hall 252 Hana Highway Pāʻia, Hawai‘i
Tue Apr 2, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui County committee reviews FY2025 budget, capital program, and bond authorizations.

The Budget, Finance, and Economic Development Committee will review Mayor Richard T. Bissen, Jr.’s proposed Fiscal Year 2025 budget package for the County of Maui. Members are scheduled to discuss and potentially recommend passage of five bills covering the operating budget, a six-year capital program, general obligation bond issuances totaling $61,373,839, lapsed bond proceeds for West Maui road repairs, and a wastewater loan agreement up to $10,700,000. The committee will also consider Resolution 24-66 to adopt county fuel tax rates effective July 1, 2024. No final actions are scheduled; the body is reviewing proposals before forwarding recommendations to the full Council.

budgetcapital-improvementbondsroadswastewaterfuel-taxcounty-finance
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Apr 1, 2024 · 6:00 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee reviews proposed Fiscal Year 2025 County of Maui budget

The Budget, Finance, and Economic Development Committee is reviewing the Mayor's proposed FY 2025 budget and related legislation. The meeting includes receiving public testimony on various fiscal items including operating budgets, capital programs, and bond authorizations. No legislative action will be taken during this meeting.

budgetfinancecapital-improvementsbondswastewatertaxes
In-Person Only: Helene Hall, Social Hall 150 Keawa Place Hāna, Hawaiʻi
Mon Apr 1, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

The Committee reviews the proposed Fiscal Year 2025 Budget for Maui County

The Committee is reviewing several bills and a resolution related to the Mayor's proposed Fiscal Year 2025 budget. Discussion includes operating budgets, capital programs, bond authorizations, and fuel tax rates.

budgetfinancecapital-improvementsbondswastewatertaxes
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 27, 2024 · 10:00 AM

Housing and Land Use Committee (2023-2025)

Committee considers rezoning land for 120 multi-family units in Wailuku

The committee will discuss a strategy for permanently affordable rental units following a presentation from Homestead Community Development Corporation. Members will also consider Bill 28 (2024) regarding a district boundary amendment in Wailuku. No legislative action is planned for the rental unit discussion.

housingzoningwailukuland-userental-units
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Mar 22, 2024 · 9:00 AM

Council of the County of Maui

Council considers ground lease for property in Kihei

The Council of the County of Maui will conduct a second and final reading of Bill 44. This ordinance would authorize the Mayor to enter into an intergovernmental agreement regarding a long-term ground lease.

housingkiheiground leaseordinance
Fri Mar 22, 2024 · 9:15 AM

Council of the County of Maui

Maui County Council discusses wildfire disposal funds and legal compensation

The Council is considering budget amendments including $7,304,000 for Lāhainā wildfire disposal sites. Other items include legal compensation for counsel representing the County in wildfire-related litigation and various board appointments.

budgetwildfirelegalagriculturegovernment
Thu Mar 21, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Review of Department of Water Supply budget and water system integration

The Water and Infrastructure Committee will conduct a budgetary review of the Department of Water Supply's Fiscal Year 2024 Budget. The committee will also receive a presentation regarding the consolidation of public and private water systems on Maui and Molokai. No legislative action will be taken during this meeting.

waterbudgetinfrastructuremauimolokaiutilities
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Mar 21, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee discusses wildfire soil remediation and new county positions

The Committee will discuss soil stabilization and bioremediation for toxic debris from the August 2023 wildfires. Members will also consider a potential County of Maui Arborist position and immigrant and migrant services.

wildfiresenvironmentgovernment-staffingsocial-services
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 20, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses Ho ʻonani Village project and department bifurcation

The Committee will receive a presentation on the Ho ʻonani Village multifamily rental housing project in Puʻunene. Members will also discuss updates regarding the division of the Department of Housing and Human Concerns into two separate departments. Additionally, the Committee may consider Resolution 23-226 to urge the Mayor to establish a Housing Coordinator.

housinggovernment-restructuringpuunenekahului
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 20, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to review FY2024 budgets for police, fire, and planning departments

The Committee will conduct operational and budgetary reviews of several county agencies. These sessions may include presentations regarding the Fiscal Year 2024 Budget. No legislative action will be taken during this meeting.

policebudgetemergency-managementfire-safetyplanning
Online via Teams: http://tinyurl.com/y7xmx267 Phone testimony: 1-808-977-4067, code 585 709 254# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Mar 19, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

The Committee will discuss eminent domain for the Central Maui Landfill expansion

The Committee will discuss a proposed authorization for eminent domain proceedings to acquire property for the Central Maui Sanitary Landfill Phase VI expansion. The meeting also includes an update from the Office of Recovery. No legislative action will be taken during this meeting.

landfilleminent-domainrecoverygovernment-relations
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Mar 19, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui Committee reviews acquiring three condo units for affordable kupuna housing

The committee is reviewing resolutions to purchase condominium units in Lahaina, Wailuku, and Kihei for affordable senior housing. They are also considering budget amendments for water supply compliance through a state loan. Additionally, the committee will discuss preparations for the Fiscal Year 2025 budget.

housingbudgetwaterkupunamauifinance
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Mar 18, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers various board and commission member appointments

The Government Relations, Ethics, and Transparency Committee is reviewing multiple resolutions to appoint members to several county boards and commissions. These appointments cover diverse areas including ethics, animal control, water supply, and public safety.

governmentappointmentsethicspublic-safetyplanning
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Mar 18, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee considers granting 8.02 acres in Kahului to Hale Makua Health Services

The committee will consider a resolution to grant real property at 472 Laau Street to Hale Makua Health Services. Members will also receive budget updates for the Department of Parks and Recreation and the Department of Housing and Human Concerns. No legislative action is planned for the budget reviews.

healthcarebudgetparkshousingkahului
Online via Teams: http://tinyurl.com/24u2f5nn Phone testimony: 1-808-977-4067, code 748 265 393# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Mar 15, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee discusses water development and West Maui infrastructure planning

The committee is considering a water source agreement for Upcountry and a master plan for wildfire-affected areas in West Maui. Members may review resolutions regarding water delivery and road improvement needs.

waterinfrastructurezoningwest-mauiupcountry
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 13, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses industrial rezoning and community plan amendments for Lāna'i

The Committee will consider several bills regarding land use in Lāna'i City. This includes a proposal to rezone property for the Miki 200 Industrial Park and multiple bills to amend the Lāna'i Community Plan and Project District 2 zoning.

zoningland-uselāna'iindustrialcommunity-plan
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 13, 2024 · 10:30 AM

Housing and Land Use Committee (2023-2025)

Committee considers rezoning for 120-unit Hale Mahaolu Ke Kahua project in Wailuku

The committee will discuss strategies for permanently affordable rental units following a presentation from Homestead Community Development Corporation. Members may also consider Bill 28 (2024), which proposes rezoning 9.798 acres in Wailuku from agricultural to urban. This change would support the construction of the Hale Mahaolu Ke Kahua project, featuring 120 multi-family units.

zoninghousingwailukuaffordable-housingland-use
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 13, 2024 · 1:30 PM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers $1.2 million increase for HUD emergency housing vouchers

The committee will consider Bill 36 (2024), which proposes increasing the FY 2024 budget for HUD emergency housing vouchers by $1,200,000. Members will also discuss grants from the Office of Economic Development and preparations for the Fiscal Year 2025 Budget. No legislative action is planned for the grant or budget discussion items.

budgethousinggrantseconomic-development
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Mar 12, 2024 · 9:00 AM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee reviews appointments for multiple Maui County boards and commissions

The Government Relations, Ethics, and Transparency Committee is considering several resolutions to appoint members to various county boards and commissions. The agenda includes reviewing applicants for roles on the Board of Ethics, Animal Control Board, and Maui Planning Commission. These appointments cover terms expiring between 2024 and 2029.

appointmentsgovernmentboardscommissionsmaui
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Mar 8, 2024 · 9:00 AM

Council of the County of Maui

Maui Council discusses housing grants, property acquisitions, and budget amendments

The Maui County Council is considering several budget amendments, including a $10,000,000 grant for the Hale Pilina project. The agenda also includes resolutions for various condominium unit acquisitions and several ordinances regarding infrastructure and community improvements.

budgethousingreal estateinfrastructuregovernment-finance
Thu Mar 7, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee considers amending 'farm' and 'farm labor dwelling' definitions

The ADEPT Committee will consider Bill 42, CD 1 (2024), which proposes changes to the definitions of “farm” and “farm labor dwelling” in the Comprehensive Zoning Ordinance. The committee may decide whether to recommend the bill for first reading or choose to file it.

zoningagriculturehousingland-use
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Mar 7, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee discusses water agreements and West Maui infrastructure planning

The Water and Infrastructure Committee will consider several items regarding water security and infrastructure. Discussions include an agreement for stream sediment removal, a water source development agreement for Upcountry, and a master plan for wildfire-affected areas in West Maui.

waterinfrastructurezoningwildfire-recoverywest-maui
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 6, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to discuss Hawaiʻi’s status under international law

The Committee may receive a presentation from Dr. David “Keanu” Sai, Ph.D., regarding Hawaiʻi’s status under international law. The session is intended for discussion of related matters, but no legislative action will be taken.

international-lawgovernment-status
Online via Teams: http://tinyurl.com/y7xmx267 Phone testimony: 1-808-977-4067, code 585 709 254# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Mar 6, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee considers rezoning for 120-unit Hale Mahaolu Ke Kahua project

The committee will consider Bill 28 (2024) regarding a district boundary amendment in Wailuku. This bill proposes rezoning 9.798 acres from agricultural to urban for the Hale Mahaolu Ke Kahua project. The committee may also discuss a strategy for permanently affordable rental units.

zoninghousingwailukuland-useaffordable-housing
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Mar 5, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses budget amendments and transient accommodations tax changes

The Committee will consider several budget amendments, including transfers for the General Excise Tax Fund and Lāhainā wildfire disposal sites. Members will also discuss updates to the Transient Accommodations Tax and a proposed ground lease in Kihei.

budgettaxationwildfire-recoveryagriculturehousingpublic-safety
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Mar 4, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee to receive presentation on alternative economies and futures

The Efficiency Solutions and Circular Systems Committee will host a presentation titled “Alternative Economies and Alternative Futures.” Dr. Dean Saranillio from the University of Hawaiʻi at Mānoa will present on matters relating to systemic inequality. No legislative action will be taken during this meeting.

systemic-inequalityeconomymauipresentation
Online via Teams: http://tinyurl.com/47pphhp9 Phone testimony: 1-808-977-4067, code 728 915 689# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawaiʻi
Mon Mar 4, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee discusses parking enforcement expansion and Purdue University agreement

The Committee will consider expanding the Volunteer Disabled Parking Enforcement Pilot Program to all parking laws. Members will also review an agreement with Purdue University involving a $20,000 commitment for water research.

parkingwatergovernment-agreementsresearch
Online via Teams: http://tinyurl.com/24u2f5nn Phone testimony: 1-808-977-4067, code 748 265 393# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Feb 28, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council discusses budget amendments and infrastructure projects

The Council is reviewing several budget amendments involving various departments and community improvements. Discussions include funding for parks, water authorities, and transportation facilities across multiple islands.

budgetparksinfrastructuregovernmentzoning
Tue Feb 27, 2024 · 10:30 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discussion on County wildfire recovery and financial plan

The Budget, Finance, and Economic Development Committee will discuss matters related to the County wildfire recovery and financial plan. The Managing Director may provide a presentation regarding this plan. No legislative action will be taken during this meeting.

wildfirerecoveryfinancebudgetmaui
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 27, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee discusses legal compensation for wildfire and litigation matters

The Committee is considering several resolutions to authorize additional compensation for special counsel. These include legal representation for wildfire-related litigation and various other civil cases.

legalwildfireslitigationcompensationgovernment-relations
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 27, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee to discuss Maui wildfire impacts on the county economy

The Budget, Finance, and Economic Development Committee will discuss matters relating to Maui wildfire impacts and economic forecasts. The committee may receive a presentation from Carl Bonham of UHERO regarding these reports. No legislative action will be taken during this meeting.

wildfireeconomybudgetfinanceuhero
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Feb 26, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers $10 million grant for Hale Pilina affordable housing project

The committee will consider budget amendments for the Hale Pilina and Aikanaha affordable housing projects. Members will also discuss proposed funding for wildfire survivor interim housing and security services in West Maui. No legislative action is scheduled for the discussion items.

housingbudgetwildfire recoverypublic safetyaffordable housing
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Feb 22, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee reviews budgets for Public Works and Environmental Management

The Water and Infrastructure Committee will conduct operational and budgetary reviews of the Department of Public Works and the Department of Environmental Management. The committee may receive status updates regarding the Fiscal Year 2024 Budget. No legislative action will be taken during this meeting.

budgetpublic-worksenvironmental-managementgovernment-operations
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Feb 22, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee reviews budgets for agriculture, environment, and transportation

The Committee will conduct operational and budgetary reviews for several county departments. No legislative action will be taken during this meeting.

agricultureenvironmenttransportationbudgetgovernment-operations
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Feb 21, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Presentations on alternative 2023 wildfire debris processing solutions

The committee may receive presentations regarding various methods for processing 2023 wildfire debris. These options include pyrolysis, biochar, and landfill waste diversion. No legislative action will be taken during this meeting.

wildfiredebriswaste-managementdisaster-resilienceplanning
Online via Teams: http://tinyurl.com/y7xmx267 Phone testimony: 1-808-977-4067, code 585 709 254# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Feb 21, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses Molokai Education Center expansion and housing plans

The Committee will discuss a proposal to expand the University of Hawai‘i Community Colleges campus in Kaunakakai. Members may also receive a presentation regarding the use of preapproved architectural plans to expedite housing.

zoninghousingeducationmolokailand use
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 20, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Maui County committee reviews climate contracts and FY2024 environmental grants.

The Maui County ADEPT Committee will hold a discussion-only meeting on February 20, 2024. Members will review updates on climate action contracts and receive budgetary presentations for watershed protection and environmental protection grants in the Fiscal Year 2024 budget. These reviews track how county funds support local water conservation and environmental programs that affect community resources. No legislative votes or binding actions are scheduled.

climate-actionenvironmental-grantsbudget-reviewsustainabilitymaui-county-government
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 20, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Committee discusses wildfire impact study and human services partnerships

The Committee will discuss a partnership between University of Hawaiʻi Maui College and Kealahoʻimai regarding substance abuse counseling certificates. Members will also receive a presentation on the Maui Wildfire Exposure Cohort Study (MauiWES) to address health and social impacts of the August 2023 wildfires. No legislative action will be taken during this meeting.

healthwildfireeducationhuman-servicesmaui
Online via Teams: http://tinyurl.com/24u2f5nn Phone testimony: 1-808-977-4067, code 748 265 393# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Fri Feb 16, 2024 · 2:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Discussion of nomination procedures for Maui County boards and commissions

The Committee will discuss procedures for nominations to various boards, committees, and commissions under the Revised Charter of the County of Maui. This includes processes for filling vacancies for members whose terms expire on March 31, 2024. No legislative action will be taken during this meeting.

governmentnominationsboardscommitteesmaui-county
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Fri Feb 16, 2024 · 9:00 AM

Council of the County of Maui

Maui County Council considers major budget amendments and rezoning requests

The council will review several ordinances to amend the Fiscal Year 2024 budget, including significant funding increases for emergency management and affordable housing projects. The agenda also includes requests to change zoning for industrial parks on Lanai and in Kihei. Additionally, the council will consider a settlement with Maui Electric Company.

budgetzoninghousingemergency-managementpublic-safetyland-use
Thu Feb 8, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee to review climate action plans and environmental protection grants

The ADEPT Committee will discuss updates on the Climate Action and Resiliency Plan and related sustainability contracts. The committee will also conduct a budgetary review of watershed protection and environmental protection grants for the Fiscal Year 2024 Budget. No legislative action is scheduled for this meeting.

climateenvironmentbudgetwatergrants
Online via Teams: http://tinyurl.com/mpehu7v8 Phone testimony: 1-808-977-4067, code 279 553 693# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Thu Feb 8, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee discusses infrastructure needs and emergency building permit changes

The Committee will receive comments regarding public infrastructure improvements within the 2023 West Maui wildfire burn areas. Members may also consider Bill 21 (2024), which aims to expedite emergency repair permits for housing, businesses, and public facilities in Lahaina and Upcountry.

wildfireinfrastructurezoningbuilding-codeslahaina
Online via Teams: http://tinyurl.com/t8fzkhzc Phone testimony: 1-808-977-4067, code 702 597 086# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Feb 7, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses workforce housing, fair housing choice, and homeowner assistance

The Housing and Land Use Committee will receive a presentation on the Aikanaha multifamily workforce housing project in Waikapū. Members will also discuss impediments to fair housing choice regarding Bill 15 (2024) and receive an update on the Homeowner Assistance Fund Program.

housingworkforce housingfair housinghomeowner assistancegovernment agreements
Online via Teams: http://tinyurl.com/3667hx3h Phone testimony: 1-808-977-4067, code 461 899 61# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Wed Feb 7, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee to discuss public infrastructure and emergency egress routes

The DRIP Committee intends to discuss matters related to public infrastructure and emergency egress routes. The committee may receive presentations, but no legislative action will be taken at this meeting.

infrastructureemergency-routesplanningmaui-county
Online via Teams: http://tinyurl.com/y7xmx267 Phone testimony: 1-808-977-4067, code 585 709 254# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 6, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui committee reviews FY2024 budget amendments for parks, roads, and housing grants.

The Maui County Budget, Finance, and Economic Development Committee will review several first-read bills amending the Fiscal Year 2024 budget. These amendments allocate funding for capital improvements including a Kihei community center, a Lānaʻi youth center, a Pāʻia parking lot, and a Wailuku-Kahului transportation baseyard. The committee will also consider grants for affordable housing infrastructure, economic development, and broadband planning outreach. No final votes are expected at this stage; the committee may recommend passage or file the bills.

budgetcapital-improvementsaffordable-housingparks-and-recreationtransportationbroadbandgrants
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Tue Feb 6, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Committee considers $10 million settlement for 2023 wildfire claims

The committee is reviewing appointments for the Planning Director and the Independent Nomination Board. Members will also consider authorizing $10,000,000 in settlements for 2023 wildfire claims involving death or serious bodily injury.

wildfiresettlementsappointmentsplanninggovernment
Online via Teams: http://tinyurl.com/2s9hsuhk Phone testimony: 1-808-977-4067, code 423 765 169# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Feb 5, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Maui Committee reviews budget amendments for housing and community infrastructure

The committee is considering several bills to amend the Fiscal Year 2024 budget. Proposed changes include funding for affordable housing, park improvements, and transportation facilities. Members will also discuss a $500,000 grant to Hone Heke Corporation.

budgethousingparkstransportationeconomic-development
Online via Teams: http://tinyurl.com/yzxbuphm Phone testimony: 1-808-977-4067, code 420 614 452# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawai‘i
Mon Feb 5, 2024 · 1:30 PM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee discusses community self-reliance and personnel services updates

The Committee will discuss workforce development and job creation programs following the 2023 fires on Maui Island. It will also receive an update regarding Department of Personnel Services operations and hiring processes.

workforcegovernment-operationsmaui-firespersonnel
Online via Teams: http://tinyurl.com/47pphhp9 Phone testimony: 1-808-977-4067, code 728 915 689# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawaiʻi
Fri Jan 26, 2024 · 9:00 AM

Council of the County of Maui

Maui Council to discuss $10 million budget amendment and police grievance settlement

The Maui County Council is reviewing several budget amendments, including a $10 million increase for insurance programs and a police department grievance settlement. The agenda also includes discussions on land transfers for sewerage infrastructure and various permit extensions for special events.

budgetpoliceinfrastructurezoningpermits
Thu Jan 25, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Committee discusses Iao Stream flood design and wildfire permitting updates

The Committee will consider Bill 1 (2024) regarding a design agreement with the U.S. Army for the Iao Stream Flood Control Project. Additionally, the Committee intends to receive comments from the Office of Recovery regarding expedited permitting processes for properties in wildfire-affected areas.

flood-riskwildfirepermittinginfrastructurewater
Online via BlueJeans: https://bluejeans.com/479055686 Phone testimony: 1-408-915-6290, code 479 055 686 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Thu Jan 25, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee discusses stormwater runoff and Department of Agriculture strategic plan

The Committee will receive presentations regarding the prevention and management of contaminated stormwater runoff in Maui County. Members will also discuss the Department of Agriculture’s Draft Strategic Plan for 2024-2028. No legislative action will be taken during this meeting.

agricultureenvironmentstormwaterstrategic-plan
Online via BlueJeans: https://bluejeans.com/803243398 Phone testimony: 1-408-915-6290, code 803 243 398 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Wed Jan 24, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee considers changes to workforce housing deed restrictions

The Housing and Land Use Committee will review two bills regarding residential workforce housing. Bill 12 proposes lengthening the time periods for deed restrictions, while Bill 74 proposes restarting the restriction period when a unit is sold. The committee may decide to recommend passage or file these bills.

housingworkforce-housingland-usedeed-restrictions
Online via BlueJeans: https://bluejeans.com/834693029 Phone testimony: 1-408-915-6290, code 834 693 029 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Wed Jan 24, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee discusses alternative wildfire debris processing solutions

The Committee may receive a presentation regarding alternative methods for processing 2023 wildfire debris. The session includes potential discussion on related matters, but no legislative action will be taken.

wildfiredebris-processingdisaster-resilience
Online via BlueJeans: https://bluejeans.com/947335931 Phone testimony: 1-408-915-6290, code 947 335 931 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Tue Jan 23, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee considers stadium rehabilitation and housing project funding

The committee will review several budget amendments, including a $3.6 million project for the War Memorial Stadium and track. Members will also consider a grant for Kilohana Makai infrastructure and changes to General Excise Tax fund transfers. Additionally, the committee may discuss new fees for fire permit inspections.

budgethousingparksfinancetaxationinfrastructure
Online via BlueJeans: https://bluejeans.com/654512036 Phone testimony: 1-408-915-6290, code 654 512 036 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Tue Jan 23, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

The committee will consider the appointment of Kate Blystone as Planning Director

The Committee is reviewing Resolution 24-10 to approve Kate Blystone as the Planning Director. Members may recommend adopting the resolution with or without revisions. The Council must act on this appointment by March 25, 2024.

appointmentsplanninggovernmentpersonnel
Online via Teams: http://tinyurl.com/yc7f2jkp Phone testimony: 1-808-977-4067, code 546 394 817# In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Flr., 200 South High St., Wailuku, Hawaiʻi
Mon Jan 22, 2024 · 9:00 AM

Water Authority, Social Services, and Parks Committee (2023-2025)

Discussion of long-term strategic plan for County parks and recreation facilities

The Committee will discuss plans and permitting for County parks and recreation facilities. This includes reviewing the Department of Parks and Recreation’s long-term strategic plan, specifically regarding Lahaina parks following the August 2023 fires. No legislative action will be taken during this meeting.

parksrecreationlahainaplanningpermittingmaintenance
Online via BlueJeans: https://bluejeans.com/122158206 Phone testimony: 1-408-915-6290, code 122 158 206 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Fri Jan 12, 2024 · 9:00 AM

Council of the County of Maui

Maui Council reviews $100,000 grants for workforce housing units

The Maui County Council is reviewing several ordinances, including updates on rebuilding residential units impacted by the Maui wildfires. The agenda also includes budget amendments for fire and public safety and a new lease for the Maui Bus Transit Hub.

housingbudgetwildfiretransitpublic-safety
Thu Jan 11, 2024 · 9:00 AM

Water and Infrastructure Committee (2023-2025)

Maui committee considers a proposed bill on permanent shipping container storage.

At its January 11, 2024 meeting, the Maui County Water and Infrastructure Committee will discuss Resolution 23-237, which proposes allowing permanent shipping container storage on private property. The committee may recommend adopting or filing this resolution for further review by island planning commissions. Members will also hear presentations from five county departments on ways to reduce permit processing times across Maui County, which affects how long residents and businesses wait for approvals. No legislative action is scheduled for the permitting discussion.

zoningpermittinginfrastructureshipping-containerscounty-governmentpublic-hearing
Online via BlueJeans: https://bluejeans.com/479055686 Phone testimony: 1-408-915-6290, code 479 055 686 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Thu Jan 11, 2024 · 1:30 PM

Agriculture, Diversification, Environment, and Public Transportation Committee

Committee discusses soil remediation for August 2023 wildfire debris

The committee will receive presentations regarding soil stabilization and remediation to address toxic debris and ash from the August 2023 Maui wildfires. Members will also discuss contaminated stormwater runoff management and prevention. No legislative action will be taken at this meeting.

wildfiresenvironmentsoilwatermaui
Online via BlueJeans: https://bluejeans.com/803243398 Phone testimony: 1-408-915-6290, code 803 243 398 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Wed Jan 10, 2024 · 1:30 PM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Presentation on alternative 2023 wildfire debris processing solutions

The committee may receive a presentation regarding alternative solutions for processing 2023 wildfire debris. Brittany Zimmerman, CEO of Yummet Hawai ʻi LLC, is scheduled to present. No legislative action will be taken during this meeting.

wildfiredebrisplanningmaui
Online via BlueJeans: https://bluejeans.com/947335931 Phone testimony: 1-408-915-6290, code 947 335 931 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Wed Jan 10, 2024 · 9:00 AM

Housing and Land Use Committee (2023-2025)

Committee discusses Hale Pilina housing and a conditional permit for Makena events

The Committee will receive a presentation regarding the status of the Hale Pilina Family Affordable Rental Housing Project. Members may also consider Bill 80 (2023) to grant Carolee Higashino a conditional permit for small scale special events in Makena.

housingzoningresidentialmakenakihei
Online via BlueJeans: https://bluejeans.com/834693029 Phone testimony: 1-408-915-6290, code 834 693 029 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Tue Jan 9, 2024 · 9:00 AM

Budget, Finance, and Economic Development Committee (2023-2025)

Committee discusses budget amendments and police settlement authorization

The Committee will discuss fiscal year 2024 revenue shortfalls following the August 2023 wildfires. Members may also consider a police officer class grievance settlement, a $10 million budget increase for countywide costs, and an $11,000 appropriation for the Department of Police.

budgetpolicefinancewildfiresgovernment-operations
Online via BlueJeans: https://bluejeans.com/654512036 Phone testimony: 1-408-915-6290, code 654 512 036 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Tue Jan 9, 2024 · 1:30 PM

Government Relations, Ethics, and Transparency Committee (2023-2025)

Maui committee reviews board appointments and charter corrections

The Committee will consider Resolution 24-1 to approve or disapprove several nominees for the Independent Nomination Board. The Committee may also review Bill 132 (2023), which authorizes the County Clerk to correct errors and remove inoperative provisions in the County Charter.

appointmentschartergovernmentmaui-countynominations
Online via BlueJeans: https://bluejeans.com/513107325 Phone testimony: 1-408-915-6290, code 513 107 325 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Mon Jan 8, 2024 · 9:00 AM

Efficiency Solutions and Circular Systems Committee (2023-2025)

Committee discusses circular water systems for Lahaina recovery

The Committee will discuss potential circular water systems for use in Lahaina following the August 2023 wildfires. Discussions may include atmospheric drinking, residential water generation, graywater reuse, and alternative toilet technologies. No legislative action will be taken during this meeting.

waterlahainawildfire-recoveryinfrastructure
Online via BlueJeans: https://bluejeans.com/109991130 Phone testimony: 1-408-915-6290, code 109 991 130 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Mon Jan 8, 2024 · 1:30 PM

Water Authority, Social Services, and Parks Committee (2023-2025)

Discussion of Lahaina resiliency hubs at Pohaku Park and Honokōwai Beach Park

The committee will discuss updates and long-term goals for the Lahaina resiliency hubs at Pohaku Park (S-Turns) and Honokōwai Beach Park. Representatives from the Department of Parks and Recreation and the Office of Recovery may provide comments. No legislative action is scheduled for this meeting.

lahainaparksrecoveryinfrastructure
Online via BlueJeans: https://bluejeans.com/122158206 Phone testimony: 1-408-915-6290, code 122 158 206 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Thu Jan 4, 2024 · 9:00 AM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Committee discusses August 2023 Maui wildfires debris disposal sites

The Committee will discuss temporary and final debris disposal sites following the August 2023 wildfires. Discussions may include differences between the two sites and the process for moving debris from the temporary location to the final site. No legislative action will be taken during this meeting.

wildfiresdebris-disposaldisaster-recoverymaui
Online via BlueJeans: https://bluejeans.com/947335931 Phone testimony: 1-408-915-6290, code 947 335 931 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii
Tue Jan 2, 2024 · 9:00 AM

Disaster, Resilience, International Affairs, and Planning Committee (2023-2025)

Discussion of Maui wildfire debris disposal sites and transport plans

The committee will discuss the temporary and final debris disposal sites following the August 2023 Maui wildfires. The discussion includes differences between the two sites and how debris will be moved from the temporary site to the final site. No legislative action will be taken during this meeting.

wildfiredebris-disposaldisaster-recoveryplanningmaui
Online via BlueJeans: https://bluejeans.com/947335931 Phone testimony: 1-408-915-6290, code 947 335 931 In-person testimony and viewing: Council Chamber, Kalana O Maui Building, 8th Floor, 200 South High Street, Wailuku, Hawaii