The Boring PartsFederalLocal · USLocal · Canada
New York, NY

New York public meetings in 2025

676 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Wed Dec 31, 2025 · Deferred

Committee on Health

Council committee to vote on banning rodeo practices

The Committee on Health will meet to consider a local law that would prohibit calf roping and the use of electric prods and flank straps in rodeos. The meeting is scheduled for December 31, 2025, at 10:00 AM.

healthrodeoanimal-welfarecouncillegislation
250 Broadway - 8th Floor - Hearing Room 1
Fri Dec 19, 2025 · Deferred

Committee on Civil Service and Labor

Council to consider law correcting pay differentials for paraprofessionals

The Committee on Civil Service and Labor will meet to discuss Int 1261-2025, a local law intended to correct excess pay differentials for paraprofessionals resulting from pattern bargaining practices. The meeting is scheduled for Friday, December 19, 2025, at 10:00 AM in Council Chambers at City Hall.

councillaborcivil-serviceparaprofessionalspay-differentialsint-1261-2025
Council Chambers - City Hall
Thu Dec 18, 2025 · 10:00 AM

Committee on Criminal Justice

Committee will consider a resolution urging the Governor to sign the Prison Reform Bill

The Committee on Criminal Justice will consider Resolution 0734-2025. The resolution calls on the New York State Governor to sign S.8415/A.8871, known as the Prison Reform Omnibus Bill. The committee will vote on whether to adopt the resolution.

criminal-justiceprison-reformlegislationcity-councilresolution
✓ Decided: Criminal Justice Committee approves Resolution 0734-2025-A

The Committee on Criminal Justice voted to approve the amended Resolution 0734-2025-A. All seven members present voted affirmatively. One member was absent and one was on medical leave.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0734-2025 — Approved by Committee
7 yea · 1 medical · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif medical · Christopher Marte yea · Mercedes Narcisse absent · Lincoln Restler yea · Althea V. Stevens yea
Thu Dec 18, 2025 · 10:15 AM

Committee on General Welfare

Committee to consider local law requiring web forms for social services benefits

The Committee on General Welfare will consider Int. No. 1366‑A, a proposed local law to amend the city’s administrative code. The bill would require the Department of Social Services to create web‑based application forms for benefits and services. The committee will discuss and vote on the proposal.

social-servicestechnologywelfarelegislation
✓ Decided: Committee on General Welfare approves Introduction 1366-2025-A

The Committee on General Welfare approved Introduction No. 1366-2025-A. All nine council members present voted in favor. No opposition or abstentions were recorded.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1366-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Thu Dec 18, 2025 · 10:15 AM

Committee on Public Safety

Committee on Public Safety to discuss NYPD DNA and reporting laws

The Committee on Public Safety is reviewing four proposed local laws concerning police department procedures. These include rules on DNA collection from minors and access to body-worn camera footage.

policepublic-safetycivil-libertiesoversight
✓ Decided: Public Safety Committee approves four introductions on Dec 18, 2025

The Committee on Public Safety approved four introductions (Int 0125-2024, Int 1237-2025, Int 1451-2025, Int 1460-2025). Votes were 9‑0 for Int 0125-2024, 8‑0‑1 (abstain) for Int 1237-2025, 8‑1 for Int 1451-2025, and 9‑0 for Int 1460-2025. All motions passed by roll call.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 1451-2025 — Approved by Committee
8 yea · 1 nay
Yusef Salaam yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden nay · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé yea · Althea V. Stevens yea
The other 3 items passed by unanimous or near-unanimous consent.
Thu Dec 18, 2025 · 10:30 AM

Committee on Immigration

Committee to discuss redefining immigration enforcement terms and facility use

The Committee on Immigration will meet to discuss Int 1412-2025. This proposed local law seeks to redefine immigration enforcement terms and prohibit federal immigration authorities from maintaining offices on Department of Correction property.

immigrationdepartment-of-correctionfederal-authoritiescity-administrative-code
✓ Decided: Committee on Immigration approves Introduction No. 1412-2025-A

The Committee on Immigration met on December 18, 2025. Members Avilés, Bottcher, Brewer, De La Rosa, Hanif and Joseph were present; Krishnan was absent. The committee voted to approve Introduction No. 1412‑2025‑A by roll call. The motion passed with six affirmative votes and one member absent.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1412-2025 — Approved by Committee
6 yea · 1 absent
Alexa Avilés yea · Erik D. Bottcher yea · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan absent
Thu Dec 18, 2025 · 11:45 AM

Committee on Environmental Protection, Resiliency and Waterfronts

Council to inspect and clean city catch basins

The Committee on Environmental Protection, Resiliency and Waterfronts will consider a local law requiring the inspection and cleanup of catch basins and the reporting of maintenance activities. The committee will also vote on a resolution supporting the Climate Museum.

waterinfrastructureclimatemuseumenvironment
✓ Decided: Committee approves catch‑basin cleanup law and Climate Museum resolution

The Committee on Environmental Protection, Resiliency and Waterfronts approved Introduction Int 0403-2024-A, a local law amending the city code on catch‑basin inspection and cleanup, by roll‑call vote of 7 affirmative members with 2 absent. The Committee also approved Resolution 0082-2024-A supporting the mission and growth of the Climate Museum, by the same 7‑0 vote with 2 members absent. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0403-2024 — Approved by Committee
7 yea · 2 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang absent
Res 0082-2024 — Approved by Committee
7 yea · 2 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang absent
Thu Dec 18, 2025 · 11:45 AM

Committee on Fire and Emergency Management

Proposal for a program to collect and dispose of PFAS‑containing fire‑fighter gear

The Committee on Fire and Emergency Management will consider four proposed local laws. Two bills would require annual reporting on fire department vehicles and equipment and on emergency medical services units. Two other bills would address fire‑fighter personal protective equipment that contains per‑ and poly‑fluoroalkyl substances, including notice to personnel and a program for collection, exchange, and disposal. All items are listed as proposed legislation (Int. Nos. 1140‑A, 1229‑A, 1452‑A, and 1453‑A).

fire-safetyemergency-medicalequipmentreportingpfaslegislation
✓ Decided: Committee approves four fire‑related local law introductions

The Committee on Fire and Emergency Management approved four introductions to local law: Int 1140‑2024‑A on fire department vehicle reporting, Int 1229‑2025‑A on EMS unit reporting, Int 1452‑2025‑A on protective‑equipment PFAS notice, and Int 1453‑2025‑A on PFAS equipment collection. Each motion passed by roll call with six members voting affirmative and two members absent.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 1140-2024 — Approved by Committee
6 yea · 2 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Simcha Felder absent · Oswald J. Feliz yea · James F. Gennaro yea · Kevin C. Riley yea · Lynn C. Schulman yea · Susan Zhuang absent
Int 1229-2025 — Approved by Committee
6 yea · 2 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Simcha Felder absent · Oswald J. Feliz yea · James F. Gennaro yea · Kevin C. Riley yea · Lynn C. Schulman yea · Susan Zhuang absent
Int 1452-2025 — Approved by Committee
6 yea · 2 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Simcha Felder absent · Oswald J. Feliz yea · James F. Gennaro yea · Kevin C. Riley yea · Lynn C. Schulman yea · Susan Zhuang absent
Int 1453-2025 — Approved by Committee
6 yea · 2 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Simcha Felder absent · Oswald J. Feliz yea · James F. Gennaro yea · Kevin C. Riley yea · Lynn C. Schulman yea · Susan Zhuang absent
Thu Dec 18, 2025 · 9:15 AM

Committee on Standards and Ethics

Standards and Ethics Committee meeting with no agenda items listed

The New York City Council Committee on Standards and Ethics will meet on Thursday, December 18, 2025 at 9:15 AM in Hearing Room 3, 250 Broadway, 8th Floor. The meeting is called pursuant to Council Rule 10.60. No specific agenda items, proposals, or decisions are listed in the agenda.

ethicscouncilgovernance
✓ Decided: Committee on Standards and Ethics held an oversight hearing, no actions taken

The Committee on Standards and Ethics met on December 18, 2025 at City Hall. Members Ung, Ayala, Carr, Dinowitz, and Hudson were present. The committee held and filed an oversight hearing (T2025-4649). No substantive decisions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 3 *
Thu Dec 18, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Organizations

Council urges Congress to fund and move the historic SS United States to NYC

The committee will consider two resolutions. The first asks the U.S. Congress and the President to approve legislation that would allocate funds for restoring the historic ocean liner SS United States and relocating it to New York City. The second is a celebratory resolution honoring the New York Knicks' victory in the 2025 Emirates NBA Cup Championship.

culturehistoric-preservationsportslegislation
✓ Decided: Committee approves two resolutions, including amended Res 0649‑2024‑A

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations voted to approve the amended Resolution 0649‑2024‑A. The committee also approved Resolution 1194‑2025 as a P‑C item. Both approvals were recorded by roll‑call vote.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0649-2024 — Approved by Committee
6 yea · 2 absent · 1 medical
Erik D. Bottcher yea · David M. Carr yea · Shahana K. Hanif medical · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis absent · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams yea
Res 1194-2025 — P-C Item Approved by Comm
6 yea · 2 absent · 1 medical
Erik D. Bottcher yea · David M. Carr yea · Shahana K. Hanif medical · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis absent · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams yea
Thu Dec 18, 2025 · 10:00 AM

Committee on Education

Education Committee to review laws on student internet access and school food waste

The Committee on Education is meeting to discuss several proposed local laws and one resolution. The items focus on Department of Education reporting requirements and youth program outreach.

educationinternet-accessfood-wastestudent-reportingyouth-programs
✓ Decided: Education Committee approves five items, including Resolution 0842‑2025

The NYC Council Committee on Education approved four introductions (Int 0142‑2024‑A, Int 0987‑2024‑A, Int 1359‑2025‑A, Int 1360‑2025‑A) and Resolution 0842‑2025. Each motion passed with seven members voting affirmative, five absent, and one member recorded as medical. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0142-2024 — Approved by Committee
7 yea · 5 absent · 1 medical
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Shekar Krishnan absent · Linda Lee yea · Farah N. Louis absent · Mercedes Narcisse absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Int 0987-2024 — Approved by Committee
7 yea · 5 absent · 1 medical
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Shekar Krishnan absent · Linda Lee yea · Farah N. Louis absent · Mercedes Narcisse absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Int 1359-2025 — Approved by Committee
7 yea · 5 absent · 1 medical
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Shekar Krishnan absent · Linda Lee yea · Farah N. Louis absent · Mercedes Narcisse absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Int 1360-2025 — Approved by Committee
7 yea · 5 absent · 1 medical
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Shekar Krishnan absent · Linda Lee yea · Farah N. Louis absent · Mercedes Narcisse absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Res 0842-2025 — Approved by Committee
7 yea · 5 absent · 1 medical
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Shekar Krishnan absent · Linda Lee yea · Farah N. Louis absent · Mercedes Narcisse absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Thu Dec 18, 2025 · 10:15 AM

Committee on Higher Education

Committee considers resolution for New York State College Safety Act

The Committee on Higher Education is reviewing Resolution 0500-2024. This resolution calls on the New York State Legislature and Governor to pass legislation requiring SUNY and CUNY campuses to permit remote instruction for autoimmune and immunocompromised students and faculty.

higher-educationhealthremote-learningsunycuny
✓ Decided: Committee on Higher Education approves Resolution 0500-2024

The Committee on Higher Education voted to approve Resolution 0500-2024. All five committee members—Dinowitz, Bottcher, Brewer, Feliz, and Marte—cast affirmative votes. The resolution was recorded as approved by the committee.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0500-2024 — Approved by Committee
5 yea
Eric Dinowitz yea · Erik D. Bottcher yea · Gale A. Brewer yea · Oswald J. Feliz yea · Christopher Marte yea
Thu Dec 18, 2025 · 10:30 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee considers tax exemption for 2149-2153 Pacific Street

The Subcommittee on Landmarks, Public Sitings and Dispositions will review an application from the Department of Housing Preservation and Development. The body is considering a real property tax exemption for a site in Brooklyn.

tax-exemptionhousingbrooklynhpd
✓ Decided: Subcommittee approves land use application with 4‑1 vote

The Subcommittee on Landmarks, Public Sitings and Dispositions approved a land use application. The vote was four affirmative, one negative, one abstention, and one member was absent. Chair Hanks was absent; members Brannan, Farías, Feliz, and Nurse voted yes; Marte voted no; Salaam abstained.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
LU 0414-2025 — Approved by Subcommittee
4 yea · 1 absent · 1 nay · 1 abstain
Kamillah Hanks absent · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte nay · Sandy Nurse yea · Yusef Salaam abstain
Thu Dec 18, 2025 · 10:30 AM

Committee on Civil Service and Labor

Council to consider community hiring standards for city‑assisted housing projects

The Committee on Civil Service and Labor will consider two proposed local laws. The first would amend the city’s administrative code to establish community hiring and compensation standards for city‑assisted housing development projects. The second would direct a study and publish a report on the impacts of algorithmic and automated employment decision tools on city employees.

housinglaborhiringalgorithmic-toolsstudycivil-service
✓ Decided: Committee approves two introductions, 910‑B and 1066‑A, by 9‑1 vote

The Civil Service and Labor Committee approved Introduction No. 910‑B and Introduction No. 1066‑A. Both motions passed with nine votes in favor and one member absent (Councilmember Hanks). No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0910-2024 — Approved by Committee
9 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks absent · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Yusef Salaam yea
Int 1066-2024 — Approved by Committee
9 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks absent · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Yusef Salaam yea
Thu Dec 18, 2025 · 10:45 AM

Committee on Transportation and Infrastructure

Committee will consider a pilot program for parking for‑hire vehicles.

The Transportation and Infrastructure Committee will consider four proposed local laws. One addresses the wrongful deactivation of high‑volume for‑hire vehicle drivers. Another creates a pilot program for parking for‑hire vehicles. The remaining two focus on planting vegetation on bicycle‑lane medians and studying the commuter van industry.

transportationfor-hire-vehiclesparkingbike-infrastructurecommuter-vanlegislation
✓ Decided: Committee approved four transportation introductions, including Int 0276-2024

The Transportation and Infrastructure Committee voted to approve four introductions: Int 0276-2024 (6‑2), Int 1000-2024 (7‑1), Int 1233-2025 (7‑1), and Int 1346-2025 (8‑0). All motions were adopted by roll call. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
Int 0276-2024 — Approved by Committee
6 yea · 2 nay
Selvena N. Brooks-Powers yea · Joann Ariola nay · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías nay · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won yea
Int 1000-2024 — Approved by Committee
7 yea · 1 nay
Selvena N. Brooks-Powers yea · Joann Ariola nay · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won yea
Int 1233-2025 — Approved by Committee
7 yea · 1 nay
Selvena N. Brooks-Powers yea · Joann Ariola nay · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won yea
The other 1 item passed by unanimous or near-unanimous consent.
Thu Dec 18, 2025 · 10:45 AM

Committee on Consumer and Worker Protection

Committee considers new laws for street vendors and delivery workers

The Committee on Consumer and Worker Protection is reviewing several proposed laws regarding vendor licensing and worker protections. The meeting includes discussions on street vendor assistance and compensation standards for security guards.

street-vendorsworker-protectionslicensingdelivery-workerssecurity-guardsai-regulation
✓ Decided: Committee approved five rule‑making introductions

The Consumer and Worker Protection Committee approved five introductions that require agency rule‑making. Each introduction—Int 0408‑2024, Int 0431‑2024, Int 1251‑2025, Int 1332‑2025, and Int 1391‑2025—was approved by roll call with all six members voting affirmative. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
Int 0408-2024 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 0431-2024 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1251-2025 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1332-2025 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1391-2025 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Res 0499-2024 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Thu Dec 18, 2025 · 10:45 AM

Subcommittee on Zoning and Franchises

Subcommittee considers franchises for public communications and street furniture

The Subcommittee on Zoning and Franchises is reviewing two resolutions regarding citywide infrastructure. The body will discuss extending a franchise for public communications structures and authorizing a coordinated street furniture franchise.

franchisesinfrastructuretelecommunicationsstreet-furnituredot
✓ Decided: Subcommittee approves two franchise extensions for city agencies

The Subcommittee on Zoning and Franchises approved Resolution 1109-2025, authorizing the Department of Information Technology & Telecommunications to extend its public communications franchise. It also approved Resolution 1157-2025, authorizing the Department of Transportation to enter a coordinated street‑furniture franchise. Both motions passed by roll‑call with six members voting affirmative and one member absent.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 1109-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Res 1157-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Dec 18, 2025 · 11:00 AM

Committee on Governmental Operations, State & Federal Legislation

Local law would require borough presidents to train community board members on equal employment.

The Committee on Governmental Operations will consider Int. No. 472‑A, a local law amendment to the city’s administrative code. The proposal would require each borough president to provide equal‑employment‑opportunity training for members of community boards. The committee will discuss and vote on the measure during the meeting.

employmenttrainingcommunity-boardsborough-presidentslocal-law
✓ Decided: Committee approves Introduction Int 0472-2024-A

The Committee on Governmental Operations, State & Federal Legislation voted to approve Introduction Int 0472-2024-A. The motion passed with eight affirmative votes and one negative vote. No other actions were taken during the meeting.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0472-2024 — Approved by Committee
8 yea · 1 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Frank Morano nay · Lynn C. Schulman yea · Inna Vernikov yea
Thu Dec 18, 2025 · 11:00 AM

Committee on Contracts

Two proposed local laws on contract conflicts and labor disclosures

The Committee on Contracts will consider two proposed local laws that would amend the New York City administrative code. One law (Int. 0479-2024) addresses standards and procedures for identifying conflicts of interest and misconduct in city contracts. The other law (Int. 1401-2025) deals with voluntary labor and human‑rights disclosures in city procurement.

contractsconflicts-of-interestlabor-rightsprocurementlocal-law
✓ Decided: Committee on Contracts approved two introductions, one unanimously

The Committee on Contracts approved Introduction 0479-2024-A with a unanimous 5‑0 vote. It also approved Introduction 1401-2025-A with a 4‑1 vote, the lone dissent from Councilmember Vernikov.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 1401-2025 — Approved by Committee
4 yea · 1 nay
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov nay
The other 1 item passed by unanimous or near-unanimous consent.
Thu Dec 18, 2025 · 11:00 AM

Committee on Land Use

Committee on Land Use to review affordable housing and citywide franchise agreements

The Committee on Land Use is discussing several proposed local laws regarding affordable homeownership and rental unit requirements for city-assisted projects. The body is also considering resolutions for public communications and street furniture franchises, as well as a specific tax exemption for a property in Brooklyn.

affordable-housingzoningtax-exemptioncity-franchisesland-use
✓ Decided: Committee approves multiple introductions and two resolutions

The Land Use Committee approved Introduction 0958‑2024‑A and Introduction 1433‑2025‑A unanimously (10‑0). Introduction 1443‑2025‑A was approved by a 9‑1 vote. Resolutions 1109‑2025 and 1157‑2025 were each approved unanimously (10‑0). No other substantive actions were recorded.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
Int 1443-2025 — Approved by Committee
9 yea · 1 nay · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola nay · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0414-2025 — Approved by Committee with Companion Resolution
8 yea · 1 nay · 1 abstain · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola nay · Diana I. Ayala yea · Selvena N. Brooks-Powers abstain · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
The other 4 items passed by unanimous or near-unanimous consent.
Thu Dec 18, 2025 · 1:30 PM

City Council Stated Meeting

Council to appropriate $512.1 million in new city revenues for FY 2026

The New York City Council will consider a resolution to appropriate $512.1 million of new city revenues for fiscal year 2026. The meeting also includes a series of local law proposals covering community hiring standards for city‑assisted housing, an AI impacts task force for civil service, expanded licensing for mobile vendors, and the creation of a land bank. Additional items address the sale, transfer, and reporting of tax liens and several property‑tax exemption resolutions.

financebudgethousingtax-liensailand-banksmall-business
✓ Decided: Council approves eight local law introductions on housing hiring, algorithms, and vendors

The City Council approved eight local law introductions covering community hiring standards for city‑assisted housing projects, a study on algorithmic employment tools, support for street vendors, mobile‑food licensing, delivery worker protections, security guard compensation, and contract conflict‑of‑interest rules. All measures passed by roll call with vote totals ranging from 39‑9 to 47‑1. No other substantive actions were taken.

Council Chambers - City Hall
Thu Dec 18, 2025 · 11:30 AM

Committee on Finance

Committee on Finance to consider $512.1 million in new City revenues

The Committee on Finance is meeting to discuss several land use applications and legislative proposals. The body will review the appropriation of new revenues for Fiscal Year 2026 and various laws regarding tax liens and land banks.

budgettax-liensland-usezoningfinance
✓ Decided: Finance Committee approved Introduction 1411‑2025‑A by 15‑0 vote

The Committee on Finance approved Introduction 1411‑2025‑A with a unanimous 15‑0 vote. The same committee also approved Introductions 1419‑2025‑A and 1420‑2025‑A, each by a 15‑0 vote. Earlier items such as Introduction 0570‑2024‑B and 1407‑2025‑A were approved with 14‑1 votes.

250 Broadway - 8th Floor - Hearing Room 2 *
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Int 0570-2024 — Approved by Committee
14 yea · 1 nay · 1 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Int 1407-2025 — Approved by Committee
14 yea · 1 nay · 1 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Int 1420-2025 — Approved by Committee
14 yea · 1 nay · 1 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Res 1186-2025 — P-C Item Approved by Comm
14 yea · 1 nay · 1 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
The other 14 items passed by unanimous or near-unanimous consent.
Thu Dec 18, 2025 · 11:30 AM

Committee on Economic Development

Council proposes reduced-cost ferry service for middle school students

The Economic Development Committee will consider two proposed local laws. The first would amend the city’s administrative code to provide contracted ferry service at a reduced cost to middle school students. The second would amend the code to improve language accessibility for ferry service users. Both proposals are pending committee action.

transportationeducationferrylocal-lawaccessibility
✓ Decided: Committee on Economic Development approves Introductions 1121-2024-A and 1149-2024-A

The Committee approved Introduction 1121-2024-A and Introduction 1149-2024-A. All seven members—Farías, Avilés, Bottcher, Gutiérrez, Riley, Salamanca Jr., and Vernikov—voted affirmatively on each. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1121-2024 — Approved by Committee
7 yea
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov yea
Int 1149-2024 — Approved by Committee
7 yea
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov yea
Thu Dec 18, 2025 · 11:30 AM

Committee on Parks and Recreation

Committee will vote on a Local Law naming 77 streets and public places citywide.

The Parks and Recreation Committee will consider Local Law T2025-4612, which proposes naming 77 thoroughfares and public places across the five boroughs, including names such as Laura Friedman Way, Eddie Palmieri Way, and Argentina Way. The agenda also includes a proposal to repeal sections 5, 10, 103, and 104 of Local Law 121 (2025) and sections 16, 80, and 99 of Local Law 10 (2025). The committee will discuss and potentially adopt these measures at its December 18, 2025 meeting.

street-naminglocal-lawparks-recreationcity-council
✓ Decided: Committee approved the introduction as a P‑C Item

The Committee on Parks and Recreation voted to approve the introduction as a P‑C Item. The motion passed with five affirmative votes and three members absent. No other actions were taken during the meeting.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1501-2025 — P-C Item Approved by Comm
5 yea · 3 absent
Shekar Krishnan yea · David M. Carr absent · Robert F. Holden yea · Linda Lee yea · Julie Menin absent · Mercedes Narcisse absent · Vickie Paladino yea · Sandra Ung yea
Thu Dec 18, 2025 · 11:15 AM

Committee on Sanitation and Solid Waste Management

Council will consider a local law amendment on supplemental sanitation service rules.

The Committee on Sanitation and Solid Waste Management will consider Int. 1279-2025, a proposed amendment to the city’s administrative code. The amendment would modify the Department of Sanitation rule that governs supplemental sanitation service providers placing out refuse or recycling. The committee will vote on the proposed Int. 1279‑B.

sanitationwaste-managementlocal-lawcity-council
✓ Decided: Committee approves Local Law amendment for supplemental sanitation services

The Committee on Sanitation and Solid Waste Management approved Introduction 1279-2025-B, a Local Law amendment concerning supplemental sanitation service providers placing refuse or recycling. The motion passed by roll call with ten votes in favor and one vote against; two members were absent. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 1279-2025 — Approved by Committee
10 yea · 2 absent · 1 nay
Shaun Abreu yea · Chris Banks yea · David M. Carr yea · Simcha Felder yea · James F. Gennaro nay · Julie Menin absent · Frank Morano yea · Sandy Nurse yea · Vickie Paladino yea · Rafael Salamanca, Jr. yea · Sandra Ung yea · Inna Vernikov yea · Susan Zhuang absent
Thu Dec 18, 2025 · 11:15 AM

Committee on Housing and Buildings

Council committee to discuss affordable housing study for Wards Island

The Committee on Housing and Buildings is reviewing several proposed local laws. These include studies on housing feasibility, property purchase opportunities for qualified entities, and updates to city building and energy codes.

affordable-housingzoningbuilding-codesenergy-codeco-ops
✓ Decided: Committee approves four housing introductions, including affordable housing study

The Committee on Housing and Buildings approved four introductions. Int 0571-2024-A to study affordable housing on Ward's Island passed with all seven members voting affirmative. Int 0902-2024-B, granting qualified entities first opportunity to submit interest and purchase properties, passed with six affirmative votes and one abstention. Int 0994-2024-A, amending the code on cooling systems in tenant‑occupied dwellings, passed unanimously. Int 1120-2024-B, setting timelines for co‑ops to approve or deny apartment sales, also passed unanimously.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Int 0571-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0902-2024 — Approved by Committee
6 yea · 1 abstain
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz abstain · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0994-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1120-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1321-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1422-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1490-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Thu Dec 18, 2025 · 11:15 AM

Committee on Small Business

Committee considers small business loan readiness resources

The Committee on Small Business is meeting to discuss Int 1350-2025. This proposed local law would amend the administrative code of the city of New York regarding resources for small business loan readiness.

small-businessloansadministrative-code
✓ Decided: Committee on Small Business approves Introduction No. 1350-2025-A

The Committee on Small Business voted to approve Introduction No. 1350-2025-A. All six members present voted affirmative, with one member absent and no negative votes recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1350-2025 — Approved by Committee
6 yea · 1 absent
Oswald J. Feliz yea · Erik D. Bottcher yea · Selvena N. Brooks-Powers yea · Shekar Krishnan yea · Vickie Paladino yea · Sandra Ung yea · Susan Zhuang absent
Wed Dec 17, 2025 · 10:00 AM

Committee on Health

Resolution urging state law for pain management in gynecologic procedures

The Committee on Health will consider Resolution No. 1061-A, which calls on the New York State Legislature and the Governor to enact legislation requiring pain management options for patients undergoing in‑office gynecologic procedures. The council will vote on whether to adopt this resolution.

healthlegislationpain-managementgynecologic-procedurescity-council
✓ Decided: Committee on Health approves Resolution 1061-2025-A

The Committee on Health approved Resolution 1061-2025-A. The vote recorded seven members in favor and four members absent.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 1061-2025 — Approved by Committee
7 yea · 4 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan absent · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang absent
Wed Dec 17, 2025 · 10:45 AM

Committee on Veterans

Committee reviews multiple veteran‑focused local laws and resolutions

The Committee on Veterans will consider eight proposed local laws covering reporting on veteran preference in Mitchell‑Lama housing, community‑board veteran committees, procurement for veteran‑owned businesses, support for veteran vendors, fee waivers for veteran food‑unit commissaries, cure periods for veteran service‑organization violations, rental assistance for homeless veterans, and a study of a pilot therapy program for traumatic‑memory reconsolidation. The committee will also hear three resolutions urging the Department of Education to observe Veterans Day, requesting a state property‑tax exemption for 100 % service‑connected disabled veterans, and asking the Housing Authority to give veterans admission preference in its next agency plan.

veteranshousingprocurementtaxhealtheducation
✓ Decided: Committee approves multiple veteran-focused bills and resolutions

The NYC Council Committee on Veterans approved a series of local law introductions and three resolutions. All approvals were by roll call, with five votes in favor and one member absent, except one bill where one member abstained. The actions cover veteran reporting, community board committees, procurement, vendor support, housing preferences, and commemorations.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
Int 0465-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 0684-2024 — Approved by Committee
4 yea · 1 absent · 1 abstain
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse abstain · Vickie Paladino yea
Int 0685-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 0686-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 0687-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 0688-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 0959-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Int 1171-2025 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Res 0018-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Res 0311-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Res 0465-2024 — Approved by Committee
5 yea · 1 absent
Robert F. Holden yea · Joann Ariola yea · Simcha Felder yea · Kristy Marmorato absent · Sandy Nurse yea · Vickie Paladino yea
Wed Dec 17, 2025 · 12:45 PM

Committee on Mental Health, Disabilities and Addiction

Council to consider a law banning mobile syringe distribution in certain areas

The Committee on Mental Health, Disabilities and Addiction will consider two proposed local laws. Int. No. 868-A would amend the city’s administrative code to prohibit mobile syringe service programs from distributing hypodermic syringes and needles in specified locations. Int. No. 1169-A would amend the code to address the safe collection and disposal of needles and syringes. Both items are scheduled for discussion at the December 17, 2025 meeting.

mental-healthpublic-healthneedlessyringe-service-programscity-legislation
✓ Decided: Committee approved two mental‑health introductions, 6‑1 and 7‑0 votes

The Committee on Mental Health, Disabilities and Addiction approved Introduction 0868‑2024‑A with a 6‑1 vote. The same committee approved Introduction 1169‑2025‑A unanimously, 7‑0. Both motions were adopted by roll‑call vote. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0868-2024 — Approved by Committee
6 yea · 1 nay
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher yea · Tiffany L. Cabán nay · Shahana K. Hanif yea · Farah N. Louis yea · Darlene Mealy yea
The other 1 item passed by unanimous or near-unanimous consent.
Wed Dec 17, 2025 · 1:00 PM

Committee on Mental Health, Disabilities and Addiction

Committee to review mental health program outcomes and equity

The Committee on Mental Health, Disabilities and Addiction will hold an oversight hearing to evaluate the New York City Department of Health and Mental Hygiene's systems for measuring outcomes and equity in city-funded mental health programs.

mental-healthhealthoversightequitydoohmhcouncil-hearing
✓ Decided: Committee held oversight hearing; no decisions recorded

The Committee on Mental Health, Disabilities and Addiction met on December 17, 2025 at City Hall. Members present were Chair Linda Lee, Shaun Abreu, Erik D. Bottcher, Tiffany Cabán, Shahana K. Hanif, Farah N. Louis, and Darlene Mealy, with Public Advocate Williams attending. The meeting consisted of an oversight hearing (T2025-4518) and the filing of a committee report; no votes or substantive actions were taken.

250 Broadway - 8th Floor - Hearing Room 1
Tue Dec 16, 2025 · 12:00 PM

Committee on Governmental Operations, State & Federal Legislation

Committee to consider charter amendment on elected officials' compensation

The Committee on Governmental Operations, State & Federal Legislation will hold a hearing on December 16, 2025 at 12:00 PM in Hearing Room 1, 250 Broadway. It will consider Int 1493-2025, a local law amendment to the New York City charter that addresses compensation for the mayor, public advocate, city council members, borough presidents, comptroller, and district attorneys.

chartercompensationelected-officialslocal-lawgovernance
✓ Decided: Committee held hearing on Int 1493‑2025, no decisions were made

The Committee on Governmental Operations, State & Federal Legislation held a hearing on Introduction 1493‑2025, a local law to amend the city charter regarding compensation for city officials. The introduction was also laid over by the committee. No votes, approvals, denials, or other substantive actions were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Fri Dec 12, 2025 · 10:00 AM

Committee on Health

Committee to discuss fertility treatment, cancer screening, and restaurant sodium warnings

The New York City Council Committee on Health will hold an oversight hearing on HealthyNYC and meet to vote on three local laws regarding fertility treatment, blood glucose test strips, and restaurant sodium warnings. The committee will also consider resolutions urging the state legislature to expand colorectal cancer screening and mandate pain management options for gynecologic procedures.

healthcounciloversightfertilitycancernutritionlegislation
✓ Decided: Health Committee held hearings on several items, no decisions recorded

The Committee on Health reviewed T2025-4509, Int. No. 1303, Int. No. 1399, Int. No. 1465, and Resolutions 1021-2025, 1061-2025, and 1136-2025. Each item was noted as a hearing held or laid over by the committee. No votes or approvals were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 3
Thu Dec 11, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will consider zoning changes for Brooklyn's Herkimer‑Williams area

The Subcommittee on Zoning and Franchises will review several applications to amend the zoning map and resolution for the Herkimer‑Williams site in Brooklyn, including changes from M1‑2 to C6‑4 and M1‑6 districts and the creation of a Mandatory Inclusionary Housing area. It will also consider a site acquisition for a publicly accessible open space and special permits for retail development on Williams Place. Additional items include a zoning amendment in Queens, a sidewalk café consent in Manhattan, and resolutions extending franchise agreements for public communications structures and street furniture across the city.

zoninghousingopen-spacefranchisebrooklynqueensmanhattan
✓ Decided: Subcommittee approved six land use applications with modifications, 6‑1 vote

The Subcommittee on Zoning and Franchises voted to approve six land use applications (LU 0434‑2025 through LU 0439‑2025) with modifications and referred them to the City Planning Commission. The motion passed with six members voting affirmative and one member absent. Resolutions 1109‑2025 and 1157‑2025 were heard and laid over without a recorded vote.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
LU 0434-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0435-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0436-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0437-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0438-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0439-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Dec 11, 2025 · 12:00 PM

Committee on Land Use

Committee on Land Use to review Herkimer-Williams development in Brooklyn

The Committee is considering multiple applications for the Herkimer-Williams project, including zoning map amendments and a mandatory inclusionary housing area. The body will also review a commercial overlay in Queens, a sidewalk café in Manhattan, and citywide franchise agreements.

zoninghousingbrooklynqueensmanhattanland-use
✓ Decided: Committee approves Queens zoning amendment for Medident Corp

The Land Use Committee voted 10‑0 to approve the zoning map amendment submitted by Medident Corp., establishing a C1‑2 district within an R3‑2 district in Queens. The same vote approved six other land‑use applications with modifications and referred them to the City Planning Commission. Council member Hanks was the only member absent for all votes.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
LU 0434-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0435-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0436-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0437-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0438-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0439-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Thu Dec 11, 2025 · Deferred

Committee on Finance

No agenda items were announced for this Finance Committee meeting

The Committee on Finance meeting scheduled for Thursday, December 11, 2025, lists no specific agenda items. The agenda entry reads "AGENDA TO BE ANNOUNCED," indicating that details of discussions or decisions have not been provided. The meeting will proceed with only procedural matters as currently documented.

financecity-councilnycmeeting
Council Chambers - City Hall
Thu Dec 11, 2025 · Deferred

Committee on Immigration

Council to consider law creating private right of action on civil immigration detainers

The Committee on Immigration will consider four local law proposals that amend the city’s administrative code. The bills address civil immigration detainers, signage about constitutional protections, employer use of E‑Verify, and the presence of federal immigration authorities in correctional facilities. Each proposal seeks to change city policy on immigration enforcement and related practices.

immigrationlocal-lawenforcementemploymentsignage
Council Chambers - City Hall
Wed Dec 10, 2025 · 10:00 AM

Committee on Oversight and Investigations

Committee will conduct an oversight visit to Rikers Island

The Committee on Oversight and Investigations, together with the Committee on Criminal Justice, will hold an oversight session that includes a visit to Rikers Island. The agenda lists this as the sole item for the December 10, 2025 meeting. No legislative actions or votes are indicated.

oversightcriminal-justicecorrectionsriker-island
✓ Decided: Committee held oversight hearing, no decisions made

The Oversight and Investigations Committee met on December 10, 2025. Members were present and a hearing was conducted. The committee filed an oversight report. No votes, approvals, denials, or other substantive actions were recorded.

Council Chambers - City Hall Jointly with the Committee on Criminal Justice
Wed Dec 10, 2025 · 10:00 AM

Committee on Criminal Justice

Committee will conduct an oversight visit to Rikers Island

The Committee on Criminal Justice will hold an oversight visit to Rikers Island, in partnership with the Committee on Oversight and Investigations. The visit is scheduled as agenda item T2025-4468 for the Dec 10, 2025 meeting at 10:00 AM in the Council Chambers. No other decisions or actions are listed on the agenda.

criminal-justiceoversightriker-islandcity-council
✓ Decided: Committee on Criminal Justice held oversight hearing, no decisions

The Committee on Criminal Justice met on Dec 10, 2025 for an oversight hearing. Roll call listed members present and absent, and other council members attended. The meeting attached a committee report (T2025-4468) and filed the oversight, but no votes, approvals, or other substantive decisions were recorded.

Council Chambers - City Hall Jointly with the Committee on Oversight and Investigations.
Tue Dec 9, 2025 · 1:00 PM

Committee on Aging

Committee on Aging will discuss oversight of social isolation among older New Yorkers.

The Committee on Aging will hold a hearing on the issue of social isolation among older New Yorkers. The meeting is scheduled for Tuesday, December 9, 2025 at 1:00 PM in Hearing Room 2, 250 Broadway, 8th Floor. Chair Crystal Hudson and committee members will review oversight item T2025-4501.

agingsocial-isolationoversightnyccommittee
✓ Decided: Committee on Aging held a hearing and filed an oversight report

The Committee on Aging met on December 9, 2025. An oversight hearing (T2025-4501) was held and an oversight report was filed. No substantive decisions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Tue Dec 9, 2025 · 3:00 PM

Committee on Standards and Ethics

Committee on Standards and Ethics holds routine oversight meeting

The City Council Committee on Standards and Ethics will hold an oversight meeting on December 9, 2025, as required by Council Rule 10.60. No specific agenda items are listed for discussion.

ethicsoversightcity-councilgovernance
✓ Decided: Committee held a hearing and filed an oversight report

The Committee on Standards and Ethics met on December 9, 2025, conducted a hearing and filed an oversight report. No substantive decisions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 3 *
Tue Dec 9, 2025 · 10:00 AM

Committee on Sanitation and Solid Waste Management

Committee will review oversight and public engagement for NYC’s 2026 solid waste plan

The Committee on Sanitation and Solid Waste Management will meet on Tuesday, December 9, 2025 at 10:00 AM in Hearing Room 1, 250 Broadway, 8th Floor. The agenda item T2025-4200 calls for oversight and engagement regarding the City’s 2026 Solid Waste Management Plan. No other items are listed, and the agenda does not specify any decisions or votes.

sanitationsolid-wasteplanningoversightengagement
✓ Decided: No substantive decisions were made at this meeting

The Committee on Sanitation and Solid Waste Management held a roll call, noting which members were present and absent. An oversight hearing (Item T2025-4200) was conducted and a committee report was filed. No approvals, denials, or motions were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Mon Dec 8, 2025 · 10:00 AM

Committee on Immigration

Committee will consider four immigration‑related local law proposals

The New York City Council Committee on Immigration will discuss four proposed Local Laws that amend the city’s administrative code. One bill creates a private right of action concerning civil immigration detainers and cooperation with federal immigration authorities. Another requires signage describing certain constitutional and legal protections. A third restricts employers from using E‑Verify or similar systems for applicants who have not been offered employment, and a fourth redefines immigration‑enforcement terms and bars federal immigration authorities from maintaining offices on Department of Correction property.

immigrationlocal-lawcity-councilemploymentsignageenforcement
✓ Decided: Committee held hearings and laid over four immigration bills

The Immigration Committee considered four introductions: Int 0214-2024, Int 1268-2025, Int 1272-2025, and Int 1412-2025. Each was heard by the committee and then laid over. No votes or final actions were recorded.

Council Chambers - City Hall
Mon Dec 8, 2025 · 1:00 PM

Committee on Technology

Committee reviews privacy, AI, and website domain proposals and two state‑level resolutions

The Committee on Technology will consider three local‑law proposals that update definitions of identifying information, require a gendered impact assessment for AI, and mandate a top‑level domain for city agency websites. It will also hear two resolutions urging the New York State Legislature and Governor to enact the New York Data Protection Act and the Right to Your Own Image Act. The meeting is scheduled for Monday, December 8, 2025 at 1:00 PM in Hearing Room 3, 250 Broadway, 8th Floor.

privacytechnologydata-protectionartificial-intelligencedomain-namescity-councillegislation
✓ Decided: Committee held hearings and filed reports on several technology items

The Committee on Technology conducted hearings and introduced multiple items, including Int. No. 1335, Int. No. 1340, Int. No. 1367, Res. No. 0783, and Res. No. 1062. Attachments such as reports, summaries, and fiscal impact statements were filed. No substantive decisions, approvals, or votes were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Civil and Human Rights.
Mon Dec 8, 2025 · 1:00 PM

Committee on Civil and Human Rights

Council urges state to pass the New York Data Protection Act

The Committee on Civil and Human Rights will consider three local‑law amendments that update definitions of identifying and private information, require a gender‑impact AI assessment, and set a top‑level domain rule for city agency websites. It will also hear two resolutions urging the New York State Legislature and Governor to enact the New York Data Protection Act and the Right‑to‑Your‑Own‑Image Act. The meeting is scheduled for Dec 8, 2025 at 1 PM in Hearing Room 3, 250 Broadway.

privacytechnologyaidata-protectioncivil-rightslegislation
✓ Decided: Committee held oversight hearings and received reports, no decisions made

The Committee on Civil and Human Rights held oversight hearings on several introductions and resolutions, including Int. No. 1335, 1340, 1367, Res. No. 0783, and Res. No. 1062. Attachments such as reports, fiscal impact statements, and hearing transcripts were noted. No votes, approvals, denials, or other actions were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Technology
Thu Dec 4, 2025 · 9:30 AM

Committee on Cultural Affairs, Libraries and International Intergroup Organizations

City Council declares Haitian Konpa Day annually

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations will consider two resolutions. One resolution (Res 0987-2025) would declare July 26 as Haitian Konpa Day each year to honor Haitian music and dance. The other resolution (Res 1063-2025) would designate November 12 as Sigma Gamma Rho Day each year to recognize the sorority's contributions. Both items are scheduled for discussion at the December 4, 2025 meeting.

cultureholidayscommunityarts
✓ Decided: Committee approves two resolutions with 7-2 votes each

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations approved Resolution 0987-2025 and Resolution 1063-2025. Both motions passed by roll‑call vote with seven members in favor and two members absent. Council members Carr, Hanif, Hanks, Hudson, Louis, Ossé and Ung voted affirmative; Chair Bottcher and Williams were absent.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0987-2025 — Approved by Committee
7 yea · 2 absent
Erik D. Bottcher absent · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams absent
Res 1063-2025 — Approved by Committee
7 yea · 2 absent
Erik D. Bottcher absent · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams absent
Thu Dec 4, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

NYC Council proposes a student fare program for MTA trains and buses

The Committee on Transportation and Infrastructure will consider two proposed local laws and two resolutions. One local law would test high‑visibility pavement markings and start a pilot program. Another would require the Department of Transportation to inventory city‑owned retaining walls. The resolutions request that the MTA provide real‑time GPS data to first‑responder agencies and that the state enact a student fare program for MTA trains and buses.

transportationinfrastructurelocal-lawresolutionstudent-faregpspavement
✓ Decided: Committee approves four items, including two introductions and two resolutions

The Transportation and Infrastructure Committee approved Introduction No. 1154-2024, Introduction No. 1423-2025, Resolution No. 498-2024, and Resolution No. 773-2025. Each motion passed with seven votes in favor and one member absent (Julie Won). No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 1154-2024 — Approved by Committee
7 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won absent
Int 1423-2025 — Approved by Committee
7 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won absent
Res 0498-2024 — Approved by Committee
7 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won absent
Res 0773-2025 — Approved by Committee
7 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won absent
Thu Dec 4, 2025 · 10:30 AM

Subcommittee on Zoning and Franchises

MTA rezoning of 125th and Lexington to be heard

The Subcommittee on Zoning and Franchises will hear two applications from the Metropolitan Transportation Authority to rezone the 125th and Lexington area in Manhattan. The proposals include changing the zoning map to a C6-11 District and establishing a Mandatory Inclusionary Housing area.

zoningmtamanhattanhousingredevelopmentpublic-hearing
✓ Decided: Subcommittee approved land use application, added changes, sent to CPC

The Subcommittee on Zoning and Franchises approved the land use application with modifications and referred it to the City Planning Commission. All seven members—Riley, Abreu, Carr, Hanks, Moya, Salaam, and Schulman—voted affirmative. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0426-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0427-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Dec 4, 2025 · 10:30 AM

Committee on Governmental Operations, State & Federal Legislation

City Council to consider charter amendment creating a Census Office

The Committee on Governmental Operations will consider Int 1225‑2025 A, a proposed local law to amend the New York City charter. The amendment would establish an Office of the Census. The committee will discuss and vote on the proposal at the December 4 meeting.

governmentcensuscharterlegislation
✓ Decided: Committee approves Introduction No. 1225-2025-A unanimously

The Committee on Governmental Operations, State & Federal Legislation voted to approve Introduction No. 1225-2025-A. All nine members present cast affirmative votes, resulting in a 9‑0 approval. No other actions were taken during the meeting.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1225-2025 — Approved by Committee
9 yea
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Frank Morano yea · Lynn C. Schulman yea · Inna Vernikov yea
Thu Dec 4, 2025 · 11:00 AM

Committee on General Welfare

City Council to consider Mayor's veto of rent assistance law

The Committee on General Welfare will meet to discuss Intro 1372-2025, a local law that would limit the household rent contribution for rental assistance voucher recipients. The Mayor has vetoed this law, and the committee will consider the veto message.

housingrent-assistancevetocouncil-committeenyc
✓ Decided: Committee approved Introduction No. 1372

The Committee on General Welfare held a hearing on Introduction No. 1372 and approved it. The mayor's veto message related to the same introduction was also heard and formally filed. No other substantive actions were recorded.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1372-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Thu Dec 4, 2025 · 1:30 PM

City Council Stated Meeting

City Council to review park site acquisitions in Brooklyn and Queens

The City Council is considering the acquisition of multiple properties for park use in Brooklyn Community District 5 and Queens Community District 3. The body is also reviewing various local laws regarding public health, building codes, and city charter amendments.

parksland-usepublic-healthzoningtaxesbuilding-codes
✓ Decided: Council approved several local law introductions despite mayor vetoes

The City Council voted to approve four local law introductions: Int 0982‑2024‑A, Int 0984‑2024‑A, Int 1248‑2025‑B, and Int 1392‑2025‑A. The first two passed 40‑7, the third passed 46‑1, and the fourth was approved by consent. The Council also adopted a land‑use call‑up to review a sidewalk café at 37 Canal Street, with 45 members voting in favor.

Council Chambers - City Hall
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Int 0982-2024 — Overridden by Council
40 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Harvey D. Epstein yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
Int 0984-2024 — Overridden by Council
40 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Harvey D. Epstein yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
Int 1248-2025 — Overridden by Council
46 yea · 4 absent · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Harvey D. Epstein yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
Int 1372-2025 — Overridden by Council
40 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Harvey D. Epstein yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
The other 43 items passed by unanimous or near-unanimous consent.
Thu Dec 4, 2025 · 12:00 PM

Committee on Environmental Protection, Resiliency and Waterfronts

Council considers resilient construction standards for tanks in flood risk areas

The Committee on Environmental Protection, Resiliency and Waterfronts is meeting to discuss Int 1397-2025. This proposed law would establish construction standards for tanks in stormwater flood risk areas and require the Department of Buildings to provide flood risk information via a portal.

environmental-protectionflood-riskstormwaterbuilding-codesresiliency
✓ Decided: Committee on Environmental Protection approves Introduction Int. 1397-2025-A

The Committee on Environmental Protection, Resiliency and Waterfronts met on Dec. 4, 2025. Members Gennaro, Avilés, Holden, Marmorato, Nurse, Restler and Zhuang were present; Brannan and Salamanca Jr. were absent. The committee approved the introduction (Int. 1397‑2025‑A) with seven affirmative votes. No other decisions were recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1397-2025 — Approved by Committee
7 yea · 2 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. absent · Susan Zhuang yea
Thu Dec 4, 2025 · 11:45 AM

Committee on Housing and Buildings

Council considers rent‑adjustment and notice‑period resolutions for Mitchell‑Lama housing

The Committee on Housing and Buildings will consider two resolutions urging the New York State Legislature and the Governor to act on rent adjustments and minimum notice periods for Mitchell‑Lama rental and co‑op residents. It will also review four proposed local laws that would amend the building and administrative codes on sidewalk shed permits, rat‑related inspection reporting, construction‑site mental‑health safety training, and awning‑sign installation education with fee waivers.

housingrentbuilding-codeinspectionssafetyawningsresolutions
✓ Decided: Committee approved four housing introductions and two resolutions

The Committee on Housing and Buildings approved Introduction 0796-2024, Introduction 1217-2025, Introduction 1384-2025, and Introduction 1456-2025. It also approved Resolution 0575-2024 and Resolution 1016-2025. Each item was approved by roll‑call with all seven members voting affirmatively.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
Int 0796-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1217-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1384-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1456-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0575-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 1016-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Thu Dec 4, 2025 · 11:30 AM

Committee on Education

Local law to require schools to stock airway clearance devices

The Committee on Education will consider Int. No. 1002-2024, a proposed local law amendment that would require all schools to stock airway clearance devices and repeal section two of the existing law after its expiration. It will also consider Res. 0054-2024, a resolution urging the NYC Department of Education and the New York State Education Department to increase training for educators of English Language Learners. Finally, the committee will review Res. 0251-2024, a resolution asking the State Education Department to allow lifeguard certification to substitute for Physical Education credit for high school seniors aged 17 and older.

educationschoolshealth-safetyenglish-language-learnersphysical-education
✓ Decided: Education Committee approves Introduction 1002‑2024 and Resolutions 0054 & 0251

The Committee on Education voted to approve Introduction Int 1002‑2024, including its amendment, by roll‑call. The committee also approved Resolution 0054‑2024 and Resolution 0251‑2024, each by unanimous roll‑call. All 13 members voted affirmatively on each item.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1002-2024 — Approved by Committee
13 yea
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Res 0054-2024 — Approved by Committee
13 yea
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Res 0251-2024 — Approved by Committee
13 yea
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Thu Dec 4, 2025 · 11:30 AM

Committee on Parks and Recreation

Committee considers laws on pool mapping and lifeguard participation

The Committee on Parks and Recreation is reviewing four proposed local laws and one resolution. The items focus on water safety, swimming pool information, and park personnel.

parkswater-safetyswimming-poolslifeguardsurban-park-rangers
✓ Decided: Committee approves five items, including four introductions and a resolution

The New York City Council Committee on Parks and Recreation approved five measures by unanimous roll‑call vote. Introductions 0988‑2024‑A, 1058‑2024‑A, 1059‑2024‑A, and 1425‑2025‑A were each approved. Resolution 0469‑2024 was also approved. All eight committee members voted affirmative.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0988-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Int 1058-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Int 1059-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Int 1425-2025 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Res 0469-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Thu Dec 4, 2025 · 11:00 AM

Committee on Land Use

City Council considers park acquisitions and MTA rezoning

The Committee on Land Use will review applications for park site acquisitions in Brooklyn and Queens, as well as a proposed rezoning of the MTA 125th and Lexington area in Manhattan. The body will also discuss a local law regarding affordable homeownership.

zoningparkshousingmtaaffordable-housingland-useacquisitionmanhattan
✓ Decided: Land Use Committee unanimously approves two applications, one with companion resolution

The Committee on Land Use voted unanimously to approve application LU 0421‑2025 with a companion resolution. It also approved applications LU 0426‑2025 and LU 0427‑2025 with modifications and referred them to the City Planning Commission. Each motion received 11 affirmative votes and no negatives.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
LU 0420-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0421-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0426-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0427-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Thu Dec 4, 2025 · 11:00 AM

Committee on Contracts

Committee considers vendor payment pilot and contract services laws

The Committee on Contracts will discuss amendments to the New York City Charter regarding an office of contract services and vendor payment schedules. The meeting includes a review of a mayoral veto of Introductory Number 1248-B.

contractscity-chartervendor-paymentshomeless-servicescriminal-justice
✓ Decided: Committee on Contracts approved Introductions 1248‑2025‑B and 1392‑2025‑A

The Committee on Contracts met on Dec. 4, 2025. Members Won, Nurse, Stevens and Vernikov were present; Bottcher was absent. The committee approved Introduction 1248‑2025‑B and Introduction 1392‑2025‑A, each with a 4‑1 vote. Additional procedural steps such as hearings and an amendment proposal for Introduction 1392‑2025‑A were recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1248-2025 — Approved by Committee
4 yea · 1 absent
Julie Won yea · Erik D. Bottcher absent · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov yea
Int 1392-2025 — Approved by Committee
4 yea · 1 absent
Julie Won yea · Erik D. Bottcher absent · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov yea
Thu Dec 4, 2025 · 9:30 AM

Committee on Health

Council considers requiring epinephrine devices in schools and child care

The Committee on Health is meeting to discuss Proposed Int. No. 895-A. This legislation would amend the city administrative code regarding the stocking of epinephrine devices in child care programs and schools.

healthschoolschild-carepublic-safety
✓ Decided: Committee on Health approves Introduction Int. 0895-2024

The Committee on Health met on December 4, 2025 at City Hall. Members Schulman, Ariola, De La Rosa, Felder, Feliz, Marmorato, Narcisse and Zhuang were present; Brannan, Gennaro and Menin were absent. By roll‑call the committee approved Introduction Int. 0895‑2024 with eight affirmative votes and no recorded opposition.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0895-2024 — Approved by Committee
8 yea · 3 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan absent · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato yea · Julie Menin absent · Mercedes Narcisse yea · Susan Zhuang yea
Thu Dec 4, 2025 · 10:30 AM

Committee on Civil and Human Rights

Mayor vetoes two pay‑equity related local laws

The Committee on Civil and Human Rights will receive two communications from the Mayor vetoing Introductory Numbers 982‑A and 984‑A. Both bills would amend the city administrative code—one on pay data reporting by private employers and the other on a study of pay equity for private employees. The committee will discuss the mayor's disapproval of these proposals.

civil-rightspay-equitylabormayor-vetolocal-law
✓ Decided: Committee approved two introductions and filed mayor's veto messages

The Committee on Civil and Human Rights held a hearing on Dec. 4, 2025. It approved Introduction Int 0982-2024-A and Introduction Int 0984-2024-A, each with a 4‑1 vote. The committee also filed the mayor's veto messages for both introductions. No other substantive actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0982-2024 — Approved by Committee
4 yea · 1 absent
Nantasha M. Williams absent · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea
Int 0984-2024 — Approved by Committee
4 yea · 1 absent
Nantasha M. Williams absent · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea
Thu Dec 4, 2025 · 10:45 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee reviews Pacific St tax exemption and park site acquisitions

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider three applications. One application (LU 0414-2025) seeks a real‑property tax exemption for 2149‑2153 Pacific Street in Brooklyn, submitted by the Department of Housing Preservation and Development. Two applications (LU 0420-2025 and LU 0421-2025) request acquisition and site selection of multiple properties for park use in Brooklyn Community District 5 and Queens Community District 3, submitted by the Department of Citywide Administrative Services (and the Department of Parks and Recreation for the Queens request). The subcommittee will discuss approval of these requests.

landmarksparkstax-exemptionland-acquisitionbrooklynqueenshousing
✓ Decided: Subcommittee approves Land Use Application LU 0421-2025

The Subcommittee on Landmarks, Public Sitings and Dispositions approved Land Use Application LU 0421-2025. The motion passed with five affirmative votes and two members absent. The committee also laid over Land Use Application LU 0420-2025. No other substantive actions were recorded.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0420-2025 — Approved by Subcommittee
5 yea · 2 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse absent · Yusef Salaam yea
LU 0421-2025 — Approved by Subcommittee
5 yea · 2 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse absent · Yusef Salaam yea
Thu Dec 4, 2025 · 11:30 AM

Committee on Finance

Committee on Finance to review multiple property tax exemptions

The Committee on Finance is meeting to consider several property-related items. The agenda consists of preconsidered items for specific locations across Manhattan, Brooklyn, and Staten Island.

financemanhattanbrooklynstaten-islandproperty-tax
✓ Decided: Committee on Finance approved seven land use applications as P‑C items

The Finance Committee reviewed land use applications LU 0440‑2025 through LU 0446‑2025. For each application a motion was made to approve it as a P‑C item with a companion resolution. All motions passed by roll call with 16 members voting affirmative and Councilmember Williams absent. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
LU 0440-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0441-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0442-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0443-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0444-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0445-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
LU 0446-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams absent · Julie Won yea
Thu Dec 4, 2025 · 11:45 AM

Committee on Children and Youth

Resolution urging state to inform foster youth about college financial aid

The Committee on Children and Youth will consider Resolution 0843-2025. The resolution calls on the New York State Assembly and Governor to enact bill A5658A/S378. It directs the State Education Department and the Office of Children and Family Services to create posters and pamphlets that inform foster youth about higher‑education financial resources.

educationfoster-careyouthstate-legislationinformation
✓ Decided: Committee on Children and Youth approves Resolution 0843‑2025

The Committee on Children and Youth voted to approve Resolution 0843‑2025. The vote was 5‑0 in favor, with one member absent. No other actions were taken during the meeting.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0843-2025 — Approved by Committee
5 yea · 1 absent
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé yea · Nantasha M. Williams absent
Wed Dec 3, 2025 · 10:00 AM

Committee on General Welfare

NYC Council to review CityFHEPS housing voucher program changes

The Committee on General Welfare will hold an oversight hearing on the CityFHEPS program. The body will consider four local laws aimed at improving the application process and reporting for housing vouchers.

housingsocial-serviceswelfarecityfhepsvoucher-programoversightlocal-law
✓ Decided: Committee heard and laid over several introductions; no actions taken

The General Welfare Committee held hearings on and laid over introductions T2025-4337, Int 1366-2025, Int 1430-2025, Int 1458-2025, Int 1459-2025, and Int 1477-2025. No approvals, denials, or votes were recorded for any item. The meeting consisted of procedural oversight and document filings.

250 Broadway - 8th Floor - Hearing Room 1
Wed Dec 3, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee on Zoning and Franchises meeting scheduled for December 3

The Subcommittee on Zoning and Franchises will meet on December 3, 2025. The provided agenda contains only procedural information and does not list specific items for decision or discussion.

zoningfranchisescity-council
✓ Decided: Subcommittee held hearings and laid over multiple land use applications

The Zoning and Franchises Subcommittee conducted hearings on several land use applications and a resolution. After the hearings, the subcommittee laid over several of those items for further consideration. No vote tallies were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Wed Dec 3, 2025 · 1:00 PM

Committee on Veterans

Committee reviews progress on City Council Report Card recommendations

The Committee on Veterans will hold an oversight hearing to receive an update on how the City Council’s Report Card Initiative recommendations are being implemented. The meeting is scheduled for December 3, 2025 at 1:00 PM in Hearing Room 3, 250 Broadway, 8th Floor. No other agenda items are listed.

oversightveteranscity-councilreport-cardgovernance
✓ Decided: Veterans Committee held roll call and hearing, no decisions made

The Committee on Veterans met on December 3, 2025 with Chair Robert F. Holden and members Joann Ariola, Simcha Felder, Sandy Nurse, and Vickie Paladino present; Kristy Marmorato was absent. The meeting consisted of a roll call and an oversight hearing (T2025-4430) with attached committee report. No substantive actions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Tue Dec 2, 2025 · Deferred

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee on Landmarks, Public Sitings and Dispositions meeting scheduled

The Subcommittee on Landmarks, Public Sitings and Dispositions will meet on December 2, 2025. The provided agenda contains only procedural scheduling information and no specific items for decision or discussion.

landmarkspublic-sitingsdispositions
250 Broadway - 8th Floor - Hearing Room 2
Tue Dec 2, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee reviews legislation on co-op apartment sales and shared housing

The Committee on Housing and Buildings will hold an oversight hearing on co-op transparency. Members will discuss four introduction bills regarding cooperative apartment sales and shared housing regulations.

housingco-opsreal-estatebuilding-codestransparency
✓ Decided: Committee heard multiple co‑op housing bills and an oversight item

The Housing and Buildings Committee held hearings on several proposed local laws concerning cooperative apartment sales, financial disclosures, sale timelines, and shared housing. It also reviewed oversight item T2025-4338 on co‑op transparency. No votes, approvals, denials, or tablings were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Tue Dec 2, 2025 · 3:00 PM

Committee on Standards and Ethics

Standards and Ethics Committee meeting with no listed agenda items

The Committee on Standards and Ethics will meet on December 2, 2025 at City Hall. The meeting is called under Council Rule 10.60 and is listed as an oversight meeting (T2025-4552). No specific agenda items, proposals, or decisions are detailed in the agenda.

ethicsoversightcouncilstandards-ethics
✓ Decided: Committee on Standards and Ethics held an oversight hearing and filed documents

On December 2, 2025, the Committee on Standards and Ethics met at City Hall with Chair Sandra Ung and members Diana I. Ayala, David M. Carr, Eric Dinowitz, and Crystal Hudson present. The committee conducted an oversight hearing and filed the associated oversight documents. No other substantive decisions or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 3 *
Tue Nov 25, 2025 · Deferred

Committee on Contracts

Mayor vetoes Introductory Number 1248‑B to amend NYC charter on contract services

The Committee on Contracts will consider a communication from the mayor announcing a veto and disapproval of Introductory Number 1248‑B, a proposed local law to amend the city charter concerning the office of contract services. The item is listed as M 0193‑2025 and is marked “to be filed.” No other agenda items are listed.

chartercontractslegislationmayor
250 Broadway - 8th Floor - Hearing Room 1 VOTE*
Tue Nov 25, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Local law to require petroleum sellers disclose pre‑authorization holds

The Committee on Consumer and Worker Protection will consider Int. No. 1049‑A, a local law amendment to the city administrative code. The bill would require sellers of petroleum products for motor vehicles or motor boats to disclose pre‑authorization holds to consumers. The committee will vote on the proposal.

consumer-protectionworker-protectionlocal-lawpetroleumpreauthorization
✓ Decided: Committee approves Introduction 1049-2024-A on agency rule‑making

The Committee on Consumer and Worker Protection voted to approve Introduction No. 1049-2024-A, which concerns agency rule‑making. The motion passed with four affirmative votes (Menin, Abreu, Brewer, Krishnan); one member was absent and one was on medical leave. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1049-2024 — Approved by Committee
4 yea · 1 absent · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías absent · Shekar Krishnan yea · Chi A. Ossé medical
Tue Nov 25, 2025 · 10:00 AM

Committee on Criminal Justice

Committee will consider a local law amendment for correction work release program.

The Committee on Criminal Justice will review and vote on Int. No. 1241‑A, a proposed amendment to the city’s administrative code concerning the Department of Correction work release program. The meeting is scheduled for November 25, 2025 at 10:00 AM in Hearing Room 3, 250 Broadway, 8th Floor. No other agenda items are listed.

criminal-justicecorrectionslocal-lawwork-releasecity-council
✓ Decided: Committee on Criminal Justice approves Introduction 1241-2025-A

The Committee on Criminal Justice voted to approve Introduction No. 1241-2025-A. The vote recorded five affirmative votes (Nurse, Abreu, Hanif, Marte, Stevens) and four members absent (Ayala, Cabán, Narcisse, Restler). No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1241-2025 — Approved by Committee
5 yea · 4 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala absent · Tiffany L. Cabán absent · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse absent · Lincoln Restler absent · Althea V. Stevens yea
Tue Nov 25, 2025 · 10:00 AM

Committee on Civil Service and Labor

Two proposed local laws on civil service career info and exam promotion

The Committee on Civil Service and Labor will consider two proposed local laws that would amend the city’s administrative code. One bill (Int 0828‑2024) addresses how information about civil‑service careers is distributed at the City University of New York. The other bill (Int 0829‑2024) concerns the promotion of civil‑service examinations. The committee will vote on whether to adopt these proposals.

civil-servicelaborlocal-laweducationexaminations
✓ Decided: Committee approved introductions 0828‑2024‑A and 0829‑2024‑A

The Committee on Civil Service and Labor approved Introduction 0828‑2024‑A and Introduction 0829‑2024‑A. Both approvals were made by roll‑call vote with all nine members present voting affirmative. Councilmember Erik D. Bottcher was absent. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0828-2024 — Approved by Committee
9 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher absent · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Yusef Salaam yea
Int 0829-2024 — Approved by Committee
9 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher absent · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Yusef Salaam yea
Tue Nov 25, 2025 · 10:30 AM

Committee on Rules, Privileges and Elections

Council will consider nominations of Mitchell Katz and Dave Chokshi to health board.

The Committee on Rules, Privileges and Elections will meet on Tuesday, November 25, 2025 at 10:30 a.m. in Hearing Room 1, 250 Broadway, 8th Floor. The agenda includes two mayoral communications submitting the names Mitchell Katz and Dave Chokshi for the Council’s advice and consent on their reappointment and appointment, respectively, to the New York City Board of Health under City Charter sections 31 and 553.

city-councilappointmentsboard-of-healthadvice-and-consentcharter
✓ Decided: Committee disapproves Mayor's message with six affirmative votes

The Committee on Rules, Privileges and Elections voted to disapprove the Mayor's message. Six members voted in favor, two abstained, and three were absent. The motion was approved by roll call.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
M 0182-2025 — Disapproved by Committee
6 yea · 3 absent · 2 abstain
Keith Powers absent · Adrienne E. Adams yea · Joann Ariola yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson absent · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain
M 0184-2025 — Disapproved by Committee
6 yea · 3 absent · 2 abstain
Keith Powers absent · Adrienne E. Adams yea · Joann Ariola yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson absent · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain
Tue Nov 25, 2025 · 10:30 AM

Committee on Aging

Council to urge state and federal action on housing and healthcare for seniors

The Committee on Aging will consider four resolutions urging state and federal legislation to expand housing and healthcare benefits for seniors and people with disabilities. The agenda includes calls to lower the age for HIV services, expand Medicare, and freeze rent for SCRIE and DRIE enrollees.

aginghousinghealthcaremedicarerentdisabilitycouncilresolution
✓ Decided: Committee on Aging approved four resolutions with a 6‑1 vote each

The Committee on Aging voted to approve Resolution 0106‑2024‑A, Resolution 0452‑2024, Resolution 0850‑2025, and Resolution 0985‑2025. All six present members voted affirmative and one member, Lee, was absent for each vote.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Res 0106-2024 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy yea · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Res 0452-2024 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy yea · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Res 0850-2025 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy yea · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Res 0985-2025 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy yea · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Tue Nov 25, 2025 · 10:30 AM

Subcommittee on Zoning and Franchises

Subcommittee to review rezoning for 1720 Atlantic Avenue and MTA 125th and Lexington

The Subcommittee on Zoning and Franchises will discuss several land use applications. These include rezoning requests for sites in Brooklyn and Manhattan and signage modifications for a property on Broadway.

zoninghousingmanhattanbrooklynmtaland-use
✓ Decided: Subcommittee approved four land use applications, sending two with modifications to CPC

The subcommittee voted 6‑0 to approve land use applications LU 0422‑2025 and LU 0423‑2025 with modifications and refer them to the City Planning Commission. It also approved applications LU 0429‑2025 and LU 0430‑2025. All votes were unanimous with Chair Riley absent.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
LU 0422-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley absent · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0423-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley absent · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0429-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley absent · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0430-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley absent · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Tue Nov 25, 2025 · 10:45 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee reviews lease, tax exemption, landmark designations, and park site selections

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider a 49‑year ground lease request for a vacant parcel at 349 East 140th Street in the Bronx, submitted by NYC Health and Hospitals Corp. It will also review a real‑property tax exemption application for 2149‑2153 Pacific Street in Brooklyn. The committee will vote on landmark designations for several Manhattan buildings—the Barbey Building, 29th Street Towers, Fashion Tower, Furcraft Building, and Lefcourt Clothing Center. Additional items include proposals to acquire and select sites for new parks in Brooklyn Community District 5 and Queens Community District 3.

leasetax-exemptionlandmarksparksland-use
✓ Decided: Subcommittee approved multiple land‑use applications, laying over two

The Subcommittee on Landmarks, Public Sitings and Dispositions voted to approve several land‑use applications, including LU 0364‑2025, LU 0414‑2025, and LU 0415‑2025 through LU 0419‑2025. Each approval received six affirmative votes and one non‑voting member. The applications LU 0420‑2025 and LU 0421‑2025 were laid over by the subcommittee. No other actions were recorded.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
LU 0364-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0415-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0416-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0417-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0418-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0419-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0433-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz absent · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
Tue Nov 25, 2025 · Deferred

Committee on Civil and Human Rights

Committee reviews mayoral vetoes of pay data and pay equity laws

The Committee on Civil and Human Rights will review two communications from the Mayor regarding the veto and disapproval of two bills. Both bills relate to pay data reporting and pay equity for private employees.

laborpay-equityprivate-employerscivil-rights
250 Broadway - 8th Floor - Hearing Room 2 VOTE*
Tue Nov 25, 2025 · 11:00 AM

Committee on Land Use

NYC Health Corp seeks 49‑year lease of Bronx parcel at 349 East 140th St

The Land Use Committee will consider an application by the New York City Health and Hospitals Corporation to lease a vacant Bronx parcel at 349 East 140th Street for 49 years with two 25‑year renewal options. It will also review several landmark designation requests for buildings on West 38th, West 29th, West 36th, West 30th, and Seventh Avenue in Manhattan. Additional items include a rezoning amendment for 1720 Atlantic Avenue in Brooklyn and a signage amendment for 1551 Broadway in Manhattan’s Theater Subdistrict.

leaselandmarkszoningdevelopmentsignagehousing
✓ Decided: Committee approved 11 land use applications, two with modifications

The Land Use Committee voted to approve eleven land‑use applications, each with a companion resolution. Ten members voted in favor and one member (Riley) was absent on each vote. Two applications (LU 0422‑2025 and LU 0423‑2025) were approved with modifications and referred to the City Planning Commission.

250 Broadway - 8th Floor - Hearing Room 3
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
LU 0364-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0415-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0416-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0417-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0418-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0419-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0422-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0423-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0429-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0430-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
LU 0433-2025 — Approved by Committee with Companion Resolution
10 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley absent · Pierina Ana Sanchez yea
Tue Nov 25, 2025 · 1:30 PM

City Council Stated Meeting

Council to appropriate $512.1 million for FY 2026 budget

The City Council will consider a $512.1 million appropriation of new city revenues for Fiscal Year 2026 and a transfer of city funds between agencies for the same year. It will also authorize the Department of Finance to evaluate the economic feasibility of developing certain vacant properties. Additional items include a land‑use call‑up for the Herkimer‑Williams project in Brooklyn and several landmark designation resolutions.

budgetfinanceland-usezoninglandmarkscity-planning
✓ Decided: Council approved Land Use Call‑Up for three planning applications

The City Council adopted a resolution placing three City Planning Commission applications (C 250288 PCK, C 250287 ZSK, C 250286A ZSK) under council review, with 47 votes in favor, 1 non‑voting member, and 2 absent. The Council also approved several local‑law introductions and a funding resolution by consent. No other substantive actions were taken.

Council Chambers - City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
M 0182-2025 — Disapproved by Council
39 yea · 8 abstain · 2 absent · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés absent · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Frank Morano abstain · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler abstain · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman abstain · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 1167-2025 — Disapproved by Council
39 yea · 8 abstain · 2 absent · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés absent · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Frank Morano abstain · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler abstain · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman abstain · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
The other 46 items passed by unanimous or near-unanimous consent.
Tue Nov 25, 2025 · 12:00 PM

Committee on Women and Gender Equity

Committee considers laws on STEM disparities and gender-based violence

The Committee on Women and Gender Equity will discuss three proposed local laws and one resolution. The items focus on education reporting, public health resources in businesses, and reproductive rights.

educationgender-equitypublic-healthreproductive-rightsstem
✓ Decided: Committee approves three introductions and a resolution on Nov 25, 2025

The Committee on Women and Gender Equity voted to approve Introduction 0691-2024, Introduction 1216-2025, and Introduction 1297-2025, each with a unanimous 5‑0 vote. The committee also approved Resolution 0889-2025 with a 4‑1 vote, with Councilmember Vernikov opposing. All approvals were recorded by roll call.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0889-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
The other 3 items passed by unanimous or near-unanimous consent.
Tue Nov 25, 2025 · Deferred

Committee on General Welfare

Committee considers mayoral veto of rental assistance voucher law

The Committee on General Welfare will review a communication from the Mayor regarding the veto and disapproval of Introductory Number 1372. This proposed local law seeks to limit the household rent contribution for people receiving rental assistance vouchers.

housingrental-assistancevouchersmayoral-veto
250 Broadway - 8th Floor - Hearing Room 2 VOTE*
Tue Nov 25, 2025 · 11:30 AM

Committee on Finance

Finance Committee to vote on designating organizations for expense‑budget funding

The Committee on Finance will consider Resolution T2025-4466, which would approve a new designation and changes to the designation of certain organizations to receive funding from the expense budget. The resolution is listed as a pre‑considered agenda item. The committee will also address agenda item T2024-0001 and any other business deemed necessary.

financebudgetfundingcity-councilnonprofit
✓ Decided: Finance Committee approves Resolution 1153

The New York City Council Committee on Finance voted to approve Resolution No. 1153. The vote was 13 in favor and 1 against. Councilmember David M. Carr voted negative, Councilmember Keith Powers was absent, and Councilmembers Francisco P. Moya and Chi A. Ossé were on medical leave.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 1153-2025 — P-C Item Approved by Comm
13 yea · 2 medical · 1 nay · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé medical · Keith Powers absent · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Tue Nov 25, 2025 · 11:30 AM

Committee on Technology

Proposal to create a NYC Office of Algorithmic Accountability

The Committee on Technology will consider four proposed local laws. Two bills (Int 0199-2024 and Int 0926-2024) aim to establish an Office of Algorithmic Accountability and set basic compliance standards for artificial‑intelligence use by city agencies. A third bill (Int 1024-2024) would require a public list of AI systems assessed by that office. The fourth bill (Int 1235-2025) proposes a centralized system for processing Freedom of Information Law requests.

algorithmic-accountabilityartificial-intelligencecity-charterfoiatechnology
✓ Decided: Technology Committee approved four introductions by roll‑call vote

The New York City Council Committee on Technology approved Introduction 0199-2024, 0926-2024, 1024-2024, and 1235-2025. Each motion passed by roll‑call with four members voting affirmative (Gutiérrez, Holden, Paladino, Won) and one member absent (Bottcher). No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 0199-2024 — Approved by Committee
4 yea · 1 absent
Jennifer Gutiérrez yea · Erik D. Bottcher absent · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Int 0926-2024 — Approved by Committee
4 yea · 1 absent
Jennifer Gutiérrez yea · Erik D. Bottcher absent · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Int 1024-2024 — Approved by Committee
4 yea · 1 absent
Jennifer Gutiérrez yea · Erik D. Bottcher absent · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Int 1235-2025 — Approved by Committee
4 yea · 1 absent
Jennifer Gutiérrez yea · Erik D. Bottcher absent · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Tue Nov 25, 2025 · 11:00 AM

Committee on Governmental Operations, State & Federal Legislation

Council proposes law to have schools give students coded voter registration forms

The Committee on Governmental Operations, State & Federal Legislation will consider two proposed local laws. The first would amend the city’s administrative code to require the Department of Education to provide students with coded voter registration forms and related materials. The second would amend the code to require training for local entities on the legislative process and parliamentary procedure. Both items are pending approval.

educationvotinglegislationtraininglocal-law
✓ Decided: Committee approved introductions 0441-2024-A and 1075-2024-A

The Committee on Governmental Operations, State & Federal Legislation approved Introduction 0441-2024-A and Introduction 1075-2024-A. Both approvals were by unanimous roll‑call vote of eight members, with Councilmember Gutiérrez absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0441-2024 — Approved by Committee
8 yea · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Frank Morano yea · Lynn C. Schulman yea · Inna Vernikov yea
Int 1075-2024 — Approved by Committee
8 yea · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Frank Morano yea · Lynn C. Schulman yea · Inna Vernikov yea
Tue Nov 25, 2025 · 11:30 AM

Committee on Mental Health, Disabilities and Addiction

Committee will consider two local laws on document accessibility and wheelchair repair info

The New York City Council Committee on Mental Health, Disabilities and Addiction will discuss two proposed local laws. One would establish accessibility guidelines for printed documents, and the other would require information on wheelchair repair providers. The committee will also consider two resolutions urging higher‑level legislatures to fund community treatment teams and add mental‑wellness training to OSHA courses.

mental-healthdisabilitiesaccessibilitylegislationcity-council
✓ Decided: Committee approved Res. 736 and Res. 1049 addressing mental health services

The Committee on Mental Health, Disabilities and Addiction approved Resolution 736-2025 and Resolution 1049-2025 by a 6‑1 vote. The committee also approved Introduction Int. 0163-2024-A and Introduction Int. 1004-2024-A, each with the same 6‑1 vote. All approvals were recorded by roll call.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 0163-2024 — Approved by Committee
6 yea · 1 absent
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher absent · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Darlene Mealy yea
Int 1004-2024 — Approved by Committee
6 yea · 1 absent
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher absent · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Darlene Mealy yea
Res 0736-2025 — Approved by Committee
6 yea · 1 absent
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher absent · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Darlene Mealy yea
Res 1049-2025 — Approved by Committee
6 yea · 1 absent
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher absent · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Darlene Mealy yea
Mon Nov 24, 2025 · 1:00 PM

Committee on Higher Education

Committee to examine student graduation rates at CUNY campuses

The Committee on Higher Education is holding an oversight hearing. The body will examine student graduation rates at CUNY campuses.

higher-educationcunygraduation-ratesoversight
✓ Decided: Higher Education Committee held roll call, no decisions made

The Committee on Higher Education met on November 24, 2025 at City Hall. Members present were Chair Eric Dinowitz, Erik D. Bottcher, Gale A. Brewer, Oswald Feliz, and Christopher Marte; Bottcher was listed as absent. The minutes record only the roll call and contain no substantive actions, approvals, or votes.

250 Broadway - 8th Floor - Hearing Room 2
Mon Nov 24, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee reviews sidewalk cafe access and worker bereavement leave

The Committee on Consumer and Worker Protection will hold an oversight update on the Dining Out NYC program. The body will also consider several proposed local laws regarding sidewalk cafes, newsrack enforcement, and employer requirements for bereavement leave.

dining-out-nycsidewalk-cafeslabor-lawspublic-safetyconsumer-protection
✓ Decided: Committee held hearings on multiple introductions without substantive actions

The Consumer and Worker Protection Committee met on November 24, 2025, and recorded roll call. The committee reviewed several introductions (Int. 1142-2024, 1320-2025, 1368-2025, 1421-2025, 1423-2025, 1426-2025, 1444-2025, 1446-2025). For each, a hearing was held and the item was laid over, but no approvals, denials, or vote tallies were recorded.

250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Transportation and Infrastructure.
Mon Nov 24, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee to discuss laws on sidewalk cafes, autism warning signs, and paid bereavement leave

The Committee on Transportation and Infrastructure will hold an oversight meeting on the Dining Out NYC program and consider several Local Laws regarding sidewalk cafes, autism warning plaques, and civil penalties for sidewalk defects.

sidewalk-cafesautismsidewalksdining-out-nyclocal-lawoversighttransportation
✓ Decided: Committee heard and laid over multiple introductions, no decisions made

The Transportation and Infrastructure Committee held hearings on several introductions and subsequently laid over multiple items. No votes, approvals, or other substantive actions were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Consumer and Worker Protection
Mon Nov 24, 2025 · Deferred

Subcommittee on Zoning and Franchises

Subcommittee on Zoning and Franchises meeting scheduled for Nov 24, 2025

The Subcommittee on Zoning and Franchises will meet on November 24, 2025 at City Hall, 250 Broadway, Hearing Room 3. The agenda does not list specific items, indicating a procedural or open hearing session. Members include Chair Kevin C. Riley and members Shaun Abreu, David M. Carr, Kamillah Hanks, Francisco P. Moya, Yusef Salaam, and Lynn C. Schulman.

zoningfranchisescity-councilhearing
250 Broadway - 8th Floor - Hearing Room 3
Mon Nov 24, 2025 · 1:00 PM

Committee on Parks and Recreation

Committee reviews park bathroom maintenance and staffing reports

The Committee on Parks and Recreation will hold an oversight hearing on the maintenance of drinking fountains and bathrooms in parks. The committee will also consider a local law regarding staffing level reports for park rangers and park enforcement patrol officers.

parksmaintenancestaffingoversight
✓ Decided: Committee held oversight hearing; no decisions were made

The Parks and Recreation Committee met on November 24, 2025, with Chair Shekar Krishnan and members present. The session consisted of an oversight hearing and the filing of related reports and attachments. No approvals, denials, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Thu Nov 20, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee considers laws on short-term rentals and building code updates

The Committee on Housing and Buildings is discussing several proposed local laws. These include regulations for short-term rentals in one- and two-family dwellings and updates to the city's building, energy, and plumbing codes.

housingshort-term-rentalsbuilding-codespest-controlenergy-efficiency
✓ Decided: Housing and Buildings Committee heard multiple bills but took no action

The committee reviewed introductions for bills Int. 0948, 1107, 1217, 1321, 1422, 1456, and 1490. Each item was either heard, amended, or laid over by the committee. No votes, approvals, or denials were recorded.

Council Chambers - City Hall
Thu Nov 20, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Organizations

Resolution urging Congress to designate SS United States historic and fund its restoration

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations will consider three resolutions. One addresses oversight of censorship in the arts and cultural sector. Two resolutions propose designating July 26 as Haitian Konpa Day and November 12 as Sigma Gamma Rho Day, while another urges federal legislation to recognize the ocean liner SS United States as a historic location and allocate restoration funds.

cultural-affairsartsheritagehaitian-culturesororityhistorical-preservation
✓ Decided: Committee held hearings and laid over three cultural resolutions

The Cultural Affairs Committee heard three resolutions: a federal historic‑preservation request for the SS United States, a Haitian Konpa Day proclamation, and a Sigma Gamma Rho Day designation. After the hearings, each resolution was laid over by the committee, meaning they were not advanced at this meeting.

250 Broadway - 8th Floor - Hearing Room 2
Thu Nov 20, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

Committee will consider oversight to protect NYC from federal overreach

The Committee on Governmental Operations, State & Federal Legislation will meet on November 20, 2025 at 10:00 AM in Hearing Room 3, 250 Broadway. The agenda lists item T2025-4425 titled “Oversight – Protecting New York City from Federal Overreach.” The committee will discuss oversight measures related to federal actions affecting the city.

oversightfederal-overreachcity-governmentlegislation
✓ Decided: Committee held oversight hearing on protecting NYC from federal overreach

The Committee on Governmental Operations, State & Federal Legislation met on Nov. 20, 2025 with five members present and two absent. The committee conducted an oversight hearing titled T2025-4425, focusing on protecting New York City from federal overreach, and filed the accompanying report. No votes or formal approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Thu Nov 20, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee to consider zoning map amendment for Herkimer‑Williams area

The Subcommittee on Zoning and Franchises will preconsider two applications submitted by Broadway Junction Partners LLC. The first (T2025-4473) seeks to amend the Zoning Map Section 17c, changing the Herkimer‑Williams area in Brooklyn from an M1-2 district to C6-4 and M1-6 districts. The second (T2025-4474) proposes amending the Zoning Resolution Article VII, Chapter 4 to modify large‑scale development provisions and establish a Mandatory Inclusionary Housing area in the same Brooklyn community district.

zoninghousingdevelopmentbrooklyninclusionary-housingland-use
✓ Decided: Subcommittee heard two zoning applications but took no action

The Subcommittee on Zoning and Franchises received two applications from Broadway Junction Partners LLC: T2025-4473 to amend the zoning map in Brooklyn Community District 5, and T2025-4474 to amend the zoning resolution and establish a mandatory inclusionary housing area in the same district. Both items were noted as hearings on P‑C items and were laid over by the committee. No approvals, denials, or votes were recorded.

Committee Room - City Hall
Wed Nov 19, 2025 · Deferred

Committee on Higher Education

CUNY graduation rates to be examined by Higher Ed Committee

The Committee on Higher Education will hold a hearing to oversee and examine student graduation rates at City University of New York campuses. The meeting is scheduled for Wednesday, November 19, 2025, at 10:00 AM at City Hall.

educationcunygraduation-ratesoversightcity-hall
250 Broadway - 8th Floor - Hearing Room 1
Wed Nov 19, 2025 · 10:00 AM

Committee on Public Safety

Committee on Public Safety to review police reporting and footage access laws

The Committee on Public Safety is meeting to discuss four proposed local laws. These items focus on police department reporting requirements and access to evidence and communications.

policepublic-safetytransparencyoversightlegislation
✓ Decided: Committee held hearings and laid over four public safety bills

The Committee on Public Safety held hearings on four local law introductions (Int 1237-2025, Int 1402-2025, Int 1451-2025, Int 1460-2025). After the hearings, each bill was laid over for further consideration. No votes or final approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Wed Nov 19, 2025 · 10:30 AM

Committee on Land Use

Three local laws on affordable‑rental unit percentages will be considered

The New York City Council Committee on Land Use will consider three local law proposals that amend the city’s administrative code. The bills would set citywide percentages for 2‑ and 3‑bedroom units in projects receiving city financial assistance, limit the share of studio apartments in city‑funded older‑adult rental projects, and require a minimum share of units affordable to extremely low‑income and very low‑income households.

housingaffordabilityrentalscity-financed-projectszoning
✓ Decided: Committee heard and laid over three housing-related local law introductions

The Land Use Committee held hearings on three local law introductions concerning rental unit percentages and studio limits in city‑funded projects. After the hearings, each introduction was laid over by the committee. No votes or final approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Tue Nov 18, 2025 · Deferred

Committee on Civil and Human Rights

Council committee reviews privacy‑protection local law amendment

The Committee on Civil and Human Rights will consider Int 1335-2025, a local law amendment that updates the city’s definitions of identifying and private information. The proposal is part of an oversight effort on privacy protection in the digital age and will be heard jointly with the Committee on Technology. Council members will discuss how the amendment balances technological advancements with privacy safeguards.

privacytechnologycivil-rightsoversightlegislation
250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Technology
Tue Nov 18, 2025 · 10:00 AM

Committee on Small Business

Committee reviews M/WBE certification and MENA business inclusion

The Committee on Small Business is holding a joint hearing with the Committees on Contracts and Women and Gender Equity. The body will discuss the status of the Minority and Women-owned Business Enterprise (M/WBE) certification program and proposed legislative changes regarding disparity studies and public contracts.

small-businessmwbepublic-contractsdisparity-studies
✓ Decided: Small Business Committee held hearings and laid over items, no votes

The Committee on Small Business conducted an oversight hearing on the status of the Minority and Women-owned Business Enterprise certification program (T2025-4319). It also heard the introduction of Int 1076-2024, a local law amendment concerning businesses owned by persons of Middle Eastern and North African descent, and considered Resolution 0281-2024 calling on the mayor’s office to address disparities faced by women of color in public contracts. No votes, approvals, or denials were recorded; the items were laid over for further action.

250 Broadway - 8th Floor - Hearing Room 2 Jointly with the Committee on Contracts and the Committee on Women and Gender Equity
Tue Nov 18, 2025 · 10:00 AM

Committee on Women and Gender Equity

Council reviews M/WBE program, MENA business inclusion law, and women of color contract disparities

The Committee on Women and Gender Equity will oversee the status of the Minority and Women‑owned Business Enterprise (M/WBE) Certification Program (T2025-4318). It will consider Int 1076-2024, a local law amendment requiring future disparity studies to include businesses owned by persons of Middle Eastern and North African descent. The committee will also discuss Res 0281-2024, a resolution urging the Mayor’s Office to identify and implement measures to reduce disparities faced by women‑of‑color businesses in public contracts. The meeting is held jointly with the Committees on Contracts and Small Business.

women-equityminority-businesscontractslocal-lawoversight
✓ Decided: Committee held hearings on M/WBE oversight and new local law proposals

The Committee on Women and Gender Equity held hearings on the status of the Minority and Women-owned Business Enterprise certification program (T2025-4318) and on Introduction Int 1076-2024, which would require inclusion of Middle Eastern and North African-owned businesses in disparity studies. The committee also heard Resolution 0281-2024 calling on the mayor’s office to address disparities faced by women‑of‑color‑owned businesses. No votes or final actions were recorded.

250 Broadway - 8th Floor - Hearing Room 2 Jointly with the Committee on Contracts and the Committee on Small Business
Tue Nov 18, 2025 · 10:00 AM

Committee on Contracts

Council Committee reviews M/WBE program, new law & resolution on business equity

The Committee on Contracts will oversee the status of the Minority and Women-owned Business Enterprise (M/WBE) Certification Program. It will consider Int 1076-2024, a local law amendment to require inclusion of businesses owned by persons of Middle Eastern and North African descent in future disparity studies. The committee will also discuss Res 0281-2024, a resolution urging the Mayor's Office to identify measures to reduce disparities faced by women of color in public contracts. The hearing is joint with the Committees on Women and Gender Equity and Small Business.

contractsminority-businesswomen-ownedlocal-lawequity
✓ Decided: Committee held hearings on minority and women-owned business programs

The Committee on Contracts held a hearing on oversight of the Minority and Women‑owned Business Enterprise (M/WBE) certification program (T2025-4317). It introduced Int 1076‑2024 to require inclusion of Middle Eastern and North African‑owned businesses in future disparity studies. The committee also considered Resolution 0281‑2024 urging the mayor to address disparities faced by women of color‑owned businesses. No votes or formal approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 2 Jointly with the Committee on Women and Gender Equity and the Committee on Small Business.
Tue Nov 18, 2025 · 1:00 PM

Committee on Hospitals

Committee reviews the state of nursing in NYC

The City Council Committee on Hospitals will hold an oversight session on the state of nursing. The meeting is scheduled for Tuesday, November 18, 2025 at 1:00 PM in the Committee Room at City Hall. No other agenda items are listed.

healthcarenursingoversighthospitals
✓ Decided: Committee held oversight hearing on the state of nursing

On November 18, 2025, the NYC Council Committee on Hospitals conducted an oversight hearing titled T2025-4226 on the state of nursing. The committee filed the accompanying report. No votes or formal approvals were recorded.

Committee Room - City Hall
Tue Nov 18, 2025 · Deferred

Committee on Technology

Committee to discuss privacy laws and oversight

The Committee on Technology will hold an oversight hearing on privacy protection in the digital age. The body will jointly meet with the Committee on Civil and Human Rights to consider a local law amending the city's administrative code regarding definitions of identifying and private information.

technologyprivacyoversightcivil-rightslegislation
250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Civil and Human Rights.
Mon Nov 17, 2025 · 1:00 PM

Committee on Fire and Emergency Management

Council committee urges MTA to add fire extinguishers in subway cars and stations

The Committee on Fire and Emergency Management will consider several local law amendments concerning firehouse vehicle and equipment reporting, emergency medical services unit reporting, uniform emergency response maps, and PFAS testing and remediation in firehouse drinking water. It will also discuss a resolution urging the Metropolitan Transportation Authority to install encased, alarmed, publicly accessible fire extinguishers in subway cars and stations.

fireemergency-managementreportingpfasmtasafetylegislation
✓ Decided: Fire and Emergency Management Committee held hearings, no votes taken

The committee heard introductions for several local laws concerning firehouse vehicle reporting, emergency medical services reporting, emergency response maps, after‑action reports, PFAS protection for firefighters, and fire extinguisher installation in the subway system. Each item was either heard or laid over by the committee, but no votes or final actions were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Mon Nov 17, 2025 · 1:00 PM

Committee on Children and Youth

Oversight of educational access in NYC juvenile detention centers

The Committee on Children and Youth will consider an oversight item (T2025-4340) concerning educational access in the city’s juvenile detention centers. It will also review a local law proposal (Int 0987-2024) for a pilot program to develop educational materials on reducing surplus food in public schools. Several resolutions will be considered, including one recognizing March as Music In Our Schools Month and three urging state legislation on educational leadership, student representation, and Open Meeting Law compliance.

educationjuvenile-detentionschoolslegislationresolutions
✓ Decided: Committee held hearings and forwarded multiple education-related resolutions

The Committee on Children and Youth conducted a hearing on oversight item T2025-4340 concerning educational access in NYC juvenile detention centers. It also heard and laid over four education‑related resolutions (Res 0842‑2025, Res 1017‑2025, Res 1018‑2025, Res 1019‑2025). No votes or final approvals were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Education.
Mon Nov 17, 2025 · 1:00 PM

Committee on Education

Committee on Education to review juvenile detention access and school food waste

The Committee on Education will hold an oversight hearing on educational access in NYC’s juvenile detention centers. Members will also consider a pilot program for reducing surplus food in public schools and several resolutions regarding school leadership teams.

educationjuvenile-detentionfood-wasteschool-governancepublic-schools
✓ Decided: Committee heard and laid over four education resolutions

The Education Committee heard four resolutions—Res 0842-2025, Res 1017-2025, Res 1018-2025, and Res 1019-2025—and then laid each over for further action. No vote tallies or approvals were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Children and Youth
Mon Nov 17, 2025 · Deferred

Committee on Transportation and Infrastructure

NYC Council to consider sidewalk cafe and repair laws

The Committee on Transportation and Infrastructure will consider five local laws regarding sidewalk cafes, newsracks, and property repair penalties. The committee will also hear a proposal to inventory city-owned retaining walls.

sidewalkscafestransportationinfrastructurenewsracksproperty-repair
250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Consumer and Worker Protection
Mon Nov 17, 2025 · Deferred

Committee on Consumer and Worker Protection

Council to consider civil penalties for unrepaired sidewalk defects

The Committee on Consumer and Worker Protection will consider six local law proposals. Items include imposing civil penalties on property owners who do not fix sidewalk defects, expanding access to roadway and sidewalk cafés, requiring an inventory of city‑owned retaining walls, updating newsrack requirements, and setting a maximum pedestrian path width in front of cafés. The committee will discuss each proposal but no decisions are recorded in the agenda.

sidewalkscaféspenaltiesretaining-wallsnewsracks
250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Transportation and Infrastructure.
Fri Nov 14, 2025 · 10:00 AM

Committee on Health

Council to consider banning horse-drawn cabs in NYC

The Committee on Health will review Local Law Int 0967-2024, which proposes to prohibit the operation of horse-drawn cabs in New York City. The legislation also seeks to repeal multiple sections of the city administrative code related to carriage horses and horse-drawn cabs. The council will decide whether to adopt the amendment and the repeals at this meeting.

transportationanimalslocal-lawcity-codehealth
✓ Decided: Committee defeats horse‑drawn cab ban proposal

The Health Committee voted to defeat Introduction No. 967, a local law that would have prohibited horse‑drawn cabs and repealed related code sections. The motion to approve the introduction failed by roll‑call vote. The vote recorded one affirmative, four negatives, two abstentions, and three absences.

250 Broadway - 8th Floor - Hearing Room 1 *Please note: Testimony will not be taken at this meeting
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0967-2024 — Defeated by Committee
4 nay · 3 absent · 2 abstain · 1 medical · 1 yea
Lynn C. Schulman abstain · Joann Ariola medical · Justin L. Brannan nay · Carmen N. De La Rosa nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro nay · Kristy Marmorato absent · Julie Menin absent · Mercedes Narcisse abstain · Susan Zhuang absent
Thu Nov 13, 2025 · 1:00 PM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council will consider designating five Manhattan buildings as landmarks

The Subcommittee will review five landmark designation applications for Manhattan properties. It will also evaluate site‑selection and acquisition proposals for new parks in Brooklyn and Queens. Additionally, it will consider an Urban Development Action Area project for a property on 108 Avenue in Queens.

landmarksparksurban-developmentmanhattanbrooklynqueens
✓ Decided: Subcommittee heard and laid over multiple landmark applications

The Subcommittee on Landmarks, Public Sitings and Dispositions held hearings on eight land‑use applications. Each application was subsequently laid over by the Subcommittee for further consideration. No approvals, denials, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Thu Nov 13, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Council to approve extending the city’s public communications franchise across all boroughs.

The Subcommittee on Zoning and Franchises will consider Resolution 1109-2025, which authorizes the Department of Information Technology & Telecommunications to extend the franchise for installation, operation, and maintenance of public communications structures in the Bronx, Brooklyn, Manhattan, Queens, and Staten Island. The committee will also review two land‑use applications for 1551 Broadway: LU 0429-2025 to amend sign provisions within the Theater Subdistrict, and LU 0430-2025 to grant a special permit modifying Times Square signage and street‑wall requirements. All items are scheduled for the November 13, 2025 meeting.

zoningfranchisecommunicationssignagemidtown
✓ Decided: Subcommittee heard items but took no formal action

The Subcommittee on Zoning and Franchises held a hearing on Resolution 1109‑2025 authorizing the Department of Information Technology & Telecommunications to extend its franchise. It also heard two land‑use applications, LU 0429‑2025 and LU 0430‑2025, concerning signage changes at 1551 Broadway. All three items were laid over by the subcommittee with no vote recorded.

250 Broadway - 8th Floor - Hearing Room 3
Thu Nov 13, 2025 · 11:00 AM

Committee on Finance

Committee will consider five local law proposals on land banks and tax liens

The Finance Committee will vote on five Local Law proposals. One creates a city land bank, while the others address the sale of tax liens, required notice to condominium boards about tax‑lien sales, reporting on chronically unresolved tax liens, and selling interests in tax liens to a land bank. The items are listed as Int 0570-2024-A, Int 1407-2025, Int 1411-2025, Int 1419-2025, and Int 1420-2025.

land-banktax-lienshousingfinancelegislation
✓ Decided: Finance Committee held hearings on several tax‑lien and land‑bank bills

The Committee on Finance heard introductions for five local laws concerning land banks and the sale of tax liens. No votes were taken; the introductions were either heard or laid over by the committee. The items included Int 0570‑2024 (land bank), Int 1407‑2025, Int 1411‑2025, Int 1419‑2025, and Int 1420‑2025 (tax‑lien related).

Committee Room - City Hall
Thu Nov 13, 2025 · Deferred

Committee on Sanitation and Solid Waste Management

Committee to review the 2026 Solid Waste Management Plan

The Committee on Sanitation and Solid Waste Management will hold an oversight hearing to discuss the City's 2026 Solid Waste Management Plan. The meeting is scheduled for Thursday, November 13, 2025, at 10:00 AM at City Hall.

sanitationwaste-managementoversightcity-hallsolid-waste
250 Broadway - 8th Floor - Hearing Room 1
Thu Nov 13, 2025 · 10:00 AM

Committee on Civil Service and Labor

Council to consider creating a city Department of Emergency Medical Services

The Committee on Civil Service and Labor will consider two local laws. The first proposes amending the city charter and administrative code to establish a Department of Emergency Medical Services. The second proposes amending the administrative code to correct excess pay differentials for paraprofessionals resulting from pattern bargaining practices. Both items are on the agenda for the November 13, 2025 meeting.

emergency-medicallaborpayrollcity-chartercivil-service
✓ Decided: Committee heard and laid over two introductions; no votes recorded

The Civil Service and Labor Committee held hearings on Introduction 0521‑2024 (establishing a Department of Emergency Medical Services) and Introduction 1261‑2025 (correcting excess pay differentials for paraprofessionals). Both introductions were subsequently laid over by the committee. No votes or final actions were taken.

Council Chambers - City Hall Jointly with the Committee on Governmental Operations, State & Federal Legislation
Thu Nov 13, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

Council to consider creating a Department of Emergency Medical Services

The Committee on Governmental Operations, State & Federal Legislation will consider a local law that amends the New York City charter and administrative code to establish a Department of Emergency Medical Services. It will also consider a local law that amends the administrative code to correct excess pay differentials for paraprofessionals arising from pattern bargaining practices. Both items are listed as introductions Int 0521-2024 and Int 1261-2025.

emergency-medicalcity-charterpay-equityparaprofessionalslegislation
✓ Decided: Committee held hearings on two introductions; no votes taken

The Committee on Governmental Operations, State & Federal Legislation heard introductions for Int 0521-2024 (establishing a department of emergency medical services) and Int 1261-2025 (correcting excess pay differentials for paraprofessionals). Both items were laid over by the Committee with no vote recorded.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor.
Thu Nov 13, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee to hold oversight hearing on NYC's bus system

The Committee on Transportation and Infrastructure will conduct an oversight hearing regarding the city's bus network, operations, equity, and redesign. Members will also consider several local laws and resolutions concerning bus lanes, MTA schedules, and fare discounts.

transportationmtabusestransit-farespublic-safety
✓ Decided: Committee held hearings on multiple transportation oversight and resolution items

The Transportation and Infrastructure Committee conducted hearings on a bus system oversight, several local law introductions, and multiple resolutions related to the MTA and transit policies. No votes or formal approvals were recorded; items were heard and laid over. The meeting was procedural.

250 Broadway - 8th Floor - Hearing Room 2
Thu Nov 13, 2025 · Deferred

Committee on Housing and Buildings

Council reviews three co‑op sale transparency bills

The Committee on Housing and Buildings will consider three local law proposals that would amend the city’s administrative code regarding cooperative apartment sales. The bills address the sale process, require co‑op corporations to give financial information to prospective buyers, and set timelines for approving or denying sales. A related amendment, Int. No. 1120‑A, is also on the agenda.

housingco-opstransparencylegislationcity-council
250 Broadway - 8th Floor - Hearing Room 1
Wed Nov 12, 2025 · 11:30 AM

Committee on Governmental Operations, State & Federal Legislation

City charter amendment to require borough and community boards to publish bylaws

The Committee on Governmental Operations, State & Federal Legislation will consider Local Law Int. No. 1250‑A, a proposed amendment to the New York City Charter. The amendment would require borough boards, community boards, and advisory bodies to publish their bylaws. The committee will vote on the proposal at the November 12, 2025 meeting.

charterlocal-lawbylawsgovernmental-operations
✓ Decided: Committee approved Intro 1250-2025-A to amend city charter

The Committee on Governmental Operations, State & Federal Legislation approved Introduction 1250-2025-A, a local law to amend the New York City charter concerning publication of bylaws by borough boards, community boards, and advisory bodies. The motion passed with seven members voting affirmative and two members absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1250-2025 — Approved by Committee
7 yea · 2 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Frank Morano yea · Lynn C. Schulman yea · Inna Vernikov absent
Wed Nov 12, 2025 · 11:30 AM

Committee on General Welfare

Council will consider a local law to study burial capacity on Hart Island

The Committee on General Welfare will consider Introduction 1408‑2025 A, a local law concerning a study and report on burial capacity on Hart Island. Council members will discuss the proposal during the hearing. No other agenda items are listed.

burial-capacityhart-islandlocal-lawgeneral-welfare
✓ Decided: Committee on General Welfare approves Hart Island burial study introduction

The Committee on General Welfare approved Introduction Int 1408‑2025‑A, a local law to study and report on burial capacity on Hart Island. The motion passed with five members voting affirmative (Banks, Ossé, Restler, Riley, Ung) while four members were absent (Ayala, Avilés, Cabán, Stevens). No other measures were adopted during the meeting.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1408-2025 — Approved by Committee
5 yea · 4 absent
Diana I. Ayala absent · Alexa Avilés absent · Chris Banks yea · Tiffany L. Cabán absent · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens absent · Sandra Ung yea
Wed Nov 12, 2025 · 11:15 AM

Committee on Land Use

NYC Council Land Use Committee to consider multiple Brooklyn rezonings

The Committee on Land Use will hear applications to rezone properties in Brooklyn, including changes to zoning districts and the creation of mandatory inclusionary housing areas.

zoningland-usebrooklyninclusionary-housingrezoningcouncil-agenda
✓ Decided: Committee approved nine rezoning applications, most with companion resolutions

The Land Use Committee voted 9‑2 to approve multiple rezoning and inclusionary‑housing applications across Brooklyn. Several applications were approved with modifications and referred to the City Planning Commission. Council members Ayala and Hanks were absent for all votes.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
LU 0405-2025 — Approved by Committee with Companion Resolution
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0406-2025 — Approved by Committee with Companion Resolution
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0407-2025 — Approved by Committee with Companion Resolution
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0408-2025 — Approved by Committee with Companion Resolution
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0409-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0410-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0424-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0425-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0428-2025 — Approved by Committee with Companion Resolution
9 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Wed Nov 12, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will consider multiple Brooklyn rezoning and inclusionary housing proposals

The Subcommittee on Zoning and Franchises will review several applications to amend the Zoning Map and Zoning Resolution for properties in Brooklyn. Proposals include rezoning 58 Nixon Court from R5 to R7A with a C2-4 district and establishing a Mandatory Inclusionary Housing area. Additional rezoning applications cover 464 Ovington Avenue, 5502 Flatlands Avenue, and 699-703 Lexington Avenue, each changing district designations and adding C2-4 districts. The committee will also consider a follow-up action to amend floor-area regulations for the Special Atlantic Avenue Mixed Use District.

zoninghousinginclusionary-housingbrooklynrezoning
✓ Decided: Subcommittee approved rezoning of 58 Nixon Court from R5 to R7A

The Subcommittee on Zoning and Franchises approved several land‑use applications, including the rezoning of 58 Nixon Court. Four members voted in favor, two were absent, and one member voted medically for each motion. Several applications were approved with modifications and referred to the City Planning Commission.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
LU 0405-2025 — Approved by Subcommittee
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0406-2025 — Approved by Subcommittee
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0407-2025 — Approved by Subcommittee
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0408-2025 — Approved by Subcommittee
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0409-2025 — Approved by Subcommittee with Modifications and Referred to CPC
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0410-2025 — Approved by Subcommittee with Modifications and Referred to CPC
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0424-2025 — Approved by Subcommittee with Modifications and Referred to CPC
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0425-2025 — Approved by Subcommittee with Modifications and Referred to CPC
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
LU 0428-2025 — Approved by Subcommittee
4 yea · 2 absent · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya medical · Yusef Salaam absent · Lynn C. Schulman yea
Wed Nov 12, 2025 · 11:00 AM

Committee on Sanitation and Solid Waste Management

Amendment to city code on stationary on‑street residential refuse containers

The Committee on Sanitation and Solid Waste Management will consider a proposed local law (Int. No. 1123‑B) to amend the New York City Administrative Code regarding stationary on‑street containers for residential refuse collection. The item is listed as Int 1123‑2024 A on the agenda.

sanitationsolid-wastelocal-lawrefuse-containers
✓ Decided: Committee approved Local Law Int 1123-2024-B on on‑street refuse containers

The Committee on Sanitation and Solid Waste Management voted to approve Introduction Int 1123-2024-B, a Local Law amending the city code regarding stationary on‑street containers for residential refuse. The motion passed with seven affirmative votes and three negative votes. Members absent were Paladino, Vernikov, and Zhuang.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 1123-2024 — Approved by Committee
7 yea · 3 nay · 3 absent
Shaun Abreu yea · Chris Banks yea · David M. Carr nay · Simcha Felder nay · James F. Gennaro yea · Julie Menin yea · Frank Morano nay · Sandy Nurse yea · Vickie Paladino absent · Rafael Salamanca, Jr. yea · Sandra Ung yea · Inna Vernikov absent · Susan Zhuang absent
Wed Nov 12, 2025 · 11:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Organizations

Council to consider designating Black Solidarity Day and Alpha Kappa Alpha Day

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations will consider two resolutions. Resolution 1133-2025 would declare the first Monday of November as Black Solidarity Day in New York City. Resolution 1134-2025 would declare January 15 as Alpha Kappa Alpha Sorority, Incorporated Day in New York City. Both items are listed as pre‑considered for the November 12 meeting.

cultural-affairsobservancescity-councilholidays
✓ Decided: Committee approves two citywide cultural day resolutions

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations approved Resolution 1133-2025, designating the first Monday of November as Black Solidarity Day (6‑1 vote). It also approved Resolution 1134-2025, designating January 15 as Alpha Kappa Alpha Sorority, Incorporated Day (7‑0 vote). Both motions passed by roll‑call.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 1133-2025 — P-C Item Approved by Comm
6 yea · 1 nay · 1 medical · 1 absent
Erik D. Bottcher yea · David M. Carr nay · Shahana K. Hanif medical · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams yea
The other 1 item passed by unanimous or near-unanimous consent.
Wed Nov 12, 2025 · 10:30 AM

Committee on Consumer and Worker Protection

Local laws on home improvement permits and business licensing reforms

The Committee on Consumer and Worker Protection will consider two proposed local laws. The first would require home‑improvement contractors to give owners information about required permits and to conduct public outreach about contractors working without permits. The second would reform several business licensing requirements, including those for locksmiths, process servers, electronic and appliance service dealers, distributors, and electronics stores, and would repeal certain sections of the code. Both items are scheduled for discussion at the November 12, 2025 meeting.

local-lawhousingbusiness-licensingconsumer-protectionworker-protection
✓ Decided: Committee approves two local law introductions on contractor permits and licensing

The Committee on Consumer and Worker Protection approved Introduction 1193-2025-A, which requires home improvement contractors to provide permit information and includes public outreach. The committee also approved Introduction 1308-2025-A, which reforms various business licensing requirements. Both motions passed by a 5‑1 vote, with one member absent.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1193-2025 — Approved by Committee
5 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan absent · Chi A. Ossé yea
Int 1308-2025 — Approved by Committee
5 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan absent · Chi A. Ossé yea
Wed Nov 12, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee will consider a local law to amend the code for pedestrian lighting fixtures

The Transportation and Infrastructure Committee will hold a hearing on Int. 0079-2024, a proposed local law to amend the New York City administrative code regarding the installation of pedestrian lighting fixtures. Members will discuss the amendment and decide whether to advance it. The meeting is scheduled for November 12, 2025 at 10:00 AM in Hearing Room 3, City Hall.

transportationinfrastructurelightinglocal-lawcity-code
✓ Decided: Committee approves pedestrian lighting fixtures introduction

The Committee on Transportation and Infrastructure approved Introduction Int 0079-2024-A, a local law to amend the city’s administrative code regarding installation of pedestrian lighting fixtures. The motion was approved by roll call with all eight members voting affirmative. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0079-2024 — Approved by Committee
8 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won yea
Wed Nov 12, 2025 · 1:30 PM

City Council Stated Meeting

City Council considers Brooklyn rezonings and business license reforms

The City Council is reviewing several zoning amendments in Brooklyn and proposed changes to business licensing requirements. The body is also considering tax exemptions for Cold War veterans and updates to business improvement district expenditures.

zoningbusiness-licensingtax-exemptionsbrooklynhousing
✓ Decided: Council approves eight local law introductions and several land‑use tax exemptions

The New York City Council approved by consent multiple introductory local laws, including measures on home‑improvement contractor disclosures, business licensing reforms, a Cold War veterans property‑tax exemption, and increased spending for business improvement districts. The council also voted 44‑0‑1 to approve a local law expanding BID budgets. Land‑use applications for Henry Phipps Plaza East and a Bronx cluster were approved, along with resolutions granting property‑tax exemptions for those sites.

Council Chambers - City Hall
🗳️ How they voted — 5 divided votes
Named votes as recorded in the official record.
Int 1123-2024 — Approved by Council
30 yea · 11 nay · 5 absent · 4 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks abstain · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Tiffany L. Cabán absent · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis nay · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens absent · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
LU 0398-2025 — Approved, by Council
42 yea · 5 absent · 2 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán absent · David M. Carr abstain · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens absent · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 1151-2025 — Approved, by Council
42 yea · 5 absent · 2 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán absent · David M. Carr abstain · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens absent · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0399-2025 — Approved, by Council
42 yea · 5 absent · 2 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán absent · David M. Carr abstain · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens absent · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 1152-2025 — Approved, by Council
42 yea · 5 absent · 2 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán absent · David M. Carr abstain · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens absent · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 36 items passed by unanimous or near-unanimous consent.
Wed Nov 12, 2025 · 10:00 AM

Committee on Finance

Committee on Finance to review tax exemptions and business improvement districts

The Committee on Finance is meeting to discuss several proposed local laws regarding tax exemptions and business improvement districts. The body will also consider land use items for properties in Manhattan and the Bronx.

taxesbusiness-improvement-districtszoningland-useveterans
✓ Decided: Committee on Finance approves tax exemption for Cold War veterans

The Finance Committee approved Introduction 0740-2024-A, creating a real‑property tax exemption for Cold War veterans. The committee also approved three other introductions affecting business improvement districts and two land‑use applications, each by roll‑call vote with 12 affirmative votes, 2 non‑voting members, and 3 absent members.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0740-2024 — Approved by Committee
12 yea · 5 absent
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers absent · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won yea
Int 1410-2025 — Approved by Committee
12 yea · 5 absent
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers absent · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won yea
Int 1428-2025 — Approved by Committee
12 yea · 5 absent
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers absent · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won yea
LU 0431-2025 — P-C Item Approved by Committee with Companion Resolution
12 yea · 5 absent
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers absent · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won yea
LU 0432-2025 — P-C Item Approved by Committee with Companion Resolution
12 yea · 5 absent
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers absent · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won yea
Thu Oct 30, 2025 · 10:00 AM

Committee on Children and Youth

Council committee considers resolution to aid foster youth education resources

The Committee on Children and Youth will review the oversight item T2025-4155, which evaluates ACS Family Enrichment Centers. It will also consider Resolution 0843-2025, which calls on the New York State Assembly and Governor to enact bill A5658A/S378. The resolution directs the State Education Department and the Office of Children and Family Services to create posters and pamphlets about higher‑education financial resources for foster youth.

youtheducationfoster-careoversightlegislation
✓ Decided: Committee held oversight hearing, no decisions were made

The Committee on Children and Youth met on Oct. 30, 2025 and conducted an oversight hearing. The meeting reviewed Resolution 0843‑2025 and related committee reports. No actions were approved, denied, or voted on during this session.

250 Broadway - 8th Floor - Hearing Room 2
Thu Oct 30, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Council will vote on a law setting security guard pay and training standards

The Committee on Consumer and Worker Protection will consider Int 1391‑2025, a local law amendment to the New York City Administrative Code. The proposal would establish compensation and training standards for security guards. The committee will vote on the measure during the meeting.

security-guardslaborwagestraininglocal-law
✓ Decided: Committee heard security guard compensation bill, then laid it over

The Committee on Consumer and Worker Protection held a hearing on Intro. No. 1391‑2025, which would amend the city code to set compensation and training standards for security guards. After the hearing, the committee laid the measure over, meaning it was postponed with no vote taken.

Council Chambers - City Hall
Thu Oct 30, 2025 · 10:00 AM

Committee on Finance

Council considers a tax exemption for Cold War veterans' property.

The Committee on Finance will consider Int 0740-2024, a local law amendment to create a real property tax exemption for Cold War veterans. The proposal would amend the city's administrative code to provide the exemption. No other agenda items are listed for this meeting.

property-taxveteransfinance
✓ Decided: Committee held hearing on tax exemption for Cold War veterans

The Committee on Finance held a hearing on Introduction 0740-2024, a local law to create a real‑property tax exemption for Cold War veterans. The committee also laid the introduction over. No vote or final decision was recorded.

Committee Room - City Hall
Thu Oct 30, 2025 · Deferred

Committee on Technology

Oversight of the Office of Technology and Innovation’s contract procurement role

The Committee on Technology will hold an oversight hearing on the role of the Office of Technology and Innovation in procuring technology contracts for city agencies. The hearing is conducted jointly with the Committee on Contracts. No specific decisions are indicated; the agenda item is for discussion and review.

technologycontractsoversightcity-agency
250 Broadway - 8th Floor - Hearing Room 2 Jointly with the Committee on Contracts
Thu Oct 30, 2025 · 1:00 PM

Committee on Education

Council to consider law requiring DOE to report on manifestation determination reviews

The Education Committee will hold a hearing on two proposed local laws. The first, Int 1359-2025, would amend the city’s administrative code to require the Department of Education to report on manifestation determination reviews. The second, Int 1360-2025, would amend the code to require outreach about youth programs provided by the police department. The committee will consider and vote on these proposals.

educationlocal-lawyouth-programspolicespecial-education
✓ Decided: Committee held hearings on two education-related introductions

The Education Committee conducted hearings on Introduction 1359‑2025, a local law requiring the Department of Education to report on manifestation determination reviews, and Introduction 1360‑2025, a local law concerning police department youth‑program outreach. Both introductions were laid over by the committee after the hearings. No votes or final actions were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Thu Oct 30, 2025 · 10:00 AM

Committee on Oversight and Investigations

Committee will hold hearing on Right to Counsel in Housing Court

The New York City Council Committee on Oversight and Investigations will hold a hearing to examine the Right to Counsel program in Housing Court. The meeting is scheduled for Thursday, October 30, 2025 at 10:00 AM in Hearing Room 3, 250 Broadway, 8th Floor. The agenda lists the item as T2025-4225.

housinglegal-aidcourtoversight
✓ Decided: Committee held oversight hearing on right to counsel in housing court

The Oversight and Investigations Committee met on Oct. 30, 2025. Members present included Brewer, Felder, Krishnan, Morano, Restler, Williams, Ayala, Banks, Joseph, and Won. The committee conducted a hearing on item T2025‑4225 concerning the right to counsel in housing court. No votes or formal decisions were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Thu Oct 30, 2025 · Deferred

Committee on Contracts

Council examines how the Office of Technology and Innovation procures city tech contracts.

The Committee on Contracts will hold an oversight hearing on the Office of Technology and Innovation’s role in procuring technology contracts for city agencies. The discussion will be conducted jointly with the Committee on Technology. No specific contracts or budget amounts are listed for approval.

oversighttechnologycontractscity-agenciescommittee
250 Broadway - 8th Floor - Hearing Room 2 Jointly with the Committee on Technology.
Wed Oct 29, 2025 · 9:30 AM

Committee on Aging

Resolution urging Congress to protect Social Security

The Committee on Aging will consider Resolution No. 852-A, which calls on the United States Congress and the President to take steps to protect Social Security. The resolution is scheduled for discussion at the committee meeting on October 29, 2025.

social-securityfederal-policyaginglegislation
✓ Decided: Committee on Aging approves resolution urging Congress to protect Social Security

The Committee on Aging approved Resolution 0852-2025, which calls on the United States Congress and the President to take steps to protect Social Security. The motion passed with six members voting affirmative and one member absent. No other measures were adopted.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0852-2025 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee yea · Darlene Mealy absent · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Wed Oct 29, 2025 · 10:00 AM

Committee on Hospitals

Resolution urging state health dept to share maternal data with NYC review

The Committee on Hospitals will consider four proposed resolutions. Each resolution calls on the New York State Department of Health or NYC health facilities to improve reporting, sharing, and coding of adverse maternal health events. The resolutions aim to provide confidential data to the NYC Maternal Mortality Review Committee and to standardize definitions and reporting requirements.

maternal-healthdata-sharinghealth-departmentcity-councilhospitals
✓ Decided: Committee on Hospitals approved four resolutions on maternal health data

The Committee on Hospitals approved four resolutions (1082‑2025‑A, 1085‑2025‑A, 1086‑2025‑A, 1087‑2025‑A) urging the New York State Department of Health and NYC Health + Hospitals to share, report, code, and regularly review adverse maternal health event data through NYPORTS. All six council members voted affirmatively, with the medical member also supporting each resolution.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Res 1082-2025 — Approved by Committee
6 yea · 1 medical
Mercedes Narcisse yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Jennifer Gutiérrez yea · Kristy Marmorato yea · Francisco P. Moya yea · Vickie Paladino medical
Res 1085-2025 — Approved by Committee
6 yea · 1 medical
Mercedes Narcisse yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Jennifer Gutiérrez yea · Kristy Marmorato yea · Francisco P. Moya yea · Vickie Paladino medical
Res 1086-2025 — Approved by Committee
6 yea · 1 medical
Mercedes Narcisse yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Jennifer Gutiérrez yea · Kristy Marmorato yea · Francisco P. Moya yea · Vickie Paladino medical
Res 1087-2025 — Approved by Committee
6 yea · 1 medical
Mercedes Narcisse yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Jennifer Gutiérrez yea · Kristy Marmorato yea · Francisco P. Moya yea · Vickie Paladino medical
Wed Oct 29, 2025 · 1:30 PM

City Council Stated Meeting

Council will consider raising spending for seven BIDs and a special assessment district

The City Council will adopt minutes from its October 9, 2025 meeting and receive the Mayor’s FY 2025 Management Report. Council members will consider mayoral appointments to the Board of Health, Environmental Control Board, and City Planning Commission, and will review three zoning applications for signage and park‑site selections in Manhattan, Queens, and Brooklyn. The Finance Committee will vote on increasing annual spending for seven business improvement districts and a special assessment district, along with other tax‑base and district‑plan resolutions.

zoningfinanceboard-appointmentsbusiness-improvement-districtstax-base
✓ Decided: Council approves tax preparer itemization law and several land‑use items

The City Council approved Local Law Int 1231‑2025‑A, requiring tax preparers to give itemized charge statements, by a vote of 40‑7. The Council also approved three land‑use call‑ups—1551 Broadway signage amendment, Queens CD 3 walk‑to‑park site selection, and Brooklyn CD 5 walk‑to‑park site selection—by consent. Introductions for self‑storage fee disclosures (Int 495‑A), firearm consumer warnings (Int 1016‑A), and self‑storage licensing reforms (Int 1290‑A) were likewise approved by consent. Minutes of the Oct 9, 2025 meeting were adopted and several mayoral appointment messages were referred to the Rules Committee.

Council Chambers - City Hall
Wed Oct 29, 2025 · 11:45 AM

Committee on Land Use

Committee to consider extensive Long Island City zoning amendments

The Land Use Committee will review multiple applications, including a UDAAP amendment for Taylor Wooten Estates in Brooklyn, a tax‑exemption request for several Lincoln Avenue properties, and a series of zoning map changes that reshape districts throughout Long Island City and create a new Special Long Island City District. Additional items include a lease of a 42,000‑sq‑ft parcel at 1225 Gerard Avenue and several dispositions of city‑owned property for redevelopment projects in Queens and the Bronx.

zoningtax-exemptionurban-developmenthousingredevelopmentqueensbrooklynbronx
✓ Decided: Committee approved multiple land‑use applications, including a tax exemption and zoning changes

The Land Use Committee unanimously approved the Taylor Wooten Estates UDAAP amendment (LU 0345‑2025) and a property tax‑exemption request (LU 0346‑2025). It also approved the Long Island City Neighborhood Plan applications (LU 0373‑2025, LU 0374‑2025, LU 0375‑2025, LU 0376‑2025) with modifications and referred them to the City Planning Commission. All votes were recorded as affirmative by all 11 members.

Committee Room - City Hall
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
LU 0345-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0346-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0373-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0374-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0375-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0376-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0377-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0378-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0383-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0384-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0385-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0386-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0387-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0388-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0389-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0390-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0391-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0392-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0397-2025 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0399-2025 — Approved by Committee with Modifications and Referred to CPC
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joann Ariola yea · Diana I. Ayala yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Wed Oct 29, 2025 · 11:30 AM

Subcommittee on Zoning and Franchises

Long Island City zoning map amendment with multiple district changes considered

The Subcommittee on Zoning and Franchises will consider a series of applications affecting zoning, inclusionary housing, and property disposition in Queens and Brooklyn. Items include a comprehensive amendment to the Long Island City zoning map, a Mandatory Inclusionary Housing designation, several urban development action area proposals, and special permits for the Domino Site B development. The committee will vote on these proposals or refer them for further action.

zoninginclusionary-housingurban-developmentproperty-dispositionspecial-permitslong-island-citybrooklyn
✓ Decided: Subcommittee approved seven Long Island City zoning applications with modifications

The Zoning and Franchises Subcommittee voted to approve seven land‑use applications related to the Long Island City Neighborhood Plan, each with modifications and referral to the City Planning Commission. All motions passed unanimously with seven affirmative votes and no opposition. No other substantive actions were taken at this meeting.

Committee Room - City Hall
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
LU 0373-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0374-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0375-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0376-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0377-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0378-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0392-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0397-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0398-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0399-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0400-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0401-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0402-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0403-2025 — Disapproved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed Oct 29, 2025 · 11:15 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council to review Kingsbridge Armory redevelopment and housing projects

The Subcommittee on Landmarks, Public Sitings and Dispositions is reviewing several land-use applications. These include zoning changes and property dispositions for the Kingsbridge Armory, senior living in Queens, and housing estates in Brooklyn.

zoninghousingland-usebronxbrooklynqueensreal-estate
✓ Decided: Subcommittee approves seven land use applications, all 6‑0 votes

The Subcommittee on Landmarks, Public Sitings and Dispositions voted to approve seven land‑use applications covering amendments, tax exemption, a lease, and zoning changes. Each motion passed with six members voting affirmative and one member absent. No other actions were taken.

Committee Room - City Hall
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
LU 0345-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0346-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0383-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0384-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0385-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0386-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0387-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0388-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0389-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0390-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0391-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
Wed Oct 29, 2025 · 11:00 AM

Committee on Finance

Council to vote on raising annual spending for seven BIDs and one special assessment district

The Finance Committee will consider Resolution 1083-2025 to increase the amount expended annually in seven business improvement districts and one special assessment district. It will also review resolutions designating funding recipients (T2025-4308), establishing the Coney Island Business Improvement District (T2025-4349), amending the Lincoln Square BID assessment method (T2025-4393), and a one‑percent increase in the base proportion for property tax calculations for Fiscal 2026 (T2025-4388). Additional items include amendments to property‑tax computation resolutions and several land‑use designations.

financebudgetbusiness-improvement-districtsproperty-taxtaxation
✓ Decided: Finance Committee approved a 1% property tax base increase for FY 2026

The Committee on Finance approved several resolutions, including a 1% increase in the property tax base proportion for fiscal year 2026. It also approved new designations for business improvement districts and multiple land‑use applications. All approvals were recorded by roll‑call vote with 12 members in favor and 5 absent.

Committee Room - City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 1100-2025 — P-C Item Approved by Comm
11 yea · 5 absent · 1 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías absent · Kamillah Hanks absent · Crystal Hudson absent · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won absent
The other 10 items passed by unanimous or near-unanimous consent.
Wed Oct 29, 2025 · 10:30 AM

Committee on Governmental Operations, State & Federal Legislation

Council to consider charter amendment on agency race and ethnicity data

The Committee on Governmental Operations, State & Federal Legislation will consider Int. No. 1134‑A, a local law that would amend the New York City charter to require city agencies to collect race and ethnicity data. The proposal updates data‑collection requirements across agencies. The committee will discuss and may vote on the amendment during the October 29 meeting.

charterdata-collectionrace-ethnicitylegislationgovernment-operations
✓ Decided: Committee approves Introduction 1134-2024-A to amend charter on race data

The Committee on Governmental Operations, State & Federal Legislation voted to approve Introduction 1134-2024-A, a local law amendment to the city charter concerning race and ethnicity data collected by agencies. The motion passed by roll call with all nine members voting affirmative.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1134-2024 — Approved by Committee
9 yea
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Frank Morano yea · Lynn C. Schulman yea · Inna Vernikov yea
Wed Oct 29, 2025 · 10:30 AM

Committee on Women and Gender Equity

Committee to consider laws on doula services and pregnancy health education

The Committee on Women and Gender Equity will meet to discuss two proposed local laws: one establishing a citywide doula program and another requiring an education campaign on managing chronic diseases during and after pregnancy.

healthwomenpolicyeducationpregnancy
✓ Decided: Committee approved citywide doula program and pregnancy health education bills

The Committee on Women and Gender Equity approved Introduction 1285-2025-A, a local law to establish a citywide doula program. The Committee also approved Introduction 1393-2025-A, a local law to create an education campaign on healthy living and managing chronic diseases during and after pregnancy. Both measures passed by unanimous roll‑call vote of the five members.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1285-2025 — Approved by Committee
5 yea
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov yea
Int 1393-2025 — Approved by Committee
5 yea
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov yea
Wed Oct 29, 2025 · 10:30 AM

Committee on Small Business

Local Law Int. 1132-A to amend small business regulatory education services

The Committee on Small Business will hold a hearing on Int. 1132-A, a proposed local law to amend the New York City administrative code. The amendment concerns regulatory education services provided to small businesses. The committee will discuss and decide whether to adopt the proposal.

small-businesslocal-lawregulationeducation
✓ Decided: Committee approves Introduction 1132-2024-A for small business regulation

The Committee on Small Business voted to approve Introduction 1132-2024-A, a local law amending the city’s administrative code on regulatory education services for small businesses. The motion passed with five affirmative votes; one member was absent and one was medically excused. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1132-2024 — Approved by Committee
5 yea · 1 medical · 1 absent
Oswald J. Feliz yea · Erik D. Bottcher yea · Selvena N. Brooks-Powers yea · Shekar Krishnan yea · Vickie Paladino medical · Sandra Ung absent · Susan Zhuang yea
Wed Oct 29, 2025 · 10:00 AM

Committee on Health

Health Committee to consider laws on brain injuries, child health, and opioid care

The Committee on Health is reviewing several proposed local laws and resolutions. These include mandates for first responder training and the expansion of newborn home visiting programs. The committee is also considering resolutions urging New York State to change telehealth reimbursement and disability insurance payments.

healthpublic-safetymaternal-healthopioidstelehealth
✓ Decided: Committee approved first‑responder training law for domestic‑violence brain injuries

The Committee on Health approved four local laws. Int 0029-2024 (first‑responder training on domestic‑violence brain injuries) passed with a 9‑0 vote. Int 1001-2024-A (automated text‑messaging for children’s health) and Int 1146-2024-A (newborn home‑visiting program) each passed with 9‑0 votes. The committee also approved Int 1284‑2025‑A (opioid education and antagonist distribution), though the vote count was not listed.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Int 0029-2024 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Int 1001-2024 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Int 1146-2024 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Int 1284-2025 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Res 0064-2024 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Res 0867-2025 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Res 0868-2025 — Approved by Committee
9 yea · 1 medical · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Justin L. Brannan yea · Carmen N. De La Rosa yea · Simcha Felder yea · Oswald J. Feliz medical · James F. Gennaro yea · Kristy Marmorato absent · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Wed Oct 29, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Organizations

Council committee considers designating October as Black Boy Joy Month

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations is meeting to discuss a resolution regarding a monthly designation. The body will review a proposal to recognize October annually as Black Boy Joy Month in New York City.

cultural-affairsresolutionpublic-recognition
✓ Decided: Committee approved resolution designating October as Black Boy Joy Month

The Committee on Cultural Affairs, Libraries and International Intergroup Organizations voted to adopt Resolution 0969-2025, designating October annually as Black Boy Joy Month in New York City. The resolution was amended by the committee and then approved. Eight members voted in favor and one member was absent.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0969-2025 — Approved by Committee
8 yea · 1 absent
Erik D. Bottcher yea · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung absent · Nantasha M. Williams yea
Wed Oct 29, 2025 · 9:30 AM

Committee on Consumer and Worker Protection

Committee considers new rules for self-storage and tax preparer disclosures

The Committee on Consumer and Worker Protection is reviewing four proposed local laws. These include regulations for self-storage facilities and requirements for tax preparers and firearm sellers.

consumer-protectionself-storagetax-preparationfirearmslicensing
✓ Decided: Committee approved four bills, covering storage fees and firearm warnings

The Committee on Consumer and Worker Protection approved four introductions by roll call. Each bill – Int 0495‑2024‑A (fee disclosures for self‑storage facilities), Int 1016‑2024‑A (consumer warnings for rifles, shotguns and firearms), Int 1231‑2025‑A (tax preparer charge statements), and Int 1290‑2025‑A (licensing and reforms for self‑storage facilities) – was approved unanimously by the six members present.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 0495-2024 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1016-2024 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1231-2025 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Int 1290-2025 — Approved by Committee
6 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea
Wed Oct 29, 2025 · 9:30 AM

Committee on Civil Service and Labor

Council committee to consider resolution condemning Alden Global Capital's cuts

The Committee on Civil Service and Labor will consider Resolution 1015-2025. The resolution condemns Alden Global Capital's staff cuts and managerial hostility toward the unionized Daily News workforce. It calls on the hedge fund to reach a contract agreement with the newspaper’s union.

labormediaunionresolutioncity-council
✓ Decided: Committee approves resolution condemning Alden Global Capital cuts

The Committee on Civil Service and Labor approved Resolution 1015-2025, which condemns Alden Global Capital's cuts and managerial hostility toward unionized Daily News staff and calls on the hedge fund to reach a contract deal with the newspaper’s union. The motion passed with eight affirmative votes, one negative vote, and one member recorded as medical. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 1015-2025 — Approved by Committee
8 yea · 1 medical · 1 nay
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz medical · Kamillah Hanks yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Yusef Salaam yea
Wed Oct 29, 2025 · 9:00 AM

Committee on Public Housing

Council will consider a local law to require reporting on vacant NYCHA units

The Committee on Public Housing will consider Int. No. 111-A, a local law amendment to the city’s administrative code. The proposal would require the New York City Housing Authority to report on vacant housing units. The meeting is scheduled for October 29, 2025 at 9:00 AM in Hearing Room 2, 250 Broadway.

housingnychareportinglocal-lawpublic-housing
✓ Decided: Committee approves Local Law on reporting vacant NYCHA units

The Committee on Public Housing voted to approve Introduction No. 111-A, a local law amending the city administrative code regarding reporting on vacant New York City Housing Authority dwelling units. The motion passed with seven members voting in favor and two members absent. No other measures were adopted during the meeting.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0111-2024 — Approved by Committee
7 yea · 2 absent
Chris Banks yea · Alexa Avilés yea · Erik D. Bottcher yea · Justin L. Brannan yea · Darlene Mealy absent · Chi A. Ossé yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Julie Won absent
Wed Oct 29, 2025 · 9:00 AM

Committee on Education

Council asks state to require water safety info in schools

The Committee on Education will vote on a resolution urging the New York State Legislature and Governor to pass laws requiring school districts to send water safety materials home and provide water safety instruction to K-12 students.

educationwater-safetyresolutionpublic-hearingcouncil-committee
✓ Decided: Education Committee approves water safety resolution

The Committee on Education approved Resolution 0501-2024-A, which calls on the New York State Legislature and the Governor to pass A.1080 and a companion Senate bill requiring school districts to send water‑safety information to parents and to provide water‑safety instruction for K‑12 students. The motion was approved by roll call, with all members voting affirmative and Councilmember Hanks recorded as absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0501-2024 — Approved by Committee
12 yea · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Wed Oct 29, 2025 · Deferred

Committee on Sanitation and Solid Waste Management

Committee will consider a local law amendment on on‑street residential trash containers

The Sanitation and Solid Waste Management Committee will hear a proposed local law amendment. The legislation, Int. No. 1123‑A, would modify the city’s administrative code regarding stationary on‑street containers used for residential refuse collection. The committee will vote on whether to adopt the amendment.

sanitationwaste-managementlocal-lawresidential-refusecontainers
250 Broadway - 8th Floor - Hearing Room 3 VOTE*
Tue Oct 28, 2025 · 1:00 PM

Committee on Fire and Emergency Management

Committee reviews fire safety and permitting for community energy storage

The Committee on Fire and Emergency Management will hold an oversight hearing. The discussion focuses on fire safety and permitting approval for community energy storage facilities.

fire-safetyenergy-storagepermittingoversight
✓ Decided: Committee held oversight hearing on fire safety for community energy storage

The Committee on Fire and Emergency Management convened a hearing (T2025-3595) on fire safety and permitting for community energy storage facilities. No approvals, denials, or votes were recorded in the minutes.

Council Chambers - City Hall
Tue Oct 28, 2025 · 10:00 AM

Committee on Immigration

Council committee to discuss legal services for immigrants and condemn federal guard actions.

The Committee on Immigration will hold an oversight hearing on legal services for immigrant New Yorkers and consider a resolution condemning the Trump administration's use of the National Guard.

immigrationoversightnational-guardlegal-servicescouncil-resolution
✓ Decided: Immigration Committee held hearings and filed items, no decisions taken

The Committee on Immigration held a hearing on Oversight T2025-4224 concerning legal services for immigrant New Yorkers and filed the oversight item. It also held a hearing on Resolution 1014-2025 condemning the Trump administration's use of a federalized National Guard and laid the resolution over. No votes, approvals, or rejections were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Tue Oct 28, 2025 · Deferred

Committee on Finance

Agenda items have not been announced for this Finance Committee meeting.

The New York City Council Committee on Finance will meet on Tuesday, October 28, 2025 at 10:00 AM in the Council Chambers at City Hall. The agenda for the meeting has not been released, as indicated by the placeholder “AGENDA TO BE ANNOUNCED.” No specific items or decisions are listed at this time.

financecity-councilbudgetnyc
Council Chambers - City Hall
Tue Oct 28, 2025 · Deferred

Subcommittee on Landmarks, Public Sitings and Dispositions

Council reviews Kingsbridge Armory redevelopment and housing projects

The Subcommittee on Landmarks, Public Sitings and Dispositions is reviewing land use applications for housing and city-owned property dispositions. Key items include the redevelopment of the Kingsbridge Armory and several senior and residential housing projects across Brooklyn, Queens, and the Bronx.

zoninghousingland-usereal-estatebronxbrooklynqueens
250 Broadway - 8th Floor - Hearing Room 2
Tue Oct 28, 2025 · 1:00 PM

Committee on Economic Development

Resolution urging NYCEDC to expand ferry service to LaGuardia Airport

The Economic Development Committee will consider several local laws concerning NYC Ferry operations, including annual reporting on shore‑power use at cruise terminals, reduced‑cost ferry service for middle‑school students, a feasibility study of zero‑emission port operations, and language accessibility at ferry terminals. It will also consider resolutions urging the NYC Economic Development Corporation to expand ferry service to LaGuardia Airport, urging Congress to pass the Ensuring Diversity in Community Banking Act, and urging the State Legislature to adopt reciprocity for minority‑ and women‑owned business registries. These items will be discussed at the October 28, 2025 meeting.

ferrytransportationenvironmenteducationminority-business
✓ Decided: Committee held hearings and introduced several ferry and port initiatives

The Economic Development Committee conducted oversight hearings on NYC Ferry operations and waterfront sustainability and introduced multiple local law proposals concerning shore‑power reporting, reduced ferry costs for middle‑school students, a zero‑emission port feasibility study, and language accessibility at ferry terminals. It also considered resolutions urging expansion of ferry service to LaGuardia Airport, federal banking‑diversity legislation, and state MWBE registry reciprocity. No votes or final approvals were recorded; the items were heard or laid over by the committee.

250 Broadway - 8th Floor - Hearing Room 1
Tue Oct 28, 2025 · 1:00 PM

Committee on Higher Education

Council urges NY State to pass College Safety Act for remote learning

The Committee on Higher Education will consider a resolution (Res 0500-2024) that calls on the New York State Legislature and the Governor to enact the New York State College Safety Act. The proposed act would require SUNY and CUNY campuses to allow autoimmune and immunocompromised students and faculty to take or teach courses remotely when their condition temporarily impairs them. The meeting also includes oversight of the reading and writing crisis among college students (agenda item T2025-4168).

higher-educationlegislationremote-learninghealthSUNYCUNY
✓ Decided: Committee held hearing on college reading crisis and laid over safety act resolution

The Higher Education Committee held a hearing on oversight item T2025-4168 concerning the reading and writing crisis among college students. The committee also laid over Resolution 0500-2024 urging state legislation for remote instruction for autoimmune and immunocompromised students and faculty. No vote tallies or final approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Mon Oct 27, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

Committee to review sustainability-focused local laws

The Committee on Governmental Operations, State & Federal Legislation will consider three local laws: a day‑fines pilot program for the Office of Administrative Trials and Hearings, a master plan for redeveloping Rikers Island with sustainability and resiliency goals, and a requirement for the Department of Citywide Administrative Services to report on space use or vacancy in city buildings. The meeting also includes an oversight agenda item on sustainability in city government.

sustainabilityriker-islandadministrative-servicesday-finesgovernment-oversight
✓ Decided: Committee held hearings on sustainability, day‑fines, Rikers plan, space reporting

The Committee on Governmental Operations held hearings on the T2025-4244 sustainability oversight, Int 0551-2024 day‑fines pilot program, Int 1038-2024 Rikers Island redevelopment master plan, and Int 1378-2025 reporting on city building space use. Each item was introduced and laid over by the committee, but no votes or formal approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Mon Oct 27, 2025 · 10:00 AM

Committee on Public Housing

NYC Council Public Housing Committee reviews NYCHA mold remediation updates

The Committee on Public Housing will hold a hearing to receive updates on the New York City Housing Authority’s efforts to remediate mold in its properties. The meeting is scheduled for October 27, 2025 at 10:00 a.m. in Hearing Room 2, 250 Broadway, 8th Floor. No specific actions or votes are listed on the agenda.

public-housinghousing-authoritymoldoversighthealth
✓ Decided: Committee held oversight hearing on NYCHA mold remediation

The Committee on Public Housing convened on October 27, 2025 for an oversight hearing on NYCHA’s remediation of mold, listed as agenda item T2025-4294. The hearing included a committee report, testimony, and transcript. No actions, approvals, or votes were recorded during this meeting.

250 Broadway - 8th Floor - Hearing Room 2
Thu Oct 23, 2025 · 2:00 PM

Committee on Contracts

Committee on Contracts to review procurement and vendor payment laws

The Committee on Contracts is meeting to discuss four proposed local laws. These items address digital procurement systems, insurance guidelines, and vendor payment structures.

procurementcity-contractsgovernment-efficiencyvendor-payments
✓ Decided: Committee held hearings and laid over four contract‑related bills

The Committee on Contracts held hearings on four introductions (Int 1012‑2024, Int 1298‑2025, Int 1392‑2025, Int 1401‑2025) and then laid each of them over to a later date. No votes or approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 2
Thu Oct 23, 2025 · 1:00 PM

Committee on Hospitals

Council considers resolutions to improve maternal health data reporting

The Committee on Hospitals will consider four resolutions focused on maternal health data. The resolutions request the state health department to share adverse maternal event data, create a specific code for maternal mortality, and require hospitals to report and audit such data. The committee will also ask city health facilities to report adverse maternal events to NYPORTS using an expanded definition.

maternal-healthhealth-datahospitalscity-councilpublic-health
✓ Decided: Committee held hearings and postponed four maternal health data resolutions

The Committee on Hospitals heard four resolutions (1082‑2025, 1085‑2025, 1086‑2025, 1087‑2025) that call for improved data sharing and reporting on adverse maternal health events. After the hearings, each resolution was laid over by the committee, meaning they were postponed for further consideration. No votes were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Women and Gender Equity.
Thu Oct 23, 2025 · 1:00 PM

Committee on Aging

Council proposes resolution urging Congress to expand Medicare for seniors

The Committee on Aging will consider two resolutions at its Oct. 23, 2025 meeting. One resolution calls on the United States Congress and the President to pass legislation expanding Medicare to include long‑term services and supports for seniors and individuals with disabilities. The other resolution urges the New York State Assembly and Governor to enact legislation that would retroactively freeze the rent paid by SCRIE or DRIE enrollees at their initial eligibility level. The meeting will be held in Hearing Room 3 at City Hall.

agingmedicareveteranshousingrent-controllegislation
✓ Decided: Committee held hearings on veteran oversight and two resolutions, laying over one

The Committee on Aging, meeting jointly with the Committee on Veterans, held a hearing on Oversight T2025-4116 supporting older veterans. It also held a hearing on Resolution 0850-2025 urging Congress and the President to expand Medicare to cover long‑term services and supports. The committee laid over Resolution 0985-2025 urging the New York State Assembly and Governor to freeze rent levels for SCRIE/DRIE enrollees.

250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Veterans
Thu Oct 23, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee considers Long Island City neighborhood rezoning and map amendments

The Subcommittee on Zoning and Franchises is reviewing several land-use applications, including a neighborhood rezoning in Long Island City. The body is also considering multiple zoning map amendments and Mandatory Inclusionary Housing area establishments across Brooklyn, Queens, and Manhattan.

zoningland-usehousinginfrastructuresidewalk-cafe
✓ Decided: Subcommittee held hearings and laid over rezoning applications, no decisions

The Zoning and Franchises Subcommittee heard several land‑use applications and postponed others. No approvals, denials, or votes were recorded for any of the items. All actions were limited to hearings or items being laid over to a future meeting.

250 Broadway - 8th Floor - Hearing Room 3
Thu Oct 23, 2025 · 10:00 AM

Committee on Finance

Council considers two resolutions urging state action on Mitchell‑Lama rent policies

The Finance Committee will consider Resolution 0575‑2024, which asks the New York State Legislature and the Governor to enact legislation that would adjust rental and carrying charges for Mitchell‑Lama developments each year based on the Consumer Price Index. It will also consider Resolution 1016‑2025, which requests legislation establishing a minimum 60‑day notice period for rent increases for Mitchell‑Lama rental and cooperative residents. Both resolutions are joint with the Committee on Housing and Buildings.

housingrentmitchell-lamalegislationfinance-committee
✓ Decided: Finance Committee held hearings and laid over two Mitchell‑Lama rent‑adjustment resolutions

The New York City Council Committee on Finance, meeting jointly with the Committee on Housing and Buildings, held a hearing on an oversight of housing tax incentives (T2025-4223). It also held hearings on two resolutions urging state legislation for Mitchell‑Lama rent adjustments (Res 0575-2024 and Res 1016-2025). Both resolutions were subsequently laid over for further consideration. No vote tallies were recorded.

Council Chambers - City Hall Jointly with the Committee on Housing and Buildings
Thu Oct 23, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee reviews housing tax incentives and Mitchell-Lama rental rules

The Committee on Housing and Buildings is conducting oversight on housing tax incentives. The body is also considering resolutions regarding rent adjustments and notice periods for Mitchell-Lama developments.

housingtax-incentivesmitchell-lamarent-regulation
✓ Decided: Committee lays over two Mitchell‑Lama rent‑notice resolutions

The Committee on Housing and Buildings held a hearing on the T2025-4222 housing tax incentives oversight and filed that oversight. It also held hearings on Res 0575‑2024 and Res 1016‑2025, both urging state legislation for Mitchell‑Lama rent adjustments and notice periods, and both resolutions were laid over by the committee.

Council Chambers - City Hall Jointly with the Committee on Finance.
Thu Oct 23, 2025 · 10:00 AM

Committee on Mental Health, Disabilities and Addiction

Council committee reviews accessibility laws and disability services

The Committee on Mental Health, Disabilities and Addiction is meeting to discuss several proposed local laws and resolutions. The body will consider accessibility guidelines for print documents and the creation of a film, television, and theater accessibility fund. The meeting also includes oversight of the ATWORK Employment Program.

disabilitiesaccessibilityemploymenttransportationeducation
✓ Decided: Committee held hearings and laid over six mental‑health and disability proposals

The Committee on Mental Health, Disabilities and Addiction conducted hearings on six items: an oversight of the ATWORK employment program, three local law introductions (Int 0163‑2024, Int 1004‑2024, Int 1307‑2025), and two resolutions (Res 0323‑2024, Res 0338‑2024). Each item was heard and then laid over by the committee, with no vote tallies recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1
Thu Oct 23, 2025 · 1:00 PM

Committee on Veterans

Council vets urge Medicare expansion and rent freeze for senior renters

The Committee on Veterans will hold an oversight hearing on supporting older veterans. It will consider Resolution 0850-2025, which asks Congress and the President to pass legislation expanding Medicare to cover long‑term services and supports for seniors and people with disabilities. It will also consider Resolution 0985-2025, which asks the New York State Assembly and Governor to approve a rent‑freeze measure for SCRIE and DRIE participants. The hearing is held jointly with the Committee on Aging.

veteranshealthcarehousingrent-controlseniorslegislation
✓ Decided: Committee on Veterans held hearings on two resolutions

The Committee on Veterans met jointly with the Committee on Aging on Oct. 23, 2025. It held a hearing on Resolution 0850‑2025, which urges Congress and the President to expand Medicare coverage. It laid over Resolution 0985‑2025, which requests a rent‑freeze provision for SCRIE/DRIE enrollees.

250 Broadway - 8th Floor - Hearing Room 3 Jointly with the Committee on Aging.
Thu Oct 23, 2025 · 1:00 PM

Committee on Women and Gender Equity

Committee will consider resolutions to improve maternal health data reporting

The Committee on Women and Gender Equity will hold a hearing on oversight of maternal health in New York City. Members will discuss a series of resolutions urging state and city health agencies to share, standardize, and audit data on adverse maternal health events. The items include requests for new reporting codes, expanded definitions, and retroactive data completion.

maternal-healthhealth-datahospitalsoversightlegislation
✓ Decided: Committee held hearings on four maternal health resolutions

The Committee on Women and Gender Equity held hearings on Res 1082‑2025, Res 1085‑2025, Res 1086‑2025, and Res 1087‑2025. After each hearing, the committee laid the resolutions over for further consideration. No vote tallies were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1 Jointly with the Committee on Hospitals
Wed Oct 22, 2025 · 1:00 PM

Committee on Environmental Protection, Resiliency and Waterfronts

Council to consider new flood‑elevation and resilient building standards

The Environmental Protection, Resiliency and Waterfronts Committee will hold an oversight hearing on stormwater resiliency. It will consider several proposed local laws covering catch‑basin cleaning, roof drainage locations, a green climate screen pilot, and new flood‑elevation and resilient construction standards for 10‑year rainfall flood risk areas. The committee will also consider a resolution supporting the Climate Museum.

stormwaterfloodbuilding-codeclimateenvironmental-protectionresiliency
✓ Decided: Committee held oversight hearing; no decisions recorded

The Environmental Protection, Resiliency and Waterfronts Committee met on Oct. 22, 2025 and conducted an oversight hearing. Members listed several items for discussion, including Int 0403‑2024, Int 1352‑2025, Int 1395‑2025, Int 1397‑2025, and Res 0082‑2024. The minutes record only the hearing and attached reports, with no votes, approvals, or denials. No substantive actions were taken.

250 Broadway - 8th Floor - Hearing Room 1
Wed Oct 22, 2025 · 10:00 AM

Committee on Civil Service and Labor

Council reviews working conditions in NYC’s emergency response system

The Committee on Civil Service and Labor will hold an oversight hearing on working conditions within New York City’s emergency response system. The meeting is held jointly with the Committees on Fire and Emergency Management and Public Safety. No specific actions or votes are listed.

civil-servicelaboremergency-responseoversightpublic-safety
✓ Decided: Committee held oversight hearing on emergency response working conditions

The Civil Service and Labor Committee, together with Fire and Emergency Management and Public Safety committees, conducted a hearing on oversight of working conditions within New York City’s emergency response system. No motions, approvals, or votes were recorded; the meeting consisted of a hearing and the distribution of a committee report and transcript.

Council Chambers - City Hall Jointly with the Committee on Fire and Emergency Management and the Committee on Public Safety.
Wed Oct 22, 2025 · 10:00 AM

Committee on Public Safety

Committee on Public Safety to hold oversight hearing on emergency response conditions

The Committee on Public Safety is meeting to conduct oversight regarding working conditions within New York City’s emergency response system. This is a joint session with the Committee on Civil Service and Labor and the Committee on Fire and Emergency Management.

public-safetyemergency-responseoversightlabor
✓ Decided: Committee held oversight hearing on emergency response working conditions

The Public Safety Committee conducted an oversight hearing (T2025-4153) on working conditions within New York City’s emergency response system. No approvals, denials, or votes were recorded; the meeting was procedural and included a committee report and hearing transcript.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor and the Committee on Fire and Emergency Management
Wed Oct 22, 2025 · 10:00 AM

Committee on Fire and Emergency Management

Oversight hearing on emergency responders' working conditions

The Committee on Fire and Emergency Management will hold an oversight session on working conditions within New York City’s emergency response system. The hearing is conducted jointly with the Committee on Civil Service and Labor and the Committee on Public Safety. No specific actions or decisions are noted in the agenda.

fire-emergencylaboroversightpublic-safety
✓ Decided: Committee held oversight hearing on emergency response working conditions

The Committee on Fire and Emergency Management, together with the Civil Service and Labor and Public Safety committees, held an oversight hearing on working conditions within New York City’s emergency response system. The hearing was documented with a committee report and transcript, and the oversight item was filed by the committee. No votes or formal actions were taken.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor and the Committee on Public Safety
Tue Oct 21, 2025 · Deferred

Committee on Higher Education

Higher Ed Committee to hold oversight hearing on college reading/writing crisis

The City Council Committee on Higher Education will convene an oversight hearing to examine the reading and writing crisis affecting college students. No specific actions or decisions are indicated; the agenda item is for discussion and review.

higher-educationeducationcollegereading-writingoversight
250 Broadway - 8th Floor - Hearing Room 3
Fri Oct 17, 2025 · Deferred

Committee on Fire and Emergency Management

Council reviews fire safety and permitting for community energy storage

The Committee on Fire and Emergency Management is holding an oversight hearing. The body will discuss fire safety and permitting approval processes for community energy storage facilities.

fire-safetyenergy-storagepermittingoversight
250 Broadway - 8th Floor - Hearing Room 1
Thu Oct 16, 2025 · Deferred

Committee on Veterans

Committee on Veterans to hold oversight hearing on supporting older veterans

The Committee on Veterans, jointly with the Committee on Aging, will hold an oversight hearing. The discussion will focus on supporting New York City’s older veterans.

veteransagingoversight
Council Chambers - City Hall Jointly with the Committee on Aging.
Thu Oct 16, 2025 · Deferred

Committee on Aging

Aging Committee reviews oversight of support for NYC older veterans

The New York City Council Committee on Aging will meet on Oct. 16, 2025 at 1:00 PM. The committee will discuss item T2025‑4116, an oversight agenda focused on supporting the city’s older veterans. The discussion will be held jointly with the Committee on Veterans. No other agenda items are listed.

veteransagingoversightcity-council
Council Chambers - City Hall Jointly with the Committee on Veterans
Thu Oct 16, 2025 · Deferred

Committee on Finance

Council Finance Committee to review housing tax incentives

The Committee on Finance will hold an oversight meeting to examine housing tax incentives, jointly with the Committee on Housing and Buildings. The session is scheduled for October 16, 2025, at 10:00 AM in Committee Room at City Hall.

financehousingoversighttax-incentivescity-hall
Committee Room - City Hall Jointly with the Committee on Housing and Buildings
Thu Oct 16, 2025 · Deferred

Committee on Housing and Buildings

Committee to hold oversight hearing on housing tax incentives

The Committee on Housing and Buildings will meet jointly with the Committee on Finance. The session is dedicated to oversight regarding housing tax incentives.

housingtax-incentivesoversight
Committee Room - City Hall Jointly with the Committee on Finance.
Thu Oct 16, 2025 · 10:00 AM

Committee on Parks and Recreation

Resolution to raise low‑income funeral cost limit from $3,400 to $6,000

The Committee on Parks and Recreation will consider a resolution urging New York State to increase the funeral cost limit for low‑income residents from $3,400 to $6,000. It will also review the Hart Island Capital Projects Proposal and discuss a local law related to a study and report on burial capacity on Hart Island. The items are considered jointly with the Committee on General Welfare and the Committee on Health.

burialhart-islandbudgetparks-recreationhealth
✓ Decided: Committee held oversight hearings; no substantive decisions recorded

The Parks and Recreation Committee conducted roll call and oversaw hearings on several reports and resolutions, including Int. No. 1408 and Res. No. 775. Attachments and committee reports were reviewed jointly with the General Welfare and Health committees. No votes, approvals, or denials were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on General Welfare and the Committee on Health
Thu Oct 16, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Zoning committee to consider Long Island City and Domino Site rezonings

The Subcommittee on Zoning and Franchises will meet to discuss several zoning map amendments and special permits, including a Long Island City neighborhood rezoning and development proposals for the Domino Site in Brooklyn.

zoningredevelopmentlong-island-citybrooklynhousingspecial-permits
✓ Decided: Domino Site B special permits hearing held by the zoning subcommittee

The Subcommittee on Zoning and Franches held hearings on several land‑use applications, including the Domino Site B special‑permit requests and the Ovi’s Place sidewalk café. Some applications were later laid over for further consideration. No vote tallies were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 3
Thu Oct 16, 2025 · 1:00 PM

Committee on Women and Gender Equity

Committee reviews data adequacy and multiple gender‑based violence legislation

The Committee on Women and Gender Equity will hold an oversight hearing on the adequacy of domestic and gender‑based violence data in NYC. It will consider several local law amendments addressing 311 calls, resources for newly married individuals, poster requirements for cosmetology salons, the lookback window for gender‑motivated violence victims, and data access. Two resolutions will also be considered: one affirming reproductive‑rights access and another urging state action on a lethality‑assessment law for domestic‑violence cases.

gender-based-violencedomestic-violencedatareproductive-rightslegislation
✓ Decided: Committee held hearings and filed bills, but made no formal decisions

The Committee on Women and Gender Equity held hearings on several oversight items and introduced multiple local law proposals and resolutions. All items were either heard or laid over by the committee, with no votes recorded or decisions approved or denied.

250 Broadway - 8th Floor - Hearing Room 1
Thu Oct 16, 2025 · 10:00 AM

Committee on Health

Resolution to raise funeral cost limit for low‑income residents to $6,000

The Health Committee will oversee the Hart Island Capital Projects Proposal (T2025-4144). It will consider Local Law Int 1408-2025, a study and report on burial capacity on Hart Island. The committee will also discuss Resolution 0775-2025 urging New York State to increase the funeral cost limit for low‑income residents from $3,400 to $6,000. The items are joint with the General Welfare and Parks and Recreation committees.

healthhart-islandburial-capacityfuneral-costlocal-lawresolution
✓ Decided: Health Committee held oversight hearing and filed resolution

The Committee on Health conducted a roll call, held an oversight hearing, and filed Resolution 0775-2025. No votes, approvals, or denials were recorded in the minutes. The meeting was largely procedural with attachments and reports noted.

Council Chambers - City Hall Jointly with the Committee on General Welfare and the Committee on Parks and Recreation
Thu Oct 16, 2025 · 10:00 AM

Committee on General Welfare

Council proposes raising low‑income funeral cost limit to $6,000.

The Committee on General Welfare will review the Hart Island Capital Projects proposal and consider a local law to study burial capacity on Hart Island. It will also consider a resolution urging New York State to increase the funeral cost limit for low‑income residents from $3,400 to $6,000. The items are presented jointly with the Parks and Recreation and Health committees.

hart-islandburial-capacityfuneral-costwelfare-committeeresolution
✓ Decided: Committee held oversight hearing and filed reports, no decisions made

The Committee on General Welfare convened and conducted an oversight hearing. The committee filed the related Committee Report and fiscal impact statements. Resolution 0775-2025 was heard and later laid over by the committee. No votes, approvals, denials, or tabling actions were recorded.

Council Chambers - City Hall Jointly with the Committee on Parks and Recreation and the Committee on Health.
Wed Oct 15, 2025 · 10:00 AM

Committee on Small Business

Committee considers financial aid for small business security and loan readiness

The Committee on Small Business will hold an oversight hearing on cybersecurity for small businesses. The body will also consider two local laws regarding financial assistance for security technology and loan readiness resources.

small-businesscybersecurityfinancial-assistancesecurity-technologyloans
✓ Decided: Small Business Committee held hearings, filed items, but made no decisions

The Committee on Small Business held a hearing on oversight item T2025-4150 concerning cybersecurity for small businesses and filed the item. It also held hearings on Introduction 0180-2024, which would amend the administrative code to provide financial assistance for security system technology, and Introduction 1350-2025, which would amend the code for small business loan readiness resources, and laid both over. No votes or formal approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Wed Oct 15, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Brooklyn property tax exemption request to be reviewed

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider a request for a real property tax exemption at 2149-2153 Pacific Street. The application is submitted by the Department of Housing Preservation and Development.

landmarkshousingtax-exemptionhpdsubcommittee
✓ Decided: Subcommittee held a hearing on a land use application, no decisions made

The Subcommittee on Landmarks, Public Sitings and Dispositions met on October 15, 2025 at City Hall. Members present were Chair Kamillah M. Hanks, Justin Brannan, Amanda C. Farías, Christopher Marte, Sandy Nurse, and Yusef Salaam; Oswald Feliz was absent. The meeting included a hearing on a land‑use application (P‑C Item) but no vote or formal decision was recorded.

250 Broadway - 8th Floor - Hearing Room 3
Thu Oct 9, 2025 · 1:30 PM

City Council Stated Meeting

Council considers extensive Jamaica Neighborhood zoning changes and inclusionary housing

The City Council will review a series of local laws on pay data reporting, pay equity, and contract award disbursements to non‑profit human services organizations. It will also consider a tax‑exemption resolution for a Bronx property and multiple zoning amendments for the Jamaica Neighborhood Plan, including the creation of a Special Downtown Jamaica District and a Mandatory Inclusionary Housing area. Additional zoning changes for the Claremont House site at 1640 Anthony Avenue in the Bronx are also on the agenda.

zoninghousingtaxpay-equitycontractsinclusionary-housingneighborhood-plan
✓ Decided: Council approves pay data reporting law and multiple contract measures

The City Council approved two introductions on private‑employer pay data reporting with recorded vote tallies. Several other introductions and a land‑use application were approved by unanimous consent. All actions were recorded as approved during the October 9, 2025 meeting.

Council Chambers - City Hall
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Int 0982-2024 — Approved by Council
41 yea · 8 nay · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0984-2024 — Approved by Council
42 yea · 7 nay · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1372-2025 — Approved by Council
42 yea · 7 nay · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 1058-2025 — Approved, by Council
41 yea · 8 nay · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte nay · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang nay
The other 32 items passed by unanimous or near-unanimous consent.
Thu Oct 9, 2025 · 11:30 AM

Committee on Contracts

Committee considers three proposed local laws on contract awards and services

The Committee on Contracts will consider three proposed local laws. One would amend the city charter to require a percentage of contract awards to go to nonprofit human‑services organizations registered with the comptroller. Another would amend the charter to create an Office of Contract Services. The third would amend the administrative code to require agency action plans for retroactive human‑services contract registration.

contractslocal-lawhuman-servicescharteradministrative-code
✓ Decided: Committee approves three contract‑related local law introductions (5‑0 each)

The NYC Council Committee on Contracts approved Introduction 1247‑2025‑B, Introduction 1248‑2025‑B, and Introduction 1249‑2025‑A. Each introduction amends the city charter or administrative code on contract award disbursements, the office of contract services, and agency action plans for retroactive human‑services contract registration. All approvals were made by roll‑call vote with all five members voting affirmative.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1247-2025 — Approved by Committee
5 yea
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov yea
Int 1248-2025 — Approved by Committee
5 yea
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov yea
Int 1249-2025 — Approved by Committee
5 yea
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov yea
Thu Oct 9, 2025 · 11:30 AM

Committee on Technology

Council considers plan to expand home broadband internet access

The Committee on Technology is meeting to discuss Int 1122-2024. This proposed local law seeks to amend the city's administrative code regarding a plan for expanding home access to broadband internet.

technologybroadbandinternet-accessinfrastructure
✓ Decided: Committee on Technology approves local law to expand home broadband access

The Committee on Technology approved Introduction 1122-2024-A, a local law to amend the city’s administrative code for expanding home broadband internet. The motion passed with four affirmative votes (Gutiérrez, Bottcher, Holden, Won) and one member (Paladino) recorded as medical. No other measures were adopted.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1122-2024 — Approved by Committee
4 yea · 1 medical
Jennifer Gutiérrez yea · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino medical · Julie Won yea
Thu Oct 9, 2025 · 11:00 AM

Committee on Transportation and Infrastructure

Local law proposal for a cool pavement pilot project

The Transportation and Infrastructure Committee will consider Int. 0928-2024, a proposed local law. The bill would require the Department of Transportation to conduct a pilot project on the use of cool pavement. The committee will discuss and vote on the proposal during the October 9, 2025 meeting.

transportationinfrastructureenvironmentlocal-lawpilot-project
✓ Decided: Committee approves cool‑pavement pilot introduction (Int 0928‑2024‑B)

The Transportation and Infrastructure Committee voted to approve Introduction Int 0928‑2024‑B, a local law requiring the Department of Transportation to conduct a pilot project on cool pavement. The motion passed with all eight committee members voting in favor. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0928-2024 — Approved by Committee
8 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Julie Won yea
Thu Oct 9, 2025 · 11:00 AM

Committee on General Welfare

Limit household rent contribution for voucher recipients

The Committee on General Welfare will consider three proposed local laws. One would require a report and study on air conditioning in homeless shelters. Another would set notification procedures for emergency assistance grant approvals. The third would limit the household rent contribution for recipients of a rental assistance voucher.

housinghomeless-sheltersemergency-assistancerental-assistancelocal-law
✓ Decided: Committee approves three local law introductions on shelters, grants, rent assistance

The Committee on General Welfare approved three introductions to local law. Int 1208-2025-A addresses a report and study on air conditioning in homeless shelters. Int 1232-2025-A concerns notifications for emergency assistance grant approvals. Int 1372-2025-A limits household rent contributions for rental assistance voucher recipients. All three were approved by roll call with nine affirmative votes.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1208-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Int 1232-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Int 1372-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Thu Oct 9, 2025 · 10:30 AM

Committee on Finance

Committee on Finance to consider Melrose Villa Hermosa land use item

The Committee on Finance is meeting to discuss a land use item regarding Melrose Villa Hermosa. The item is listed as preconsidered.

land-usebronxfinance
✓ Decided: Committee on Finance approved the Melrose Villa Hermosa land use application

The Committee on Finance considered Land Use Application LU 0404-2025 for Melrose Villa Hermosa in the Bronx. A motion was made to approve the application as a P‑C item with a companion resolution. The motion passed with all 16 members present voting in favor and no opposition. The application was approved by the committee.

Committee Room - City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0404-2025 — P-C Item Approved by Committee with Companion Resolution
16 yea · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Thu Oct 9, 2025 · 10:30 AM

Committee on Land Use

Council will consider extensive zoning map changes for the Jamaica Neighborhood Plan

The Land Use Committee will review multiple applications, including designating an Urban Development Action Area for Claremont House at 1640 Anthony Avenue in the Bronx and amending its zoning from R7-1 to R8. It will also consider a sweeping zoning map amendment for the Jamaica Neighborhood Plan that alters dozens of district designations across Queens. Additional items include city map changes to Archer Avenue, rezoning of 535 Morgan Avenue in Brooklyn, and other related proposals.

zoninghousingdevelopmentmapneighborhoodsqueensbronxbrooklyn
✓ Decided: Land‑use committee approves five applications, including zoning changes and Jamaica plan

The Committee on Land Use approved three applications for the Claremont House site: an Urban Development Action Area, a zoning map amendment from R7‑1 to R8, and a Mandatory Inclusionary Housing area. It also approved two Jamaica Neighborhood Plan applications, one with modifications and referral to the City Planning Commission. All votes recorded were 8‑1, with Councilmember Hanks absent.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
LU 0365-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0366-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0367-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0369-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0370-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0371-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0372-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0382-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0393-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0394-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0395-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0396-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Thu Oct 9, 2025 · 10:15 AM

Subcommittee on Zoning and Franchises

Subcommittee will consider extensive zoning changes for Jamaica Neighborhood Plan

The Subcommittee on Zoning and Franchises will hear multiple applications to amend the zoning map for the Jamaica Neighborhood Plan, including the elimination and creation of several district designations. It will also consider an amendment to the Zoning Resolution to create a Mandatory Inclusionary Housing area in Downtown Jamaica. Additional items include a proposal for an Urban Development Action Area on Union Hall Street and Guy R Brewer Boulevard, and a city‑map change affecting Archer Avenue in Queens. Two separate rezoning applications for properties in Brooklyn will also be discussed.

zoninghousingdevelopmentmap-changesqueensbrooklyn
✓ Decided: Subcommittee approved four Jamaica-area land use apps, sending three to CPC

The Zoning and Franchises Subcommittee voted unanimously (7‑0) to approve three Jamaica Neighborhood Plan applications with modifications and refer them to the City Planning Commission. It also approved the Station Plaza Jamaica map‑change application. No other actions were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
LU 0369-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0370-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0371-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0372-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0396-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Oct 9, 2025 · 9:30 AM

Committee on Health

Committee on Health to discuss cooling tower inspection and testing rules

The Committee on Health is meeting to consider Proposed Int. No. 1390-A. This legislation proposes amendments to the administrative code of the city of New York regarding the inspection and testing of cooling towers.

healthpublic-safetyinspectionscity-code
✓ Decided: Health Committee approves cooling tower inspection law (8‑0)

The New York City Council Committee on Health approved Introduction 1390‑2025‑A, a local law amending the city’s administrative code on cooling tower inspections and testing. The motion passed with eight members voting affirmative and one member absent. No other actions were taken at this meeting.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1390-2025 — Approved by Committee
8 yea · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Carmen N. De La Rosa absent · Oswald J. Feliz yea · James F. Gennaro yea · Kristy Marmorato yea · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Thu Oct 9, 2025 · 11:30 AM

Committee on Rules, Privileges and Elections

Council votes to amend its rules and adjust committee chairs

The Committee on Rules, Privileges and Elections will consider two resolutions. Resolution 1058-2025 proposes amending the Council's rules to improve clarity and consistency with Council practices and precedent. Resolution 1058-A proposes changes to the chairs and membership of certain Council committees under Rule 7.00. Both items are listed as pre‑considered.

council-rulescommittee-structuregovernance
✓ Decided: Committee approved two resolutions amending council rules and committee chairs

The Rules, Privileges and Elections Committee approved Resolution 1058‑2025‑A to amend the Council’s rules for greater clarity, with all ten members voting in favor. The committee also approved Resolution 1099‑2025, which changes the chairs and membership of certain Council committees, again unanimously. Both actions were recorded as approved by roll call.

250 Broadway - 8th Floor - Hearing Room 2 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 1058-2025 — Approved by Committee
10 yea
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Res 1099-2025 — P-C Item Approved by Comm
10 yea
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Thu Oct 9, 2025 · 11:00 AM

Committee on Housing and Buildings

Council will consider a law requiring steam‑radiator inspections in multiple dwellings.

The Committee on Housing and Buildings will consider two proposed local laws. The first would amend the city’s administrative code to require inspections of steam radiators in multiple‑dwelling buildings. The second would amend the code to set notification requirements for housing portal applications and to designate a representative to receive those notifications.

housingbuilding-safetyregulationsnotificationsportal
✓ Decided: Committee approves two housing‑related introductions

The Committee on Housing and Buildings approved Introduction 0925-2024-A, which would require inspection of steam radiators in multiple dwellings, and Introduction 1265-2025-A, which would set notification procedures for applications in the city’s housing portal and designate a representative to receive those notifications. Both motions passed by roll call with six members voting affirmative and one member excused. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0925-2024 — Approved by Committee
6 yea · 1 absent
Pierina Ana Sanchez yea · Shaun Abreu absent · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1265-2025 — Approved by Committee
6 yea · 1 absent
Pierina Ana Sanchez yea · Shaun Abreu absent · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Thu Oct 9, 2025 · 9:30 AM

Committee on Civil and Human Rights

City Council committee to consider two pay equity related local laws

The Committee on Civil and Human Rights will meet on October 9, 2025 at 250 Broadway, 8th Floor, Hearing Room 3. It will consider two proposed local laws. Int 0982-2024 would amend the administrative code to require private employers to report pay data. Int 0984-2024 would amend the administrative code to require a study on pay equity for private employees.

pay-equityemploymentlocal-lawcivil-rights
✓ Decided: Committee approves pay data reporting and pay equity study introductions

The Committee on Civil and Human Rights approved Introduction 0982-2024-A, a local law to amend the administrative code regarding pay data reporting by private employers. The Committee also approved Introduction 0984-2024-A, a local law to amend the administrative code concerning a study on pay equity for private employees. Both motions passed with four votes in favor and one member absent.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0982-2024 — Approved by Committee
4 yea · 1 absent
Nantasha M. Williams yea · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley absent · Rafael Salamanca, Jr. yea
Int 0984-2024 — Approved by Committee
4 yea · 1 absent
Nantasha M. Williams yea · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley absent · Rafael Salamanca, Jr. yea
Wed Oct 8, 2025 · Deferred

City Council Stated Meeting

Council meeting agenda lists only members and schedule, no items

The October 8, 2025 City Council meeting agenda includes the Speaker, council members, location, and time. No specific resolutions, contracts, or hearings are listed. The agenda appears to be procedural boilerplate without substantive agenda items.

city-councilmeetingprocedural
Council Chambers - City Hall
Wed Oct 8, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

No specific agenda items listed; meeting appears procedural

The Subcommittee on Landmarks, Public Sitings and Dispositions will meet on Oct. 8, 2025. The agenda does not list any specific items for decision or discussion. As a result, the meeting is likely limited to routine matters. No concrete actions or proposals are identified in the agenda.

landmarkspublic-sitingsdispositionscity-council
✓ Decided: Subcommittee approved seven land‑use applications, including zoning and tax exemptions

The Subcommittee on Landmarks, Public Sitings and Dispositions approved seven land‑use applications. Approvals included a designation of an Urban Development Action Area at 1640 Anthony Avenue, a zoning map amendment changing the site from R7‑1 to R8, an amendment creating a Mandatory Inclusionary Housing area, and tax‑exemption requests for the Claremont House and Arverne East projects. All motions passed by roll call with six members voting affirmative and one member absent.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
LU 0365-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0366-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0367-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0382-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0393-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0394-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0395-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
Fri Oct 3, 2025 · 1:00 PM

Committee on Civil and Human Rights

City Council committee holds oversight hearing on housing discrimination

The Committee on Civil and Human Rights will hold an oversight hearing titled “Housing Discrimination and Inequity” (agenda item T2025-4036). The meeting is scheduled for Friday, October 3, 2025 at 1:00 PM in Hearing Room 1, 250 Broadway, 8th Floor. No other matters or decisions are listed on the agenda.

housingdiscriminationcivil-rightsoversight
✓ Decided: Committee held housing discrimination oversight hearing

The Committee on Civil and Human Rights held an oversight hearing on housing discrimination and inequity (T2025-4036). The hearing materials—including a committee report, testimony, and transcript—were filed by the committee. No decisions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Wed Oct 1, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee reviews oversight of sidewalks, medians, and streetscapes

The Transportation and Infrastructure Committee will conduct oversight of the city’s sidewalks, medians, and streetscapes. It will also consider a series of local law amendments covering electric‑vehicle charging on lampposts, tree‑damage repairs, speed humps near parks, Open Streets activation on holidays, tree guards, median cleaning, high‑visibility pavement markings, vegetation planting on medians, and a feasibility study for new ferry terminals.

sidewalksmediansstreetscapeselectric-vehiclesparksbike-lanesopen-streetsferry-study
✓ Decided: Committee held hearings and laid over multiple transportation-related bill introductions

The Transportation and Infrastructure Committee heard introductions for several local laws covering electric‑vehicle charging, street medians, park safety, and ferry feasibility. After the hearings each bill was laid over for further consideration. No votes or final approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Tue Sep 30, 2025 · 1:00 PM

Committee on Education

Council will consider two new local laws on dental care and vaccine info for schools

The Education Committee will hold a hearing on September 30, 2025. It will consider two proposed local laws: one requiring the Department of Education to provide information about dental care, and another to provide vaccine information to parents of students. The committee will also consider a resolution urging the city and state education departments to increase training for teachers of English Language Learners and improve ELL education quality.

educationdental-carevaccinesenglish-language-learnerslanguage-accesslocal-lawresolution
✓ Decided: Education Committee held hearings and filed items; no votes recorded

The Committee on Education held a hearing on Oversight T2025-4031 concerning language access in NYC public schools. It also heard introductions of Int 1336-2025 (dental‑care information) and Int 1337-2025 (vaccine information) and considered Resolution 0054-2024 urging collaboration on English Language Learner training. All items were heard and laid over by the committee, and no votes or formal approvals were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Tue Sep 30, 2025 · Deferred

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council reviews pathways for CUNY students into arts and cultural jobs

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will hold an oversight hearing on pathways for City University of New York (CUNY) students to enter the arts and cultural jobs sector. The hearing will be conducted jointly with the Committee on Higher Education. The committee will discuss how to support student transitions into this sector.

educationartsculturestudentsworkforce
Council Chambers - City Hall Jointly with the Committee on Higher Education
Tue Sep 30, 2025 · 10:00 AM

Committee on Public Safety

Oversight of surveillance use in NYCHA developments

The Committee on Public Safety will hold an oversight hearing on the use of surveillance in NYCHA developments, in coordination with the Committees on Technology, Public Housing, and Oversight and Investigations. The meeting will discuss policies and practices related to surveillance equipment and data in public housing projects.

public-safetyhousingsurveillanceoversight
✓ Decided: Public Safety Committee held NYCHA surveillance hearing, no decisions taken

The Committee on Public Safety met on September 30, 2025, with a roll call of members. An oversight hearing (T2025-4157) on the use of surveillance in NYCHA developments was conducted. No approvals, denials, or votes were recorded during the meeting.

Council Chambers - City Hall Jointly with the Committee on Technology, the Committee on Public Housing and the Committee on Oversight and Investigations
Tue Sep 30, 2025 · 1:00 PM

Committee on Higher Education

Committee reviews CUNY student pathways into arts and cultural jobs

The Committee on Higher Education is holding an oversight hearing. The session focuses on pathways for CUNY students to enter the arts and cultural jobs sector.

higher-educationcunyworkforce-developmentarts-and-culture
✓ Decided: Committee held hearing on CUNY arts pathways oversight

The Committee on Higher Education held a hearing on Oversight T2025-3961 concerning pathways for CUNY students into the arts and cultural jobs sector. The oversight item was filed by the committee. No votes, approvals, or denials were recorded.

250 Broadway - 8th Floor - Hearing Room 3
Tue Sep 30, 2025 · 10:00 AM

Committee on Oversight and Investigations

Oversight of surveillance in NYCHA developments

The Committee on Oversight and Investigations will hold a joint session with the Technology, Public Safety, and Public Housing committees to examine the use of surveillance in NYCHA developments. The agenda item is listed as T2025-4159 and focuses on oversight of surveillance practices. No specific actions or decisions are indicated in the agenda.

oversightsurveillancepublic-housingtechnologypublic-safety
✓ Decided: Oversight hearing on NYCHA surveillance held; no decisions made

The Committee on Oversight and Investigations held a hearing (T2025-4159) on the use of surveillance in NYCHA developments. No motions were adopted, approved, denied, or tabled during the meeting.

Council Chambers - City Hall Jointly with the Committee on Technology, the Committee on Public Safety and the Committee on Public Housing
Tue Sep 30, 2025 · 10:00 AM

Committee on Public Housing

NYCHA surveillance oversight hearing scheduled

The Committee on Public Housing will hold an oversight meeting to examine the use of surveillance technology in New York City Housing Authority developments. The session is a joint meeting with the Committees on Technology, Public Safety, and Oversight and Investigations.

public-housingsurveillanceoversighttechnologypublic-safety
✓ Decided: Committee held hearing on NYCHA surveillance oversight

The Committee on Public Housing, together with other committees, held a hearing on oversight of surveillance in NYCHA developments (T2025-4158). The oversight item was filed by the committee. No votes or formal approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Technology, the Committee on Public Safety and the Committee on Oversight and Investigations
Tue Sep 30, 2025 · 10:00 AM

Committee on Technology

Committee will review surveillance use in NYCHA developments

The Committee on Technology will hold a joint meeting with the Public Safety, Public Housing, and Oversight and Investigations committees to discuss oversight of surveillance systems in New York City Housing Authority (NYCHA) developments. No specific actions or decisions are listed in the agenda.

technologyhousingsurveillanceoversight
✓ Decided: Committee held oversight hearing on NYCHA surveillance, no decisions made

The Committee on Technology met on September 30, 2025 with Chair Jennifer Gutiérrez and members Erik D. Bottcher, Robert F. Holden, Vickie Paladino, and Julie Won. The meeting was held jointly with the Committees on Public Safety, Public Housing, and Oversight and Investigations. An oversight hearing (T2025-4156) on the use of surveillance in NYCHA developments was conducted, but no actions, approvals, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Public Safety, the Committee on Public Housing and the Committee on Oversight and Investigations.
Tue Sep 30, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council will consider disposition of the Kingsbridge Armory site to a developer.

The Subcommittee on Landmarks, Public Sitings and Dispositions will review multiple HPD applications, including urban development action area designations, zoning map amendments, inclusionary housing designations, and tax‑exemption requests. A key item is the disposition of city‑owned property at 25 West Kingsbridge Road (Kingsbridge Armory) to a developer. Additional proposals involve the Claremont House site at 1640 Anthony Avenue and a lease of land at 1225 Gerard Avenue to the River Commons Housing Development Fund.

zoninghousingdevelopmenttax-exemptionarmorybronxqueens
✓ Decided: Subcommittee laid over the Kingsbridge Armory redevelopment application

The Subcommittee on Landmarks, Public Sitings and Dispositions held hearings on a series of land‑use applications and then laid each of them over for further consideration. No applications were approved or denied at this meeting. The action of laying over postpones any final decision until a later date.

Committee Room - City Hall
Mon Sep 29, 2025 · 10:00 AM

Committee on Civil Service and Labor

Committee to discuss worker safety amid climate change

The Committee on Civil Service and Labor will hold an oversight hearing on worker safety and the effects of climate change on labor. The body will also consider three local laws regarding building codes, extreme weather guidance, and mental health training for construction sites. Additionally, the committee will vote on a resolution concerning labor disputes at the Daily News.

laborworker-safetyclimate-changebuilding-codemental-healthhousingunion
✓ Decided: Committee held hearings and laid over bills; no actions decided

The Civil Service and Labor Committee held hearings on several oversight items and introduced multiple local law proposals. Each introduction was laid over by the committee. No votes, approvals, denials, or other substantive actions were recorded.

Council Chambers - City Hall Jointly with the Committee on Housing and Buildings
Mon Sep 29, 2025 · 1:00 PM

Committee on Public Housing

Oversight hearing on Section 8 and emergency housing voucher program

The Committee on Public Housing will hold an oversight hearing to review how the Section 8 and Emergency Housing Voucher Program are being administered. No specific actions or decisions are listed beyond the discussion of program oversight.

housingvouchersoversightpublic-housing
✓ Decided: Committee held oversight hearing on Section 8 and emergency housing voucher program

The Committee on Public Housing conducted an oversight hearing regarding the administration of the Section 8 and Emergency Housing Voucher Program. No votes or formal approvals were recorded. The hearing and related documents were filed by the committee.

250 Broadway - 8th Floor - Hearing Room 1
Mon Sep 29, 2025 · 1:00 PM

Committee on Parks and Recreation

Oversight hearing on Parks Dept contracting practices and vendor accountability

The Committee on Parks and Recreation, together with the Committee on Contracts, will hold an oversight hearing to review the Parks Department's contracting practices and vendor accountability. No decisions or votes are indicated; the meeting is for discussion and examination of existing procedures.

parkscontractsoversightprocurementaccountability
✓ Decided: Committee held oversight hearing on Parks Department contracting practices

The Parks and Recreation Committee conducted an oversight hearing (T2025-4082) on the department’s contracting practices and vendor accountability. A committee report, hearing testimony, and transcript were attached. The oversight item was filed by the committee. No votes or approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Contracts.
Mon Sep 29, 2025 · 1:00 PM

Committee on Contracts

Committee reviews Parks Department contracting practices and vendor accountability

The Committee on Contracts will hold an oversight meeting, jointly with the Committee on Parks and Recreation, to examine the Parks Department's contracting practices and vendor accountability. No specific actions or decisions are listed in the agenda.

contractsparksoversightvendor-accountability
✓ Decided: No substantive actions taken by the Committee on Contracts

The Committee on Contracts held a hearing on oversight of the Parks Department contracting practices (T2025-4083) and filed the oversight report. No approvals, denials, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Parks and Recreation
Mon Sep 29, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee considers multiple worker-safety and housing-code reforms

The Housing and Buildings Committee will review several proposed local laws aimed at improving worker safety and addressing climate-related risks in construction. Items include changes to means-of-egress requirements, mandatory safety‑training content on mental health and extreme‑weather protection, and allowing cellar occupancy in certain homes. The committee will also consider a resolution condemning Alden Global Capital’s actions toward the Daily News union.

worker-safetyclimate-changebuilding-codehousinglaborresolution
✓ Decided: Committee held hearings on several housing bills and laid them over

The Housing and Buildings Committee held hearings on a worker‑safety oversight, three building‑code introductions, a cellar‑occupancy introduction, and a resolution condemning Alden Global Capital. After each hearing, the items were laid over (postponed) by the committee. No votes or final approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor.
Fri Sep 26, 2025 · Deferred

Committee on Environmental Protection, Resiliency and Waterfronts

Council to consider amending the plumbing code for roof drainage locations

The Committee on Environmental Protection, Resiliency and Waterfronts will review oversight of stormwater resiliency in a changing climate. It will consider a local law amendment to the New York City plumbing code concerning the drainage location of certain building roofs. The committee will also consider a resolution supporting the mission and growth of the Climate Museum.

stormwaterplumbing-codeclimate-museumresiliencyenvironment
Council Chambers - City Hall
Fri Sep 26, 2025 · Deferred

Committee on Fire and Emergency Management

Council reviews fire safety and permitting for community energy storage

The Committee on Fire and Emergency Management is holding an oversight hearing. The body will discuss fire safety and permitting approval processes for community energy storage facilities.

fire-safetyenergy-storagepermittingoversight
250 Broadway - 8th Floor - Hearing Room 1
Fri Sep 26, 2025 · 10:00 AM

Committee on Mental Health, Disabilities and Addiction

Council committee reviews 988 lifeline and suicide reporting laws

The Committee on Mental Health, Disabilities and Addiction will hold an oversight hearing on the 988 Suicide & Crisis Lifeline. Members will also consider legislation regarding suicide reporting and opioid antagonist programs at construction sites.

mental-healthpublic-healthopioidsoversightconstruction-safety
✓ Decided: Committee held hearings and filed items on suicide lifeline, opioid program, OSHA training

The committee conducted a hearing on oversight of the city's 988 Suicide & Crisis Lifeline (T2025-4035). It also held hearings on two proposed local laws: Int 1162-2025 to require annual suicide reporting and Int 1385-2025 to create a construction‑site opioid antagonist program. Additionally, the committee heard and filed Resolution 1049-2025 urging federal legislation for mental‑wellness training in OSHA courses. No votes were recorded on these items.

250 Broadway - 8th Floor - Hearing Room 3
Thu Sep 25, 2025 · 11:30 AM

Committee on Housing and Buildings

Local law to add unlawful evictions to tenant‑harassment definition

The Committee on Housing and Buildings will consider three proposed local laws. One would expand the scope of gas piping system inspections and reestablish the plumbing and fire‑suppression contractor license board. Another would include unlawful evictions in the definition of tenant harassment and tie them to a no‑harassment certification. The third would set notice requirements for rent‑increase exemptions and provide tax abatements for senior citizens and persons with disabilities.

housingplumbingtenant-harassmenttax-abatementssenior-citizensdisabilitiesrent-increase
✓ Decided: Committee approved three pending housing introductions by unanimous vote

The Committee on Housing and Buildings approved Introduction 0429-2024-A, Introduction 0621-2024-A, and Introduction 1034-2024-A. Each motion was approved by roll call with all seven members voting affirmative. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0429-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0621-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1034-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Thu Sep 25, 2025 · 10:00 AM

Committee on Public Safety

Council urges NY State to mandate intelligent speed assistance devices.

The Committee on Public Safety will consider Resolution 0854-2025. The resolution calls on the New York State Legislature and Governor to enact S.4045/A.2299, which would require installing intelligent speed assistance devices for drivers who repeatedly exceed speed limits. The council will vote on adopting the resolution.

public-safetytrafficspeed-assistancestate-legislationtechnology
✓ Decided: Committee approves resolution urging state to require intelligent speed assistance devices

The Committee on Public Safety approved Resolution 0854-2025, which calls on the New York State Legislature and Governor to enact S.4045/A.2299 requiring intelligent speed assistance devices for repeat speed‑limit violations. The motion passed with eight votes in favor, one against, and one member absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0854-2025 — Approved by Committee
8 yea · 1 nay · 1 absent
Yusef Salaam yea · Joann Ariola nay · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden yea · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé absent · Althea V. Stevens yea
Thu Sep 25, 2025 · 4:00 PM

Committee on Standards and Ethics

Committee to hold oversight meeting on Council Rule 10.80

The Committee on Standards and Ethics will hold a meeting pursuant to Council Rule 10.80 at City Hall.

ethicsoversightcity-hallcouncil-rule
✓ Decided: Committee on Standards and Ethics held an oversight hearing, no actions taken

The Committee on Standards and Ethics convened an oversight hearing under Council Rule 10.80. Chair Sandra Ung and members Diana I. Ayala, David M. Carr, Eric Dinowitz, and Crystal Hudson were present. The minutes record no approvals, denials, votes, or other substantive decisions.

250 Broadway - 8th Floor - Hearing Room 1 *
Thu Sep 25, 2025 · 1:30 PM

City Council Stated Meeting

City Council reviews multiple zoning actions and designates Whitney Museum as landmark

The New York City Council will consider several land‑use items, including council review of zoning applications for Domino Site B in Brooklyn, the Kingsbridge Armory development in the Bronx, and the Long Island City neighborhood rezoning in Queens. The Council will also designate the former Whitney Museum of American Art at 945 Madison Avenue as a historic landmark and its interior as an interior landmark. Additional actions include approval of special permits for 350 Park Avenue in Manhattan and map amendments affecting the JFK Conduit Logistics Center in Queens and the Broadway Junction station area in Brooklyn.

zoninglandmarksland-usedevelopmentmap-amendments
✓ Decided: Council approved multiple land‑use call‑ups and several local law introductions

The City Council adopted four Land Use Call‑Ups (M 0173‑2025, M 0174‑2025, M 0175‑2025, M 0176‑2025) by consent. It also approved introductions of Local Laws 0780‑A (42‑6 vote), 1271‑A (41‑7 vote), 1302‑A and 1327‑A by consent, and Resolution 1059‑2025 (41‑7 vote). All items were referred to the Committee on Land Use or the appropriate subcommittees for further action.

Council Chambers - City Hall
🗳️ How they voted — 11 divided votes
Named votes as recorded in the official record.
Int 0780-2024 — Approved by Council
42 yea · 6 nay · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis medical · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1271-2025 — Approved by Council
41 yea · 7 nay · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis medical · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 1059-2025 — Approved, by Council
41 yea · 7 nay · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis medical · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0429-2024 — Approved by Council
47 yea · 1 medical · 1 absent · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley nay · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0621-2024 — Approved by Council
47 yea · 1 medical · 1 absent · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0363-2025 — Approved, by Council
36 yea · 9 nay · 3 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato nay · Christopher Marte abstain · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 1074-2025 — Approved, by Council
36 yea · 9 nay · 3 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato nay · Christopher Marte abstain · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
LU 0347-2025 — Approved, by Council
37 yea · 8 nay · 3 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 1078-2025 — Approved, by Council
37 yea · 8 nay · 3 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
LU 0348-2025 — Approved, by Council
36 yea · 8 nay · 4 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz abstain · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 1079-2025 — Approved, by Council
36 yea · 8 nay · 4 abstain · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz abstain · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee abstain · Farah N. Louis medical · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
The other 31 items passed by unanimous or near-unanimous consent.
Thu Sep 25, 2025 · 12:00 PM

Committee on Finance

Committee on Finance to review funding designations for organizations

The Committee on Finance will meet to consider a resolution regarding the designation of organizations to receive funding in the Expense Budget. The meeting also includes a placeholder for other necessary business.

budgetfundingfinance
✓ Decided: Finance Committee approves Resolution 1059‑2025 designating organizations for funding

The Committee on Finance considered Resolution 1059‑2025, which changes the designation of certain organizations to receive funding in the expense budget. The committee voted to approve the resolution as a P‑C item. The vote tally was 14 members in favor and 3 members absent. No other actions were taken.

Council Chambers - City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 1059-2025 — P-C Item Approved by Comm
14 yea · 3 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Thu Sep 25, 2025 · Deferred

Committee on Rules, Privileges and Elections

Committee to meet to announce agenda items

The Committee on Rules, Privileges and Elections will meet to announce the agenda for the upcoming meeting. The session is scheduled for Thursday, September 25, 2025, at 11:30 AM in Council Chambers at City Hall.

city-councilrulesmeetingagenda
Council Chambers - City Hall
Thu Sep 25, 2025 · 11:30 AM

Committee on Environmental Protection, Resiliency and Waterfronts

City Council proposes laws on sustainability plan review, reporting, stormwater easements

The Committee on Environmental Protection, Resiliency and Waterfronts will consider three proposed local laws. Int 1271‑A would require the Environmental Justice Advisory Board to review the city’s long‑term sustainability plan. Int 1302‑A would set reporting requirements for the Office of Long‑Term Planning and Sustainability and repeal several code sections related to climate adaptation, energy policy, wind resource assessment, and the citywide climate adaptation plan. Int 1327‑A would create maintenance easements for post‑construction stormwater management facilities and establish civil penalties for water‑pollution code violations.

environmental-justicesustainabilityclimate-adaptationstormwater-managementlocal-law
✓ Decided: Committee approved three environmental introductions (1271, 1302, 1327)

The Committee on Environmental Protection, Resiliency and Waterfronts approved Introduction 1271-2025 with an 8‑1 vote. It also approved Introduction 1302-2025 with a unanimous 9‑0 vote. Additionally, Introduction 1327-2025 was approved unanimously with a 9‑0 vote.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 1271-2025 — Approved by Committee
8 yea · 1 nay
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan yea · Robert F. Holden yea · Kristy Marmorato nay · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang yea
The other 2 items passed by unanimous or near-unanimous consent.
Thu Sep 25, 2025 · 11:00 AM

Committee on Land Use

Landmarks Commission seeks historic landmark status for former Whitney Museum

The Land Use Committee will consider several applications, including designating the former Whitney Museum at 945 Madison Avenue as both an exterior and interior historic landmark. It will also review special permit requests for a commercial project at 350 Park Avenue, map amendments affecting sites in Queens and Brooklyn, a lease for affordable housing on the Jacobi campus, and sidewalk‑café consents in the Bronx and Brooklyn.

historic-preservationzoninghousingmapsdevelopment
✓ Decided: Committee approves six land‑use applications, from Whitney Museum landmark to 350 Park Ave permits

The Land Use Committee approved six applications by roll‑call vote. The approvals include exterior and interior historic landmark designations for the (Former) Whitney Museum of American Art, two special‑permit requests for a commercial building at 350 Park Avenue, a map amendment to demap the JFK Conduit Logistics Center site in Queens, and a city‑map amendment for the Broadway Junction Station area in Brooklyn. All nine committee members voted in favor of each application.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
LU 0343-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0344-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0351-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0352-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0357-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0358-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0363-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0379-2025 — Disapproved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0380-2025 — Approved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0381-2025 — Disapproved by Committee with Companion Resolution
9 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
Thu Sep 25, 2025 · 10:45 AM

Subcommittee on Zoning and Franchises

Special permits for 350 Park Avenue commercial building considered

The Subcommittee on Zoning and Franchises will vote on two special‑permit applications (LU 0351‑2025 and LU 0352‑2025) submitted by VNO 350 Park Development LLC for a proposed commercial building at 350 Park Avenue in Manhattan. It will also review map‑amendment applications to close streets and adjust grades for the JFK Conduit Logistics Center in Queens (LU 0357‑2025) and for the Broadway Junction Station area in Brooklyn (LU 0358‑2025). Additionally, the committee will consider revocable sidewalk‑café consents for locations in the Bronx and Brooklyn.

zoningspecial-permitmap-amendmentmidtownqueensbrooklynbronx
✓ Decided: Subcommittee unanimously approved three 350 Park Ave permits and two map amendments

The Subcommittee on Zoning and Franchises voted to approve three special‑permit applications for the 350 Park Avenue commercial project in Manhattan. It also approved two City Map amendments affecting the JFK Conduit Logistics Center in Queens and the Broadway Junction station area in Brooklyn. The committee disapproved a sidewalk‑café consent for Lava Rock Kitchen in the Bronx. All approvals and the disapproval were adopted by unanimous roll‑call vote of the seven members.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
LU 0351-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0352-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0357-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0358-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0379-2025 — Disapproved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0380-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0381-2025 — Disapproved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Sep 25, 2025 · 10:30 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee to consider lease of Bronx HHC land for affordable housing

The Subcommittee on Landmarks, Public Sitings and Dispositions will review Application LU 0363-2025 submitted by the New York City Health and Hospitals Corporation. The application seeks authorization to lease a parcel on the NYC Health & Hospitals/Jacobi campus in the Bronx to The Fortune Society, Inc. or an affiliate housing development fund. The lease would enable construction of a multifamily affordable residential building with supportive housing in Council District 13, Community District 11.

landmarkshousingaffordable-housingbronxpublic-sittingsdispositions
✓ Decided: Subcommittee approves lease of Bronx hospital land for affordable housing

The Subcommittee on Landmarks, Public Sitings and Dispositions voted to approve LU 0363-2025, an application by the NYC Health & Hospitals Corporation to lease a parcel at the Jacobi Hospital campus to The Fortune Society for a multifamily affordable and supportive housing development in Bronx Community District 11, Council District 13. The motion passed with six members voting affirmative and one member absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0363-2025 — Approved by Subcommittee
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
Thu Sep 25, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee will consider a law aligning earned safe/sick time with schedule change act

The Committee on Consumer and Worker Protection will consider Int. No. 780-A, a local law amendment to the city’s administrative code. The proposal seeks to align the requirements of the Earned Safe and Sick Time Act with the Temporary Schedule Change Act. No other agenda items are listed.

laborworker-protectionearned-sick-timeschedule-changelocal-law
✓ Decided: Committee approves Int 0780-2024-A to align earned safe and sick time rules

The Consumer and Worker Protection Committee approved Introduction 0780-2024-A, a local law to align the requirements of the Earned Safe and Sick Time Act with the Temporary Schedule Change Act. The vote was affirmative by Chair Julie Menin, Councilmembers Shaun Abreu, Amanda Farías, and Shekar Krishnan. Councilmembers Gale A. Brewer, Chi A. Ossé, and Julie Won were absent.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0780-2024 — Approved by Committee
4 yea · 3 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer absent · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé absent · Julie Won absent
Thu Sep 25, 2025 · 9:30 AM

Committee on Technology

Committee will consider a local law on cloud computing policy

The Committee on Technology will discuss Proposed Int. No. 540-A, a local law that assesses a cloud computing policy for New York City agency technological needs. The meeting is scheduled for September 25, 2025 at 250 Broadway, 8th Floor, Hearing Room 3.

technologycloud-computinglocal-lawcity-agencypolicy
✓ Decided: Committee on Technology approves cloud computing policy introduction

The Committee on Technology approved Introduction Int 0540-2024-A, a local law to assess a cloud computing policy for city agency technology needs. The motion passed with all five members voting affirmative. No other actions were taken at this meeting.

250 Broadway - 8th Floor - Hearing Room 3 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0540-2024 — Approved by Committee
5 yea
Jennifer Gutiérrez yea · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Thu Sep 25, 2025 · 9:30 AM

Committee on Education

Council to discuss afterschool programs and school safety

The Committee on Education will consider a local law to amend the administrative code regarding afterschool programs and two resolutions urging state action on oral health education and the Protect Our Schools Act.

educationafterschoolhealthsafetycouncilcommittee
✓ Decided: Committee approves afterschool program law and two education resolutions

The Education Committee approved a local law to amend the city code for after‑school programs. It also approved a resolution urging the State Education Department to adopt oral‑health education in elementary schools. Finally, the committee approved a resolution supporting the Protect Our Schools Act to limit civil arrests in school activities. All three items passed with 12 votes in favor and 1 member absent.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0955-2024 — Approved by Committee
12 yea · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Res 0718-2025 — Approved by Committee
12 yea · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Res 0929-2025 — Approved by Committee
12 yea · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Thu Sep 25, 2025 · 9:00 AM

Committee on Civil Service and Labor

Resolution to require a practical exam for painters in civil service testing

The Committee on Civil Service and Labor will consider Resolution 0860-2025, which calls on the Department of Citywide Administrative Services to develop and implement a qualifying practical exam for painters as part of the civil service testing process. The proposal aims to add a hands‑on component to ensure painter qualifications. No other agenda items are listed.

civil-servicelabortrainingexampainters
✓ Decided: Committee approves resolution to create painter practical exam

The Committee on Civil Service and Labor voted to approve Resolution 0860-2025, directing the Department of Citywide Administrative Services to develop and implement a qualifying practical exam for painters in the civil service testing process. The motion passed with eight affirmative votes and one member absent. No other actions were taken.

250 Broadway - 8th Floor - Hearing Room 1 VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0860-2025 — Approved by Committee
8 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks absent · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Tue Sep 23, 2025 · Deferred

Committee on Civil and Human Rights

Committee will hold an oversight hearing on housing discrimination and inequity.

The City Council Committee on Civil and Human Rights will convene on September 23, 2025 at 1:00 PM. The meeting’s agenda item T2025-4036 calls for an oversight hearing focused on housing discrimination and inequity. No other items or decisions are listed.

housing-discriminationcivil-rightsoversight
250 Broadway - Hearing Room, 16th Floor
Tue Sep 23, 2025 · Deferred

Committee on Public Safety

Committee reviews NYPD officer discipline and civilian complaint board

The Committee on Public Safety will hold an oversight meeting on NYPD officer discipline and the Civilian Complaint Review Board. The agenda item is listed as T2025-3986.

public-safetypoliceoversightnypdcivilian-complaint-review-board
Council Chambers - City Hall
Mon Sep 22, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Special permit requests for 350 Park Avenue commercial building in Midtown Manhattan

The Subcommittee on Zoning and Franchises will consider two special‑permit applications (LU 0351‑2025 and LU 0352‑2025) submitted by VNO 350 Park Development LLC for a proposed commercial building at 350 Park Avenue in the Special Midtown District. The agenda also includes several city‑map amendment applications and rezoning proposals affecting Queens, Brooklyn, and the Bronx.

zoningpermitsmap-amendmentrezoningmidtownqueensbrooklyn
✓ Decided: Subcommittee laid over six land‑use applications, postponing decisions

The Zoning and Franchises Subcommittee held hearings on six land‑use applications and then voted to lay each over, meaning the matters will be reconsidered later. No vote tallies were recorded in the minutes. The applications include a special permit for 350 Park Avenue, map amendments for the JFK Conduit Logistics Center and Broadway Junction Station, and sidewalk‑café consents for El Caldero and Lava Rock in the Bronx.

250 Broadway - 8th Floor - Hearing Room 3
Mon Sep 22, 2025 · 10:00 AM

Committee on Public Safety

Committee reviews NYPD officer discipline and civilian complaint board

The Committee on Public Safety will hold an oversight hearing on NYPD officer discipline. The meeting will also address matters concerning the Civilian Complaint Review Board. No other agenda items are listed.

public-safetypoliceoversightnypdcivilian-complaint-review-board
✓ Decided: Public Safety Committee held oversight hearing, no actions taken

The New York City Council Committee on Public Safety met on September 22, 2025 at City Hall. Members Yusef Salaam, Joann Ariola, Diana I. Ayala, Tiffany Cabán, Carmen N. De La Rosa, Robert F. Holden, Rita C. Joseph, Christopher Marte and Althea V. Stevens were present; Chi A. Ossé was absent, and Council Members Restler and Public Advocate Williams also attended. The committee conducted an oversight hearing and filed an oversight report. No motions, approvals, denials, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Mon Sep 22, 2025 · 1:00 PM

Committee on Veterans

Council committee to consider implementing Veterans Advisory Board recommendations

The Committee on Veterans will review the oversight item T2025-3927, which calls for implementing the recommendations made by the Veterans Advisory Board. The council members will discuss how to carry out those recommendations during the September 22 meeting.

veteransoversightcity-councilpolicy
✓ Decided: Veterans Committee held oversight hearing, no decisions recorded

The Committee on Veterans met on September 22, 2025, with Chair Robert F. Holden and members Joann Ariola, Kristy Marmorato, and Vickie Paladino present. An oversight hearing (T2025-3927) was conducted and a committee report was filed as an attachment. No votes, approvals, or other substantive actions were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 1
Mon Sep 22, 2025 · 1:00 PM

Committee on Economic Development

Council committee to review progress on the NYC Industrial Plan

The Committee on Economic Development will hold an oversight hearing to review the progress of the NYC Industrial Plan. The meeting is scheduled for Monday, September 22, 2025, at 1:00 PM in Hearing Room 3 at City Hall.

economic-developmentindustrial-planoversightcity-hallhearing
✓ Decided: Committee held oversight hearing on NYC Industrial Plan, no decisions made

The Economic Development Committee met on September 22, 2025 for an oversight hearing on the NYC Industrial Plan. No motions, approvals, denials, or votes were recorded. The meeting consisted of a roll call and presentation of the plan materials.

250 Broadway - 8th Floor - Hearing Room 3
Mon Sep 22, 2025 · 1:00 PM

Committee on Aging

Committee on Aging reviews four local laws on meals and senior housing reporting

The New York City Council Committee on Aging will consider four proposed Local Laws: one to create a grab‑and‑go meal program at older adult centers, one to establish a technical support program for older adults, one to require reporting on senior and accessible dwelling units, and one to require home‑delivered meals every day of the calendar year. The committee will also conduct oversight of the NYC Department for the Aging meal programming.

agingmealshousinglegislationcity-council
✓ Decided: Committee held hearings and filed several aging program proposals

The Committee on Aging held hearings on four proposed local laws concerning meal programs and senior housing reporting. Each proposal was subsequently filed by the committee. No votes or approvals were recorded.

Council Chambers - City Hall
Mon Sep 22, 2025 · 10:00 AM

Committee on Rules, Privileges and Elections

Council will consider a resolution to amend its rules for clearer, consistent practice.

The Committee on Rules, Privileges and Elections will discuss Resolution T2025-4160, which proposes amendments to the Council's rules to improve clarity and consistency with existing practices and precedent. The meeting will also address item T2024-0001 and any other business deemed necessary. No other agenda items are listed.

governancerulescity-councilprocedures
✓ Decided: Committee held roll call; no decisions recorded

The Committee on Rules, Privileges and Elections met on September 22, 2025 at 10:00 AM in the Council Chambers, City Hall. Members present were Chair Keith Powers and members Adrienne E. Adams, Diana I. Ayala, Justin L. Brannan, Gale A. Brewer, Selvena Brooks-Powers, Amanda Farías, Crystal Hudson, Rafael Salamanca Jr., and Pierina Ana Sanchez. The committee pre‑considered resolutions T2025‑4160 and T2024‑0001, noting a hearing and that the items were laid over, but no votes or approvals were recorded.

Council Chambers - City Hall
Fri Sep 19, 2025 · 10:00 AM

Committee on Health

Council to review Legionnaires' disease oversight and cooling tower inspections

The Committee on Health will hold an oversight hearing on Legionnaires' disease, cooling tower inspections, and tenant safety. The agenda includes three local laws proposing to require building owners to provide shower hoses and informational materials to tenants, improve building water system maintenance, and mandate cooling tower inspections during heat-related emergencies.

healthlegionnaires-diseasecooling-towerswater-safetyoversightcity-hall
✓ Decided: Health Committee held hearings on Legionnaires' disease and water system bills

The Committee on Health conducted a hearing on oversight of Legionnaires’ disease and cooling‑tower safety (T2025-3987). It also introduced three local‑law proposals: Int 0166‑2024 on shower hoses and tenant information, Int 0434‑2024 on building water‑system maintenance, and Int 1390‑2025 on cooling‑tower inspections. No votes, approvals, or rejections were recorded; the items were only heard and laid over.

Council Chambers - City Hall
Thu Sep 18, 2025 · Deferred

City Council Stated Meeting

No substantive agenda items listed for the Sep 18 City Council meeting

The posted agenda for the New York City Council meeting on September 18, 2025 contains only the council membership and meeting details. No specific resolutions, contracts, or hearings are listed. Therefore, no decisions or discussions can be identified from this agenda.

city-councilprocedural
Council Chambers - City Hall
Thu Sep 18, 2025 · 1:00 PM

Committee on Children and Youth

Committee to hold oversight hearing on afterschool expansion

The Committee on Children and Youth is meeting to conduct oversight regarding afterschool expansion and a concept paper from the Department of Youth and Community Development (DYCD).

childrenyouthafterschooldycdoversight
✓ Decided: Committee held oversight hearing on afterschool expansion

The Committee on Children and Youth met on September 18, 2025. Members Stevens, Joseph, Lee, Menin, and Williams were present; Ossé was absent. The committee held an oversight hearing on afterschool expansion and the DYCD concept paper (Agenda Item T2025-3959). No decisions, approvals, or votes were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Thu Sep 18, 2025 · 10:00 AM

Committee on Sanitation and Solid Waste Management

Committee discusses street cleanliness and new waste management laws

The Committee on Sanitation and Solid Waste Management is holding an oversight hearing on street cleanliness challenges. The body will also consider four proposed local laws regarding food donation notices, supplemental sanitation services, medical waste, and dumping complaints.

sanitationwaste-managementfood-wastecommercial-wastestreet-cleanliness
✓ Decided: Committee held hearings and laid over several sanitation bills

The Sanitation and Solid Waste Management Committee conducted hearings on four local law introductions (Int 0536-2024, Int 1279-2025, Int 1349-2025, Int 1370-2025) and an oversight hearing (T2025-4043). No votes, approvals, or denials were recorded; the introductions were either heard or laid over by the committee.

250 Broadway - 8th Floor - Hearing Room 1
Thu Sep 18, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

City Council to consider historic landmark designation for former Whitney Museum

The Subcommittee on Landmarks, Public Sitings and Dispositions will review applications to designate the former Whitney Museum of American Art at 945 Madison Avenue as both an exterior and interior historic landmark. It will also consider several housing‑related proposals, including a tax‑exemption request for Lincoln Avenue properties in Brooklyn and lease agreements for affordable housing on NYC Health + Hospitals sites in the Bronx. All items are presented for council action on September 18, 2025.

landmarkshousingtax-exemptiondevelopmenthealthcare
✓ Decided: Subcommittee approved one land use application and postponed three others

The Subcommittee on Landmarks, Public Sitings and Dispositions approved Land Use Application LU 0344-2025 with unanimous affirmative votes. It laid over applications LU 0346-2025, LU 0363-2025, and LU 0364-2025. Hearings were held for other applications but no decisions were recorded.

Council Chambers - City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0343-2025 — Approved by Subcommittee
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0344-2025 — Approved by Subcommittee
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
Wed Sep 17, 2025 · Deferred

Committee on Children and Youth

Committee reviews afterschool expansion and DYCD concept paper

The Committee on Children and Youth is meeting to conduct oversight regarding afterschool expansion. The discussion focuses on a concept paper provided by the Department of Youth and Community Development (DYCD).

childrenyouthafterschooldycdoversight
Committee Room - City Hall
Wed Sep 17, 2025 · Deferred

Committee on Mental Health, Disabilities and Addiction

Committee reviews 988 Lifeline oversight and suicide reporting law

The Committee on Mental Health, Disabilities and Addiction will hold a hearing on the current access and operations of New York City's 988 Suicide & Crisis Lifeline. It will consider a local law amendment requiring the commissioner of health and mental hygiene to issue an annual report on city suicides. The committee will also review a local law establishing a construction‑site opioid antagonist program.

mental-healthsuicideopioidconstructioncity-council
250 Broadway - Hearing Room, 16th Floor
Wed Sep 17, 2025 · Deferred

Committee on Finance

Committee on Finance meeting agenda to be announced

The agenda for the September 17, 2025, Committee on Finance meeting has not yet been announced. No specific items for decision or discussion are listed.

financecity-council
Committee Room - City Hall
Wed Sep 17, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Subcommittee to consider extensive Long Island City zoning map amendments

The Subcommittee on Zoning and Franchises will review several applications, including a map change for Archer Avenue in Queens and a large set of zoning district revisions for the Long Island City Neighborhood Plan. It will also consider a proposal to create a Mandatory Inclusionary Housing area, an Urban Development Action Area, and multiple property acquisition and disposition requests. Additional items include revocable sidewalk‑café consents for locations in the Bronx and Brooklyn.

zoninghousingdevelopmentpropertystreetsboroughs
✓ Decided: Subcommittee heard and laid over multiple land‑use applications

The Zoning and Franchises Subcommittee held hearings on several land‑use applications, including LU 0372‑2025 for Station Plaza Jamaica and LU 0379‑2025 for a Bronx sidewalk café. After the hearings, the subcommittee laid over the same applications without a vote. No approvals, denials, or amendments were adopted during this meeting.

Council Chambers - City Hall
Wed Sep 17, 2025 · 10:00 AM

Committee on Women and Gender Equity

Council committee will review implementation of NYC paid family and prenatal leave.

The Committee on Women and Gender Equity will hold a pre‑consideration hearing on two items. First, it will oversee how the city is implementing paid family leave and prenatal leave. Second, it will consider a local law amendment to launch an education campaign for the public and non‑obstetric health providers about healthy living and chronic disease management during and after pregnancy.

paid-family-leaveprenatal-leavehealth-educationlocal-lawwomen
✓ Decided: Committee held oversight hearing and introduced pregnancy health education bill

The Committee on Women and Gender Equity held an oversight hearing on the implementation of paid family leave and prenatal leave in New York City. It also introduced Int 1393-2025, a local law to create an education campaign for healthy living during and after pregnancy. No votes or formal decisions were recorded in the minutes.

250 Broadway - 8th Floor - Hearing Room 3
Tue Sep 16, 2025 · 10:00 AM

Committee on Immigration

Oversight hearing on immigrant mental health needs in NYC

The Committee on Immigration will hold an oversight hearing titled T2025-3991 to examine the mental health needs of immigrants in New York City. Council members will discuss existing services and potential actions to address identified gaps.

immigrationmental-healthoversightcity-council
✓ Decided: Committee held oversight hearing on immigrant mental health needs

The Committee on Immigration conducted an oversight hearing titled “Addressing the Mental Health Needs of Immigrants in NYC.” A committee report was attached and filed. No votes or formal decisions were recorded.

250 Broadway - 8th Floor - Hearing Room 1
Mon Sep 15, 2025 · Deferred

Committee on Fire and Emergency Management

Committee to review fire safety for community energy storage facilities

The Committee on Fire and Emergency Management will hold an oversight meeting to examine fire safety and permitting approval processes for community energy storage facilities.

fire-safetyenergyoversightpermitting
Committee Room - City Hall
Mon Sep 15, 2025 · 1:00 PM

Committee on General Welfare

Council reviews bills on census office, federal funding reports, and rent‑voucher caps

The Committee on General Welfare will consider three local laws: one to amend the city charter to create a census office, one to require monthly reports on federal funding, and one to limit the rent contribution for rental‑assistance voucher recipients. The committee will also hold oversight of the impacts of federal budget cuts. These items are discussed jointly with the Committee on Governmental Operations, State & Federal Legislation and the Committee on Hospitals.

censusfederal-fundinghousingrent-assistancebudgetlegislation
✓ Decided: Committee held hearings on federal budget, census and housing proposals

The General Welfare Committee conducted hearings on Oversight of federal budget cuts (T2025-3963) and introduced three local laws: establishing a city census office (Int 1225-2025), requiring monthly reporting on federal funding (Int 1364-2025), and limiting rent contributions for voucher recipients (Int 1372-2025). Each item was filed or laid over by the committee, but no votes or final actions were taken.

Council Chambers - City Hall Jointly with the Committee on Governmental Operations, State & Federal Legislation and the Committee on Hospitals
Mon Sep 15, 2025 · 1:00 PM

Committee on Governmental Operations, State & Federal Legislation

Council committee to discuss federal budget cuts and census office creation

The Committee on Governmental Operations, State & Federal Legislation will hold an oversight hearing on federal budget cuts. The body will also consider three local laws regarding federal funding reporting, rental assistance vouchers, and the establishment of a census office.

federal-budgetcensusrental-assistancegovernment-operationsfederal-funding
✓ Decided: Committee held hearings on federal budget cuts and three local law proposals

The Committee on Governmental Operations held a hearing on the impacts of federal budget cuts and filed the oversight report. It also held hearings on three local law introductions—establishing a city census office, requiring monthly federal‑funding reports, and limiting rent contributions for voucher recipients—and each was laid over without further action.

Council Chambers - City Hall Jointly with the Committee on General Welfare and the Committee on Hospitals.
Mon Sep 15, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee to hold oversight hearing on commuter vans and consider five local laws

The Transportation and Infrastructure Committee will conduct an oversight hearing (T2025-3940) on commuter vans, for‑hire vehicles, and licensing. It will also consider five local law proposals: a mobile app for electric‑vehicle charging stations (Int 0115-2024), adding two commissioners to the Taxi and Limousine Commission board (Int 0139-2024), permitting commercial parking spaces for for‑hire vehicles (Int 1000-2024), directing a study of the commuter‑van industry (Int 1346-2025), and enforcing violations against unlicensed commuter vans (Int 1347-2025).

transportationcommuter-vanstaxi-limousine-commissionelectric-vehiclesparkinglocal-law
✓ Decided: Transportation Committee held hearings and filed multiple bill introductions

The Committee on Transportation and Infrastructure held an oversight hearing on TLC commuter vans (T2025-3940). It also heard and filed several bill introductions: Int 0115-2024 for an electric‑vehicle charging‑station app, Int 0139-2024 to add two commissioners to the Taxi and Limousine Commission, Int 1000-2024 to permit commercial parking spaces for for‑hire vehicles, Int 1346-2025 to require a study of the commuter‑van industry, and Int 1347-2025 to enforce violations against unlicensed commuter vans. No votes or final approvals were recorded.

Council Chambers - City Hall
Mon Sep 15, 2025 · 1:00 PM

Committee on Hospitals

Committee will examine impacts of federal budget cuts

The Committee on Hospitals will hold an oversight hearing on the impacts of federal budget cuts (T2025-3965). It will consider three local law proposals: Int 1225‑2025 to amend the city charter to create an office of the census; Int 1364‑2025 to amend the administrative code for monthly reporting by the director of management and budget on all federal funding; and Int 1372‑2025 to amend the administrative code to limit household rent contributions for rental‑assistance voucher recipients. The hearing will be conducted jointly with the Committee on General Welfare and the Committee on Governmental Operations, State & Federal Legislation.

budgetfederal-fundinghousingcensuslegislation
✓ Decided: Committee held hearings and filed introductions on three local laws

The Committee on Hospitals held a hearing on Oversight T2025-3965 concerning federal budget cuts. It also held hearings and filed introductions for Int 1225-2025 (establishing a city census office), Int 1364-2025 (monthly reporting on federal funding), and Int 1372-2025 (limiting rent contributions for voucher recipients). No votes or final actions were recorded.

Council Chambers - City Hall Jointly with the Committee on General Welfare and the Committee on Governmental Operations, State & Federal Legislation
Fri Sep 12, 2025 · 1:00 PM

Committee on Consumer and Worker Protection

Committee considers laws on wage theft, self-storage fees, and contractor permits

The Committee on Consumer and Worker Protection will discuss several proposed local laws regarding consumer protections and worker rights. The items include regulations for home repair contractors and protections for app-based delivery workers.

consumer-protectionworkers-rightshousingcontractorslabor
✓ Decided: Committee held hearings on multiple introductions, no decisions taken

The Consumer and Worker Protection Committee held hearings on six bill introductions and one resolution. Each item was heard and then laid over by the committee, with no vote recorded. No substantive actions were approved, denied, or tabled during this meeting.

Council Chambers - City Hall
Wed Sep 10, 2025 · 1:30 PM

City Council Stated Meeting

Council reviews zoning changes and delivery worker safety laws

The City Council will review multiple zoning applications and consider three Local Laws regarding third-party delivery workers. The body will also discuss the resignation of Council Member Carlina Rivera.

zoningdelivery-workerspublic-safetyland-usebudgethousingcriminal-justiceresignation
✓ Decided: Council overrides mayor veto to repeal misdemeanor penalties for street vendors

The City Council voted to override the mayor’s veto of Intro No. 47‑B, repealing misdemeanor criminal penalties for general and mobile food vendors. The override passed 35‑9 with 3 abstentions, enacting Local Law 122. The Council also approved other measures, including overrides of two mayoral vetoes and several land‑use call‑ups.

Council Chambers - City Hall
🗳️ How they voted — 7 divided votes
Named votes as recorded in the official record.
Int 0020-2024 — Approved by Council
39 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0047-2024 — Overridden by Council
35 yea · 9 nay · 3 absent · 3 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya abstain · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung abstain · Inna Vernikov nay · Nantasha M. Williams abstain · Julie Won yea · Susan Zhuang yea
Int 1133-2024 — Overridden by Council
40 yea · 7 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1135-2024 — Overridden by Council
39 yea · 8 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1240-2025 — Approved by Council
39 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1242-2025 — Approved by Council
39 yea · 7 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1258-2025 — Approved by Council
40 yea · 6 nay · 4 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz absent · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 29 items passed by unanimous or near-unanimous consent.
Wed Sep 10, 2025 · 11:00 AM

Committee on Consumer and Worker Protection

Mayor vetoes proposed repeal of misdemeanor penalties for vendors

The Committee on Consumer and Worker Protection will consider several proposed local laws affecting delivery workers, powered bicycle safety, and vendor regulations. It will also receive communications from the Mayor vetoing three proposals: the repeal of misdemeanor penalties for general and mobile food vendors, protections for contracted delivery workers, and minimum payment standards for grocery delivery workers. All items are listed as to be filed for the meeting.

delivery-workersvendor-regulationmayor-vetolocal-lawconsumer-protection
✓ Decided: Committee approves four local law introductions and files mayor's veto messages

The Consumer and Worker Protection Committee unanimously approved four local law introductions covering third‑party delivery workers, powered‑bicycle safety, vendor misdemeanor penalties, and grocery‑delivery worker pay. The committee also filed the mayor's veto messages for each of those introductions. All actions were recorded as roll‑call votes with six members in favor and one absent.

Committee Room - City Hall VOTE*
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
Int 0020-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Int 0047-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
M 0156-2025 — Filed by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Int 1133-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
M 0157-2025 — Filed by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Int 1135-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
M 0158-2025 — Filed by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Wed Sep 10, 2025 · 10:00 AM

Committee on Women and Gender Equity

Council to consider banning unsafe menstrual and intimate care products

The Committee on Women and Gender Equity will consider two proposed local laws. The first would amend the city’s administrative code to prohibit the sale of menstrual and intimate care products that contain unsafe ingredients. The second would amend the code to correct sex designations on death records. No other agenda items are listed.

women-healthconsumer-protectionvital-recordslegislation
✓ Decided: Committee approves two local law introductions on product safety and death record gender designations

The Committee on Women and Gender Equity approved Introduction 0867-2024-A, a local law to prohibit the sale of menstrual and intimate care products containing unsafe ingredients, and Introduction 1258-2025-A, a local law to correct sex designations on death records. Both motions passed by roll‑call with four members voting affirmative and one member absent. No other actions were taken.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0867-2024 — Approved by Committee
4 yea · 1 absent
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov absent
Int 1258-2025 — Approved by Committee
4 yea · 1 absent
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov absent
Wed Sep 10, 2025 · 10:00 AM

Committee on General Welfare

Committee considers housing data, legal aid, and social worker workforce measures

The Committee on General Welfare will consider three proposed items. The first is Local Law Int. 0791‑2024, which would require the Department of Social Services to post on its website data about vacant supportive housing units. The second is Local Law Int. 1175‑2025, which would amend the administrative code to provide civil legal services for income‑eligible domestic‑violence survivors in divorce proceedings. The third is Resolution 0362‑2024, which urges the New York State Legislature and the Governor to pass the Social Worker Workforce Act (A.701/S.988).

housinglegal-aidsocial-welfarelegislationcity-council
✓ Decided: Committee approves three welfare-related measures

The Committee on General Welfare approved three items by roll call: Introduction 0791-2024-A requiring the Department of Social Services to post data on vacant supportive housing units, Introduction 1175-2025-A expanding civil legal services for income‑eligible domestic‑violence survivors in divorce proceedings, and Resolution 0362-2024-A urging the state legislature and governor to enact the Social Worker Workforce Act. All eight members voted affirmative and one member was absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0791-2024 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé absent · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Int 1175-2025 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé absent · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Res 0362-2024 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé absent · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Wed Sep 10, 2025 · 9:30 AM

Committee on Fire and Emergency Management

Local law to create a residential fire emergency response guide

The Committee on Fire and Emergency Management will consider a proposed Local Law, Int. No. 751-B, to amend the New York City Administrative Code. The amendment would establish a residential fire emergency response guide. The committee will discuss and vote on this proposal.

fireemergency-managementlocal-lawpublic-safety
✓ Decided: Committee approves Int 0751-2024-B for residential fire emergency guide

The Committee on Fire and Emergency Management voted to approve Introduction Int 0751-2024-B, a local law amendment to create a residential fire emergency response guide. The motion passed by roll call with six members voting affirmative and one member absent. No other actions were taken in this meeting.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0751-2024 — Approved by Committee
6 yea · 1 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kevin C. Riley yea · Lynn C. Schulman yea · Susan Zhuang yea
Wed Sep 10, 2025 · 9:30 AM

Committee on Criminal Justice

Local Law to provide technology for custody evidence review

The Committee on Criminal Justice will consider three Local Laws and a proposed amendment. The items address technology for people in custody to receive and review evidence, creation of a holistic needs assessment program, and coordination of the transition to borough‑based jails. The committee will vote on these proposals at the September 10 meeting.

criminal-justicetechnologyevidencejail-transitionholistic-needs
✓ Decided: Committee approves three criminal‑justice local law introductions

The Criminal Justice Committee approved three introductions to local law: Int 1238‑2025‑A on evidence review technology, Int 1240‑2025‑A on holistic clinical assessments for incarcerated individuals, and Int 1242‑2025‑A on establishing jail‑transition coordinators. Each motion passed by roll‑call with eight members voting affirmative and one member absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1238-2025 — Approved by Committee
8 yea · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens absent
Int 1240-2025 — Approved by Committee
8 yea · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens absent
Int 1242-2025 — Approved by Committee
8 yea · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens absent
Wed Sep 10, 2025 · 10:45 AM

Committee on Land Use

Committee on Land Use to review rezoning and special permit applications

The Committee on Land Use is reviewing several land-use applications, including rezoning requests in Brooklyn and the Bronx. The body will also consider a special permit for a commercial building in Manhattan and a sidewalk café consent in Queens.

zoninghousingland-usemanhattanbrooklynbronxqueens
✓ Decided: Committee approved multiple land‑use applications, most with modifications

The Committee on Land Use held a hearing on eight applications covering rezoning and inclusionary‑housing changes in Brooklyn, the Bronx, and Manhattan. The committee voted 8‑1 to approve seven of the applications, either with modifications and referral to the City Planning Commission or with companion resolutions; one application was simply filed. Councilmember Hanks was the sole member absent for each vote.

Council Chambers - City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
LU 0347-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0348-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0349-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0350-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0353-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0354-2025 — Filed by Committee
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0355-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0356-2025 — Filed by Committee
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0359-2025 — Disapproved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
LU 0368-2025 — P-C Item Approved by Committee with Companion Resolution
8 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Pierina Ana Sanchez yea
🏢 Building at this address: 19 m tall
Wed Sep 10, 2025 · 10:30 AM

Committee on Finance

Finance Committee reviews Highbridge and Le Grande Ville land parcels

The New York City Council Committee on Finance will consider two land‑parcel items. Item T2025-4058 concerns the Highbridge Cluster, covering multiple blocks and lots in Bronx Community Districts 4 and 5, Council Districts 14 and 16. Item T2025-4059 concerns Le Grande Ville, a single lot in Block 2867, Bronx Community District 5, Council District 14. The agenda also includes any other business the committee may deem necessary.

financeland-usezoningbronx
✓ Decided: Committee on Finance approves three Bronx land‑use applications

The Committee on Finance approved three land‑use applications—LU 0360‑2025, LU 0361‑2025, and LU 0362‑2025—each with a companion resolution. All three approvals recorded 14 affirmative votes and 3 members absent. No other substantive actions were taken at this meeting.

Committee Room - City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0360-2025 — P-C Item Approved by Committee with Companion Resolution
14 yea · 3 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0361-2025 — P-C Item Approved by Committee with Companion Resolution
14 yea · 3 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0362-2025 — P-C Item Approved by Committee with Companion Resolution
14 yea · 3 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Wed Sep 10, 2025 · 10:30 AM

Subcommittee on Zoning and Franchises

Subcommittee reviews rezoning and special permit requests across four boroughs

The Subcommittee on Zoning and Franchises will discuss several land-use applications, including rezoning requests in Brooklyn and the Bronx. The body will also consider a special permit for a hotel and pedestrian space in Manhattan and a sidewalk café consent in Queens.

zoninghousingland-usehotelssidewalk-cafestax-exemption
✓ Decided: Subcommittee approved seven rezoning and permit applications, 6‑1 each

The Zoning and Franchises Subcommittee voted 6‑1 to approve seven land‑use applications, with Councilmember Hanks absent. Four applications were approved with modifications and referred to the City Planning Commission, while three were approved outright. The decisions cover rezoning projects in Brooklyn, the Bronx, and Manhattan, as well as special permits and inclusionary‑housing designations.

Council Chambers - City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
LU 0347-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0348-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0349-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0350-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0353-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0354-2025 — Filed by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0355-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0356-2025 — Filed by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0359-2025 — Disapproved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0368-2025 — P-C Item Approved by Subcommittee with Companion Resolution
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks absent · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
🏢 Building at this address: 19 m tall
Tue Sep 9, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Subcommittee to map Jamaica neighborhood changes

The Subcommittee on Zoning and Franchises will consider amending the City Map to rezone parts of Jamaica, Queens, and close specific streets for a park. The agenda also includes a technical correction for an existing tax exemption.

zoningjamaicaqueensstreetshousingparkscity-map
✓ Decided: Subcommittee held hearings on several land‑use applications, no approvals recorded

The Zoning and Franchises Subcommittee conducted hearings on multiple land‑use applications, including the JFK Conduit Logistics Center demapping and the Broadway Junction Station map amendment. Several applications were subsequently laid over for further consideration. No approvals, denials, or vote tallies were recorded during this meeting.

Council Chambers - City Hall
Mon Sep 8, 2025 · Deferred

Committee on Health

Committee reviews Legionnaires’ disease oversight and cooling tower safety

The City Council Committee on Health will hold an oversight meeting on Legionnaires’ disease. Members will review the city’s cooling‑tower inspection program and discuss measures to protect public health. The committee may consider recommendations for improving safety protocols.

healthdiseasewater-safetyinspectionspublic-health
Council Chambers - City Hall
Wed Aug 20, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will consider rezoning and inclusionary housing for 1946 East 7th St

The Subcommittee on Zoning and Franchises will review several charter applications related to 1946 East 7th Street in Brooklyn. One application seeks to change the zoning map from an R5 district to R6A and R7A districts, while another proposes establishing a Mandatory Inclusionary Housing area. Additional items on the agenda include other rezoning and special‑permit requests across the city.

zoningrezoninginclusionary-housingspecial-permitsmap-amendmentborough-brooklynborough-queens
✓ Decided: Subcommittee heard and laid over multiple zoning applications

The Zoning and Franchises Subcommittee held hearings on several land‑use applications, including rezoning of 1946 East 7th Street, 5602‑5604 Broadway, 350 Park Avenue, 515 7th Avenue, and a map amendment for the JFK Conduit Logistics Center. After the hearings, the subcommittee laid over each application. No approvals, denials, or vote tallies were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor
Thu Aug 14, 2025 · 10:30 AM

Committee on Criminal Justice

Council to consider expanding supportive housing eligibility

The Committee on Criminal Justice will meet to discuss a proposed local law that would amend the administrative code to expand supportive housing eligibility for individuals who have been involuntarily confined.

criminal-justicehousingcouncil-meetingsupportive-housinglegislation
✓ Decided: Criminal Justice Committee approves Intro 1100-2024-A on supportive housing

The Committee on Criminal Justice approved Introduction 1100-2024-A, which amends the city’s administrative code regarding supportive housing eligibility for persons who have been involuntarily confined. The motion passed by roll call with seven members voting affirmative and two members absent. No other actions were taken.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1100-2024 — Approved by Committee
7 yea · 2 absent
Sandy Nurse absent · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif absent · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Thu Aug 14, 2025 · 9:30 AM

Committee on Aging

Resolution to designate August 14 as Social Security Day in NYC

The Committee on Aging will consider Resolution 0986-2025. The resolution seeks to recognize August 14, 2025 as the 90th anniversary of Social Security. It also proposes to commemorate August 14 each year as Social Security Day in the City of New York.

social-securitycommemorationcity-councilaginglegislation
✓ Decided: Committee on Aging approved resolution designating Social Security Day

The Committee on Aging approved Resolution 0986-2025, which recognizes August 14, 2025 as the 90th anniversary of Social Security and designates August 14 as Social Security Day in New York City. The resolution passed with six affirmative votes and one member absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0986-2025 — Approved by Committee
6 yea · 1 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee yea · Darlene Mealy yea · Yusef Salaam absent · Lynn C. Schulman yea · Susan Zhuang yea
Thu Aug 14, 2025 · 10:00 AM

Committee on Health

Health Committee to review laws on transgender care and child care safety

The Committee on Health is discussing several proposed local laws to amend the city administrative code. The items focus on medical training, patient rights, and child care oversight.

healthcaretransgender-rightschild-carepublic-healthmedical-training
✓ Decided: Committee on Health approves three local law introductions

The Committee on Health voted to approve three introductions of local laws. The measures address signage about patient rights for transgender individuals (Int 0628-2024-A), reporting on hospital training for transgender medical care (Int 0629-2024-A), and requirements for cooling centers (Int 0998-2024-A). The votes were recorded by roll call.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
Int 0628-2024 — Approved by Committee
6 yea · 2 nay · 1 absent
Lynn C. Schulman yea · Joann Ariola nay · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro yea · Kristy Marmorato nay · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang absent
Int 1056-2024 — Approved by Committee
6 yea · 2 nay · 1 absent
Lynn C. Schulman yea · Joann Ariola nay · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro yea · Kristy Marmorato nay · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang absent
The other 5 items passed by unanimous or near-unanimous consent.
Thu Aug 14, 2025 · 1:45 PM

City Council Stated Meeting

Mayor vetoes Introductory Number 47‑B targeting vendor penalties

The City Council will receive and record the Mayor's veto communications on Introductory Numbers 47‑B, 1133‑A, and 1135‑A, all relating to vendor and delivery worker regulations. Council members will review several land‑use call‑ups, including zoning actions for 515 7th Avenue in Manhattan and the JFK Conduit Logistics Center in Queens. The Council will also consider zoning approvals for the 47 Hall Street rezoning in Brooklyn and a resolution approving the City Planning Commission's decision on ULURP No. C 240275 ZMK. Standard procedural items such as roll call, invocation, and adoption of minutes are also on the agenda.

mayor-vetozoningland-usehousingvendor-regulationdelivery-workers
✓ Decided: Council approves land‑use call‑ups, housing eligibility intro, and funding resolution

The Council adopted a consent agenda that approved several land‑use call‑ups, including reviews of City Planning Commission actions on multiple applications. It also approved Introduction 1100‑A, which amends the administrative code to expand supportive housing eligibility, by consent. A vote of 37‑7 approved Resolution 1013‑2025, designating and changing funding designations for certain organizations in the expense budget. The Council approved the LU 0342‑2025 land‑use application, granting a property‑tax exemption for numerous parcels, by consent.

Council Chambers - City Hall
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Res 1013-2025 — Approved, by Council
37 yea · 7 nay · 6 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse absent · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won absent · Susan Zhuang yea
Int 0628-2024 — Approved by Council
37 yea · 7 nay · 6 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse absent · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won absent · Susan Zhuang yea
Int 0629-2024 — Approved by Council
43 yea · 6 absent · 1 nay · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse absent · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won absent · Susan Zhuang yea
Int 1056-2024 — Approved by Council
37 yea · 7 nay · 6 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy absent · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse absent · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won absent · Susan Zhuang yea
The other 39 items passed by unanimous or near-unanimous consent.
Thu Aug 14, 2025 · 11:30 AM

Committee on Technology

Council considers new 311 category for rooftop activity complaints

The Committee on Technology is meeting to discuss Int 0422-2024. This proposed local law would require the commissioner of information technology and telecommunications to create a specific 311 category for rooftop activity complaints.

311rooftopsreportingcity-services
✓ Decided: Committee on Technology approves rooftop complaints law introduction

The Committee on Technology voted to approve Introduction Int 0422-2024-A, a local law amendment that would require the commissioner of information technology and telecommunications to create a separate 311 category for rooftop activity complaints and require the commissioner of buildings to issue an annual report on certain rooftop spaces. The motion passed with three affirmative votes (Bottcher, Holden, Paladino) and two members absent (Gutiérrez, Won). The approval moves the proposal forward for further council action.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0422-2024 — Approved by Committee
3 yea · 2 absent
Jennifer Gutiérrez absent · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino yea · Julie Won absent
Thu Aug 14, 2025 · Deferred

Committee on Women and Gender Equity

Council committee to consider a local law banning unsafe menstrual products

The Committee on Women and Gender Equity will consider Introduction 867‑A, a proposed local law that would amend the city’s administrative code to prohibit the sale of menstrual and intimate care products containing unsafe ingredients. The committee will discuss the amendment’s language and next steps for adoption.

gender-equityhealthconsumer-protectionlegislation
Council Chambers - City Hall VOTE*
Thu Aug 14, 2025 · 11:00 AM

Committee on Finance

Council Finance Committee to vote on funding designations and property parcels

The Committee on Finance will consider Resolution T2025-3925, which would approve new designations and changes for certain organizations to receive funding in the expense budget. It will also preconsider item T2025-3966 (TSM GF1), a list of specific lots and blocks in Manhattan Community District 12 and the Bronx Community Districts 4, 6, 7, 8, and 9. The agenda includes a catch‑all item for any other business as may be necessary.

financebudgetfundingland-usepropertycity-council
✓ Decided: Finance Committee approves funding resolution and land‑use application

The Committee on Finance approved Resolution 1013‑2025, which designates certain organizations to receive funding in the expense budget, with a vote of 14‑1. It also approved a land‑use application (Resolution 1028) covering multiple Manhattan and Bronx parcels, with a vote of 15‑0. Both items were adopted as P‑C items by roll call.

Council Chambers - City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 1013-2025 — P-C Item Approved by Comm
14 yea · 1 nay · 1 medical · 1 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
The other 1 item passed by unanimous or near-unanimous consent.
Wed Aug 13, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee to consider Whitney Museum landmark designation

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider designating the (Former) Whitney Museum of American Art at 945 Madison Avenue as a historic landmark. The committee will also review applications from the Department of Housing Preservation and Development regarding a UDAAP and tax exemption for properties at 984 and 988 Lincoln Avenue in Brooklyn.

landmarkswhitney-museumzoninghousingudaaptax-exemption
✓ Decided: Subcommittee heard landmark and housing applications but made no decisions

The Subcommittee on Landmarks, Public Sitings and Dispositions met on August 13, 2025. It held hearings on two applications to designate the former Whitney Museum of American Art as a historic landmark (LU 0343-2025) and as an interior landmark (LU 0344-2025). It also considered two housing‑preservation applications from the Department of Housing Preservation and Development (LU 0345-2025 and LU 0346-2025). No approvals, denials, or vote tallies were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor
Tue Aug 12, 2025 · Deferred

Subcommittee on Zoning and Franchises

Subcommittee meeting agenda lists no specific items

The Subcommittee on Zoning and Franchises will meet on August 12, 2025 at 11:00 AM in Committee Room 250 Broadway, 16th Floor. The agenda provided contains only the meeting details and does not list any rezoning proposals, contracts, ordinances, fee changes, or public hearings. Consequently, no specific decisions or discussions are documented for this session.

zoningfranchisescity-council
250 Broadway - Committee Room, 16th Floor
Wed Aug 6, 2025 · 11:30 AM

Committee on Land Use

Lenox Hill Hospital seeks special permit to expand and modify zoning rules

The Committee on Land Use will consider a series of zoning map amendment and rezoning applications submitted by the NYC Department of City Planning and private developers. Proposals include creating new special districts, changing existing district designations, and establishing mandatory inclusionary housing areas across Manhattan, Brooklyn, and Queens. The committee will also review a special permit for Lenox Hill Hospital to increase floor area and adjust height and lot‑coverage regulations for its campus at 100 East 77th Street.

zoningrezoningspecial-districtsinclusionary-housinghospitalmidtownbrooklynmanhattan
✓ Decided: Midtown South Mixed-Use Plan approved with modifications, sent to CPC

The Committee on Land Use approved six land‑use applications, all with unanimous 10‑0 votes. Each was approved with modifications and referred to the City Planning Commission, except two that received Companion Resolutions. No decision was recorded for the 236 Gold Street rezoning application.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
LU 0324-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0325-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0331-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0332-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0333-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0334-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0335-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0336-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0337-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0338-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0339-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0340-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0341-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Wed Aug 6, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee considers Midtown South Mixed-Use Plan and multiple rezoning requests

The Subcommittee on Zoning and Franchises is reviewing several land-use applications, including a comprehensive mixed-use plan for Midtown South. The body will discuss zoning map amendments and the establishment of Mandatory Inclusionary Housing areas across Manhattan, Brooklyn, and Queens.

zoningland-usehousingmanhattanbrooklynqueens
✓ Decided: Subcommittee unanimously approved Midtown South Mixed‑Use zoning plan with modifications

The Zoning and Franchises Subcommittee approved several land‑use applications with modifications and sent them to the City Planning Commission. Each approval was passed unanimously (7‑0). The applications include Midtown South Mixed‑Use plans, 47 Hall Street rezoning, and 347 Flushing Avenue rezoning.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
LU 0324-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0325-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0331-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0332-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0333-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0334-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0335-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0336-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0337-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0338-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0339-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0340-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0341-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Mon Jul 28, 2025 · 10:00 AM

Committee on Criminal Justice

Local law to require a medical clinic for court‑transported detainees

The Committee on Criminal Justice will hold oversight of the Department of Probation's organizational strategy. It will consider a local law amendment that requires the Department of Correction and Correctional Health Services to establish a medical clinic for persons transported to a court facility. The committee will also discuss several resolutions urging the state legislature to pass bills on gender‑identity treatment, prison safety transparency, and the SUPPORT Act for defendants with mental disease.

criminal-justicecorrectionshealthgender-identitymental-healthoversight
✓ Decided: Criminal Justice Committee held hearings, no resolutions approved

The Committee on Criminal Justice held a hearing on Oversight T2025-3645 concerning the Department of Probation's organizational strategy. It also heard the introduction Int 0098-2024 to amend the administrative code for a correctional health clinic. Three resolutions—Res 0272-2024, Res 0734-2025, and Res 0872-2025—were heard and laid over, but no votes or approvals were recorded.

Council Chambers - City Hall
Thu Jul 24, 2025 · Deferred

Subcommittee on Zoning and Franchises

Subcommittee on Zoning and Franchises meeting scheduled for July 24, 2025

The Subcommittee on Zoning and Franchises will meet on July 24, 2025. The provided agenda contains only procedural information and does not list specific items for decision or discussion.

zoningfranchisesprocedural
250 Broadway - Committee Room, 16th Floor
Wed Jul 16, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Lenox Hill Hospital seeks zoning changes for expansion at 100 East 77th St

The Subcommittee on Zoning and Franchises will consider three applications submitted by Lenox Hill Hospital. One seeks to amend the Zoning Map, changing the district from R8B to C1-8 and from C1-8X to C1-9 in Manhattan Community District 8, Council District 4. Another proposes an amendment to the Zoning Resolution to create a Mandatory Inclusionary Housing area in the same district. The third requests a special permit to increase floor‑area ratio, height, setbacks and lot‑coverage for a hospital enlargement at 100 East 77th Street.

zoninghospitalinclusionary-housingspecial-permitmanhattan
✓ Decided: No substantive zoning decisions were made by the subcommittee

The subcommittee heard three Lenox Hill Hospital land‑use applications (LU 0339‑2025, LU 0340‑2025, LU 0341‑2025) and laid each over for further consideration. No approvals, denials, or votes were recorded.

Council Chambers - City Hall
Mon Jul 14, 2025 · 12:30 PM

Committee on Criminal Justice

Local law to change procedures after a death in NYC Department of Correction custody

The Committee on Criminal Justice will consider a proposed local law, Int. No. 423‑A. The bill would amend the New York City charter and administrative code concerning procedures following the death of an individual in the Department of Correction's custody. The committee will discuss the language and implications of the amendment.

criminal-justicecorrectionspolicylegislation
✓ Decided: Criminal Justice Committee approves local law on custody death procedures

The Committee on Criminal Justice approved Introduction 0423-2024-A, a local law amending the city charter and administrative code regarding procedures after a death in Department of Correction custody. The motion passed with six affirmative votes; two members were absent and one voted medically. No other actions were taken.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0423-2024 — Approved by Committee
6 yea · 2 absent · 1 medical
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala absent · Tiffany L. Cabán yea · Shahana K. Hanif medical · Christopher Marte absent · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Mon Jul 14, 2025 · 12:00 PM

Committee on Economic Development

Council proposes new law requiring community impact reports for city‑subsidized projects.

The Committee on Economic Development will consider three proposed local laws. The first would amend the administrative code to require posting of community impact reports for city‑subsidized economic development projects. The second and third would amend the code to conduct a feasibility study on temporarily using vacant New York city housing authority commercial space for resident‑owned businesses, with the third adding grant funding to that study.

economic-developmenthousingcommunity-impactgrantsfeasibility-study
✓ Decided: Committee approves three local law introductions on economic development

The Economic Development Committee approved three introductions that amend the city’s administrative code. The measures address posting of community impact reports, a feasibility study for temporary use of vacant public‑housing commercial space, and inclusion of grants in that study. Each was approved with four affirmative votes, two members absent, and one member on medical leave. The approvals were recorded under enactment numbers 2025/104, 2025/111, and 2025/112.

Committee Room - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0164-2024 — Approved by Committee
4 yea · 2 absent · 1 medical
Amanda C. Farías yea · Alexa Avilés absent · Erik D. Bottcher absent · Jennifer Gutiérrez yea · Kevin C. Riley medical · Rafael Salamanca, Jr. yea · Inna Vernikov yea
Int 0810-2024 — Approved by Committee
4 yea · 2 absent · 1 medical
Amanda C. Farías yea · Alexa Avilés absent · Erik D. Bottcher absent · Jennifer Gutiérrez yea · Kevin C. Riley medical · Rafael Salamanca, Jr. yea · Inna Vernikov yea
Int 0844-2024 — Approved by Committee
4 yea · 2 absent · 1 medical
Amanda C. Farías yea · Alexa Avilés absent · Erik D. Bottcher absent · Jennifer Gutiérrez yea · Kevin C. Riley medical · Rafael Salamanca, Jr. yea · Inna Vernikov yea
Mon Jul 14, 2025 · Deferred

Committee on Fire and Emergency Management

Council committee will consider a local law to create a residential fire emergency guide

The Committee on Fire and Emergency Management will review Int. No. 751-A, a proposed local law to amend the city’s administrative code. The amendment would establish a residential fire emergency response guide. The council will vote on whether to adopt the legislation.

fire-emergencylocal-lawpublic-safety
Council Chambers - City Hall VOTE*
Mon Jul 14, 2025 · 11:30 AM

Committee on Parks and Recreation

Council to adopt Local Law naming 128 streets and public places citywide

The Parks and Recreation Committee will consider Local Law T2025-3884, which proposes naming 128 streets, avenues, and public places throughout New York City's five boroughs. The agenda also includes proposed repeals of numerous sections of Local Laws 10, 81, 54, and 41. No other matters are listed for this meeting.

street-naminglocal-lawparks-recreationboroughslegislation
✓ Decided: Committee approves naming of 128 streets and repeal of multiple local law sections

The Parks and Recreation Committee approved Introduction No. 1338-2025, a local law to name 128 thoroughfares and public places across the boroughs. The same measure also repeals numerous sections of existing local laws. The motion passed with six affirmative votes and two members absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1338-2025 — P-C Item Approved by Comm
6 yea · 2 absent
Shekar Krishnan yea · David M. Carr absent · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung absent
Mon Jul 14, 2025 · 11:30 AM

Committee on Governmental Operations, State & Federal Legislation

Council committee to consider waiving six city reporting requirements

The Committee on Governmental Operations, State & Federal Legislation will consider Local Law Int 1317‑2025, which proposes amendments to the New York City charter and administrative code to repeal several reporting requirements, including sections 19‑180, 19‑183(c), 19‑184, 24‑163.3(g), and 25‑208. The committee will also consider Resolution 0933‑2025, which approves the Report and Advisory Board Review Commission’s recommendation to grant waivers or partial waivers for six of those reporting requirements, as communicated to the City Council on December 23, 2024. No other agenda items are listed.

city-charterreporting-requirementstrafficenvironmentgovernment
✓ Decided: Committee approved Local Law Int. 1317‑A to amend charter and repeal reporting rules

The Committee on Governmental Operations, State & Federal Legislation approved Introduction No. 1317‑A, a Local Law amending the city charter and repealing several reporting requirements. The committee also approved Resolution 0933‑2025, endorsing the Report and Advisory Board Review Commission’s recommendation to waive or partially waive six reporting requirements. Both actions were approved by a 7‑0 vote, with one member absent and one on medical leave.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1317-2025 — Approved by Committee
7 yea · 1 absent · 1 medical
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr absent · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino yea · Lynn C. Schulman yea · Inna Vernikov yea
Res 0933-2025 — Approved by Committee
7 yea · 1 absent · 1 medical
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr absent · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino yea · Lynn C. Schulman yea · Inna Vernikov yea
Mon Jul 14, 2025 · 11:00 AM

Committee on Children and Youth

Committee will consider four proposed foster‑care related local laws

The New York City Council Committee on Children and Youth will discuss four proposed local laws. Two bills address provision of luggage and data collection for youth in foster care. A third bill creates a program to support current and former foster‑care youth. The fourth bill requires basic behavioral‑support training for certain staff at juvenile detention facilities.

foster-careyouthjuvenile-detentionlocal-lawcity-council
✓ Decided: Committee approved four local laws supporting foster youth and juvenile staff

The Committee on Children and Youth voted to approve four Local Laws: one providing luggage to youth in foster care, one requiring additional reporting on foster care youth, one establishing a support program for current and former foster youth, and one mandating basic behavioral‑support training for certain juvenile detention staff. Each measure passed with five affirmative votes and one medical vote.

Council Chambers - City Hall VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 1077-2024 — Approved by Committee
5 yea · 1 medical
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé medical · Nantasha M. Williams yea
Int 1245-2025 — Approved by Committee
5 yea · 1 medical
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé medical · Nantasha M. Williams yea
Int 1246-2025 — Approved by Committee
5 yea · 1 medical
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé medical · Nantasha M. Williams yea
Int 1259-2025 — Approved by Committee
5 yea · 1 medical
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé medical · Nantasha M. Williams yea
Mon Jul 14, 2025 · 10:30 AM

Committee on Finance

Committee on Finance to consider 1508 Amsterdam Avenue

The Committee on Finance is meeting to discuss a matter regarding 1508 Amsterdam Avenue. This is the only item listed on the agenda.

financemanhattanland-use
✓ Decided: Committee on Finance approves LU 0328-2025 land use application

The Committee on Finance voted to approve Land Use Application LU 0328-2025 for 1508 Amsterdam Avenue as a P‑C item with a companion resolution. The motion passed with 11 affirmative votes; 4 members were absent and 2 were on medical leave. No other actions were taken during the meeting.

Council Chambers - City Hall
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0328-2025 — P-C Item Approved by Committee with Companion Resolution
11 yea · 4 absent · 2 medical
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya medical · Chi A. Ossé medical · Keith Powers absent · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Mon Jul 14, 2025 · 9:00 AM

Committee on Aging

Committee to consider study on agency services for older adults with health conditions

The Committee on Aging is meeting to discuss Proposed Int. No. 1257-A. This legislation relates to a study and report regarding agency services for older adults with specific neurological and mental health conditions.

aginghealthcaremental-healthcity-services
✓ Decided: Committee on Aging approves Local Law study on services for older adults

The Committee on Aging voted to approve Introduction 1257-2025-A, a local law proposing a study and report on agency services for older adults with certain neurological and mental health conditions. The motion passed with six affirmative votes and one medical vote. The approval was recorded by roll call.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1257-2025 — Approved by Committee
6 yea · 1 medical
Crystal Hudson yea · Chris Banks yea · Linda Lee yea · Darlene Mealy medical · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Mon Jul 14, 2025 · 3:00 PM

City Council Stated Meeting

Council will approve a property tax exemption for a Manhattan parcel (Block 1988, Lot 33)

The City Council will consider a resolution approving an exemption from real‑property taxes for a Manhattan property at Block 1988, Lot 33. It will also review a land‑use call‑up directing Council review of the Lenox Hill Hospital application (C 250153 ZSM) and related applications. Additionally, the Council will consider several local law proposals covering foster‑care services, delivery‑worker gratuities, and procedures after a death in custody.

property-taxland-usefoster-caredelivery-workerscriminal-justicezoning
✓ Decided: Council adopts land‑use review of Lenox Hill Hospital application

The City Council voted to adopt a resolution placing the City Planning Commission’s action on Lenox Hill Hospital (Application No. C‑250153 ZSM) under Council review. Several local law introductions covering aging services, foster‑care youth, juvenile‑detention staff training, and delivery‑worker protections were approved, most by consent and two by roll‑call vote. The resolutions were referred to the Committee on Land Use and the appropriate subcommittees.

Council Chambers - City Hall
🗳️ How they voted — 12 divided votes
Named votes as recorded in the official record.
Int 0737-2024 — Approved by Council
37 yea · 6 absent · 5 nay · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0738-2024 — Approved by Council
37 yea · 6 absent · 5 nay · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1133-2024 — Approved by Council
35 yea · 6 absent · 6 nay · 3 medical · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1135-2024 — Approved by Council
36 yea · 6 absent · 5 nay · 3 medical · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0423-2024 — Approved by Council
38 yea · 6 absent · 4 nay · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0321-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
Res 0993-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
LU 0322-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
Res 0994-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
LU 0323-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
Res 0995-2025 — Disapproved by Council
28 yea · 9 nay · 6 absent · 5 abstain · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers nay · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz nay · Amanda C. Farías nay · Simcha Felder yea · Oswald J. Feliz nay · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis abstain · Kristy Marmorato yea · Christopher Marte absent · Darlene Mealy nay · Julie Menin abstain · Frank Morano yea · Francisco P. Moya medical · Mercedes Narcisse abstain · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens nay · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams nay · Julie Won abstain · Susan Zhuang yea
Int 1020-2024 — Approved by Council
35 yea · 7 nay · 6 absent · 3 medical
Adrienne E. Adams yea · Diana I. Ayala absent · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro medical · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte absent · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya medical · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers absent · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung absent · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 50 items passed by unanimous or near-unanimous consent.
Mon Jul 14, 2025 · 1:30 PM

Committee on Housing and Buildings

Council considers new tenant relocation and emergency displacement laws

The Committee on Housing and Buildings will consider three proposed local laws and two resolutions. The local laws address tenant relocation services, agency responsibility for emergency displacement, and documentation requirements for demolition permits. The resolutions urge the state legislature and governor to limit rent‑insurance collection periods and to protect tenants displaced by fire.

housingtenant-relocationemergency-displacementdemolitionrent-insurancelegislation
✓ Decided: Committee approves three housing bills and two tenant‑protection resolutions

The Committee on Housing and Buildings voted unanimously (7‑0) to approve three introductions—Int 0607-2024-A, Int 0749-2024-A, and Int 0750-2024-A—and two resolutions—Res 0307-2024 and Res 0802-2025. All approvals were recorded as roll‑call votes by the seven committee members. The measures address tenant relocation services, emergency displacement assistance, demolition documentation, landlord insurance collection limits, and fire‑displacement protections.

Council Chambers - City Hall VOTE*
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0607-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0749-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0750-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0307-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0802-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Mon Jul 14, 2025 · Deferred

Committee on Women and Gender Equity

Local law to allow correction of sex designations on death records

The Committee on Women and Gender Equity will consider Int. No. 1258-A, a proposed local law to amend the New York City Administrative Code. The amendment would address how sex designations on death records can be corrected. The committee will discuss and vote on this proposal at the July 14, 2025 meeting.

gender-equitylocal-lawdeath-recordsadministrative-code
Council Chambers - City Hall VOTE*
Mon Jul 14, 2025 · 1:15 PM

Committee on Land Use

Council to consider Bally's Ferry Point zoning map amendment in the Bronx

The Committee on Land Use will vote on three motions to disapprove Bally's Ferry Point map amendments submitted by Bally's New York Operating Company. It will also review revocable consent applications for sidewalk cafés at 25 East 83rd Street and 1556 White Plains Road. A historic landmark designation for the Modulightor Building at 246 East 58th Street will be considered, along with a pre‑considered amendment for the Union Avenue Cluster project.

zoningparkslandmarksrestaurantsdevelopment
✓ Decided: Committee approved several land use applications, including a sidewalk café and landmark

The committee defeated three Bally's Ferry Point map amendment applications (LU 0321‑2025, LU 0322‑2025, LU 0323‑2025) by a 5‑4 vote. It approved the Mykonian House sidewalk café (LU 0326‑2025) unanimously. It approved the Ajo & Oregano Restaurant sidewalk café (LU 0327‑2025) with modifications, also unanimously. It approved the Modulightor Building historic landmark designation (LU 0329‑2025) and the Union Avenue Cluster amendment (LU 0330‑2025) each with a 9‑0 vote.

Committee Room - City Hall
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
LU 0321-2025 — Defeated by Committee
5 yea · 4 nay · 1 medical
Rafael Salamanca, Jr. nay · Shaun Abreu yea · Selvena N. Brooks-Powers nay · Amanda C. Farías nay · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley nay · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0322-2025 — Defeated by Committee
5 yea · 4 nay · 1 medical
Rafael Salamanca, Jr. nay · Shaun Abreu yea · Selvena N. Brooks-Powers nay · Amanda C. Farías nay · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley nay · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0323-2025 — Defeated by Committee
5 yea · 4 nay · 1 medical
Rafael Salamanca, Jr. nay · Shaun Abreu yea · Selvena N. Brooks-Powers nay · Amanda C. Farías nay · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley nay · Carlina Rivera yea · Pierina Ana Sanchez yea
The other 4 items passed by unanimous or near-unanimous consent.
Mon Jul 14, 2025 · 1:00 PM

Subcommittee on Zoning and Franchises

Subcommittee reviews Bally's Ferry Point map amendments and sidewalk café consents

The Subcommittee on Zoning and Franchises will consider three applications regarding the Bally's Ferry Point project in the Bronx. The body will also review two requests for revocable consents to operate sidewalk cafés in Manhattan and the Bronx.

zoningland-usebronxmanhattansidewalk-cafes
✓ Decided: Subcommittee disapproved three Bally’s Ferry Point map amendment applications

The Zoning and Franchises Subcommittee voted to disapprove three separate Bally’s Ferry Point map amendment applications (LU 0321‑2025, LU 0322‑2025, and LU 0323‑2025). Each motion received four affirmative votes (Abreu, Hanks, Salaam, Schulman) and one negative vote (Chair Riley), with Councilmember Carr absent and Moya recorded as medical. The subcommittee approved a sidewalk‑café consent for Mykonian House at 25 East 83rd Street with a unanimous five‑to‑zero vote (Riley, Abreu, Hanks, Salaam, Schulman). It also approved, with modifications, a sidewalk‑café consent for Ajo & Oregano Restaurant on White Plains Road, again by a five‑to‑zero vote.

Committee Room - City Hall
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
LU 0321-2025 — Disapproved by Subcommittee
4 yea · 1 nay · 1 absent · 1 medical
Kevin C. Riley nay · Shaun Abreu yea · David M. Carr absent · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0322-2025 — Disapproved by Subcommittee
4 yea · 1 nay · 1 absent · 1 medical
Kevin C. Riley nay · Shaun Abreu yea · David M. Carr absent · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0323-2025 — Disapproved by Subcommittee
4 yea · 1 nay · 1 absent · 1 medical
Kevin C. Riley nay · Shaun Abreu yea · David M. Carr absent · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
The other 2 items passed by unanimous or near-unanimous consent.
Mon Jul 14, 2025 · 12:30 PM

Committee on Oversight and Investigations

Committee to review police investigation reporting and 9/11 toxin knowledge

The Committee on Oversight and Investigations will discuss a local law regarding police department investigation reporting. The body will also consider a resolution directing the Department of Investigation to report on mayoral knowledge of environmental toxins from the September 11 attacks.

policeoversightpublic-healthcity-charterinvestigations
✓ Decided: Committee approves police reporting law amendment and 9/11 toxin investigation

The Committee on Oversight and Investigations approved Introduction Int 1020-2024-A, a local law amendment to the city charter on reporting police investigations, by a 6‑2 vote. The committee also approved Resolution 0560-2024-A directing the Department of Investigation to examine mayoral knowledge of environmental toxins from the September 11, 2001 attacks and to report to the Council, also by a 6‑2 vote. Both motions were approved by roll call.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1020-2024 — Approved by Committee
6 yea · 2 absent
Gale A. Brewer yea · Diana I. Ayala absent · Chris Banks yea · Rita C. Joseph yea · Shekar Krishnan yea · Lincoln Restler yea · Nantasha M. Williams yea · Julie Won absent
Res 0560-2024 — Approved by Committee
6 yea · 2 absent
Gale A. Brewer yea · Diana I. Ayala absent · Chris Banks yea · Rita C. Joseph yea · Shekar Krishnan yea · Lincoln Restler yea · Nantasha M. Williams yea · Julie Won absent
Mon Jul 14, 2025 · 10:30 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council to consider historic landmark designation for 246 East 58th St

The Subcommittee on Landmarks, Public Sitings and Dispositions will preconsider two applications. One seeks to designate the Modulightor Building Apartment Duplex at 246 East 58th Street in Manhattan as a historic landmark (DL-544/LP-2684). The other proposes an amendment to the Project Summary for the Union Avenue Cluster Urban Development Action Area covering properties at 993 Union Avenue, 995 Union Avenue, 774 Union Avenue, and 1042 Longfellow Avenue in the Bronx.

landmarkshistoric-preservationurban-developmenthousingbronxmanhattan
✓ Decided: Subcommittee approves two landmark and housing amendment applications

The Subcommittee on Landmarks, Public Sitings and Dispositions voted to approve the designation of the Modulightor Building Apartment Duplex as a historic landmark. It also approved the Union Avenue Cluster amendment for the listed Bronx properties. Both motions passed with six votes in favor and one member absent.

Committee Room - City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0329-2025 — P-C Item Approved by Subcommittee with Companion Resolution
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0330-2025 — P-C Item Approved by Subcommittee with Companion Resolution
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
Mon Jul 14, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee will consider five proposed local laws affecting delivery workers' pay

The Committee on Consumer and Worker Protection will consider five proposed local laws that would amend the New York City administrative code. The measures address gratuity standards, required gratuity options, pay calculation transparency, worker protections, and minimum payments for food and grocery delivery workers. All items are listed as proposed items (Int. No. 737‑A, 738‑A, 859‑A, 1133‑A, 1135‑A).

deliverylaborpayconsumer-protectioncity-legislation
✓ Decided: Committee approved five consumer and worker protection introductions

The Committee on Consumer and Worker Protection approved five introductions: 0737-2024, 0738-2024, 0859-2024, 1133-2024, and 1135-2024. Each approval recorded affirmative votes from Chair Julie Menin, Shaun Abreu, Gale A. Brewer, Amanda Farias, Shekar Krishnan, and Julie Won, with a medical vote from Chi A. Ossé. No other actions were taken during the meeting.

Council Chambers - City Hall VOTE*
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0737-2024 — Approved by Committee
6 yea · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé medical · Julie Won yea
Int 0738-2024 — Approved by Committee
6 yea · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé medical · Julie Won yea
Int 0859-2024 — Approved by Committee
6 yea · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé medical · Julie Won yea
Int 1133-2024 — Approved by Committee
6 yea · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé medical · Julie Won yea
Int 1135-2024 — Approved by Committee
6 yea · 1 medical
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé medical · Julie Won yea
Mon Jul 14, 2025 · 9:30 AM

Committee on Environmental Protection, Resiliency and Waterfronts

City adopts NY State Climate Smart Communities pledge

The Committee on Environmental Protection, Resiliency and Waterfronts will consider Resolution 0926-2025, which declares that New York City adopts the New York State Climate Smart Communities pledge to reduce greenhouse gas emissions and adapt to a changing climate. If adopted, the resolution formalizes the city's commitment to the pledge.

climateenvironmentresiliencepolicy
✓ Decided: Committee adopts Climate Smart Communities pledge

The Committee on Environmental Protection, Resiliency and Waterfronts approved Resolution 0926-2025, which adopts the New York State Climate Smart Communities pledge to reduce greenhouse‑gas emissions and adapt to climate change. The vote recorded five affirmative votes, three members absent, and one member recorded as medical. No other actions were taken.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0926-2025 — Approved by Committee
5 yea · 3 absent · 1 medical
James F. Gennaro medical · Alexa Avilés absent · Justin L. Brannan yea · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler absent · Rafael Salamanca, Jr. absent · Susan Zhuang yea
Wed Jul 9, 2025 · Deferred

Committee on Finance

Local Law to create property tax exemption for Cold War veterans

The Finance Committee will consider Int 0740-2024, a local law amendment to the city administrative code. The proposal would establish a real property tax exemption for Cold War veterans. The committee will discuss the language and implications of the amendment.

property-taxveteranslocal-law
Council Chambers - City Hall
Tue Jul 8, 2025 · 1:00 PM

Subcommittee on Zoning and Franchises

Council subcommittee will consider rezoning of 47 Hall Street in Brooklyn.

The Subcommittee on Zoning and Franchises will review applications for revocable consents to operate sidewalk cafés at 25 East 83rd Street in Manhattan and 1556 White Plains Road in the Bronx. It will also consider multiple rezoning proposals affecting properties in Brooklyn, the Bronx, and Queens, including changes to district designations and the creation of Special Mixed Use and Inclusionary Housing areas.

zoninghousingdevelopmentinclusionary-housingsidewalk-cafesbrooklyn
✓ Decided: Subcommittee held hearings and laid over several zoning and café applications

The Zoning and Franchises Subcommittee conducted hearings for two sidewalk‑café permits in Manhattan and the Bronx. It also processed multiple rezoning and inclusionary‑housing proposals in Brooklyn, hearing some items and laying others over for further review. No votes were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor
Tue Jul 8, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee will preconsider Union Avenue amendment and Modulightor landmark

The Subcommittee on Landmarks, Public Sitings and Dispositions will preconsider two applications. One is HPD’s amendment to the Union Avenue Cluster Project Summary for several Bronx properties, and the other is the Landmarks Preservation Commission’s request to designate the Modulightor Building Apartment Duplex at 246 East 58th Street as a historic landmark. Both items are listed as pre‑considered and will be discussed at the July 8 meeting.

landmarkshousingdevelopmentbronxmanhattan
✓ Decided: Subcommittee heard two land‑use applications but took no final action

The Subcommittee on Landmarks, Public Sitings and Dispositions held a hearing on the Union Avenue Cluster Amendment (LU 0330‑2025) submitted by the Department of Housing Preservation and Development. It also heard the application to designate the Modulightor Building Apartment Duplex (LU 0329‑2025) as a historic landmark. Both items were laid over by the committee, and no votes or final decisions were recorded.

250 Broadway - Committee Room, 16th Floor
Tue Jul 1, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will consider multiple zoning map amendments in Bronx and Manhattan

The Subcommittee on Zoning and Franchises will review five applications concerning zoning map amendments and property disposition. Three applications (LU 0321‑2025, LU 0322‑2025, LU 0323‑2025) relate to the Bally's Ferry Point project in the Bronx, including the creation of a C8‑4 district, the establishment of Ring Road and related land changes, and the disposition of Ferry Point Park property. Two applications (LU 0324‑2025 and LU 0325‑2025) involve the Midtown South Mixed‑Use Plan in Manhattan, proposing changes to several special districts, rezoning from M1‑6 to higher‑density districts, and establishing a Mandatory Inclusionary Housing area. The committee will vote on whether to approve these amendments.

zoningmap-amendmentbronxmanhattanmixed-useinclusionary-housingproperty-disposition
✓ Decided: Subcommittee heard three Bronx projects and postponed two Midtown plans

The Zoning and Franchises Subcommittee held hearings on three land‑use applications submitted by Bally's New York Operating Company for the Bronx. Two Midtown South mixed‑use plan applications were laid over by the subcommittee. No vote tallies were recorded in the minutes.

Council Chambers - City Hall
Mon Jun 30, 2025 · 1:30 PM

City Council Stated Meeting

Council to adopt FY 2026 city budget, capital program and related resolutions

The New York City Council will consider a series of budget‑related resolutions, including the FY 2026 expense, revenue, contract and capital budgets, and the FY 2026 Community Development Program. It will also vote on fund‑transfer and new‑revenue appropriations for FY 2025, and review several zoning applications in the Bronx and Manhattan. All items are pre‑considered and coupled on general orders.

budgetfinancecapitalcommunity-developmentzoningtaxesexpense-budget
✓ Decided: Council approved payments in lieu of taxes for Western Rail Yards housing infrastructure

The City Council adopted Resolution 0960-2025, authorizing payments in lieu of taxes to fund infrastructure over the Western Rail Yards to support housing development. It also approved several other resolutions and local law introductions, including changes to funding designations, property tax calculations, and safety and vendor regulations. All items were adopted by consent or recorded vote.

Council Chambers - City Hall BUDGET ADOPTION
🗳️ How they voted — 7 divided votes
Named votes as recorded in the official record.
Int 0047-2024 — Approved by Council
40 yea · 8 nay · 3 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Frank Morano nay · Francisco P. Moya abstain · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung abstain · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 0961-2025 — Approved, by Council
41 yea · 9 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya nay · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 0962-2025 — Approved, by Council
41 yea · 9 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano yea · Francisco P. Moya nay · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
M 0154-2025 — Approved, by Council
41 yea · 9 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 0978-2025 — Approved, by Council
41 yea · 9 nay · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder nay · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Frank Morano nay · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
LU 0297-2025 — Approved, by Council
36 yea · 10 nay · 5 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés nay · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez abstain · Shahana K. Hanif nay · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph nay · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy nay · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse nay · Chi A. Ossé nay · Vickie Paladino yea · Keith Powers yea · Lincoln Restler abstain · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez nay · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won nay · Susan Zhuang abstain
Res 0981-2025 — Approved, by Council
36 yea · 10 nay · 5 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés nay · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez abstain · Shahana K. Hanif nay · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph nay · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy nay · Julie Menin yea · Frank Morano yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse nay · Chi A. Ossé nay · Vickie Paladino yea · Keith Powers yea · Lincoln Restler abstain · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez nay · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won nay · Susan Zhuang abstain
The other 49 items passed by unanimous or near-unanimous consent.
Mon Jun 30, 2025 · 12:30 PM

Committee on Finance

Committee on Finance to adopt Fiscal Year 2026 budgets and tax rate

The Committee on Finance is meeting to adopt the Expense, Revenue, Contract, and Capital budgets for Fiscal Year 2026. The body will also consider fixing the real property tax rate for the upcoming fiscal year and approving the FY 2026 Community Development Program.

budgettaxeshousingfinanceinfrastructure
✓ Decided: Committee on Finance approves FY2025‑26 city budget and related resolutions

On June 30, 2025 the New York City Council Committee on Finance voted to approve a series of budget‑related resolutions. The committee adopted the FY2025‑26 expense, revenue, and capital budgets, approved property‑tax calculation resolutions, and authorized fund transfers and a $435.2 million revenue appropriation. All motions passed with either unanimous or near‑unanimous votes.

Council Chambers - City Hall BUDGET ADOPTION
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Res 0961-2025 — P-C Item Approved by Comm
15 yea · 2 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks nay · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Res 0962-2025 — P-C Item Approved by Comm
15 yea · 2 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks nay · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
M 0154-2025 — P-C Item Approved by Comm
15 yea · 2 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks nay · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
Res 0978-2025 — P-C Item Approved by Comm
15 yea · 2 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks nay · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won yea
The other 27 items passed by unanimous or near-unanimous consent.
Mon Jun 30, 2025 · 11:30 AM

Committee on Parks and Recreation

Council to consider a law expanding access to school playgrounds.

The Committee on Parks and Recreation will consider two proposed local laws. The first would amend the city’s administrative code to require an annual report aimed at expanding access to school playgrounds. The second would amend the code to require posting information about indoor basketball court usage and to commission a study on improving access to indoor basketball courts.

parksrecreationschool-playgroundsindoor-basketballlocal-law
✓ Decided: Committee approves two local law introductions for playgrounds and basketball courts

The Parks and Recreation Committee approved Introduction 0566-2024-B, which amends the city code to expand access to school playgrounds. The Committee also approved Introduction 0643-2024-A, which amends the code to require posting information on indoor basketball court use and to study improving access. Both motions passed by roll call with all eight members voting affirmative.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0566-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Int 0643-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Mon Jun 30, 2025 · 11:30 AM

Committee on Consumer and Worker Protection

Committee reviews laws on delivery worker access and vendor penalties

The Committee on Consumer and Worker Protection is considering three local laws. These proposals address delivery device access, criminal penalties for vendors, and immigration service fraud outreach.

worker-protectionstreet-vendorsdelivery-workersconsumer-fraud
✓ Decided: Committee approves three introductions on delivery safety, vendor penalties, fraud outreach

The Committee on Consumer and Worker Protection approved three local law introductions. Int 0030-2024-B on safe delivery device access was approved by a 6‑1 vote. Int 0047-2024-B repealing misdemeanor penalties for vendors was approved by a 6‑1 vote. Int 0205-2024-A on outreach about immigration fraud schemes was approved by a 6‑1 vote.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0030-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Int 0047-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Int 0205-2024 — Approved by Committee
6 yea · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won absent
Mon Jun 30, 2025 · 11:00 AM

Committee on Housing and Buildings

Council to consider new safety rules for natural-gas detectors in buildings

The Committee on Housing and Buildings will consider two proposed local laws. The first would amend the administrative code and building code to set deadlines for installing natural-gas detectors and repeal section 908.10 of the building code. The second would amend the building code to require a solid color or artwork on temporary protective structures at construction sites. The meeting is scheduled for June 30, 2025 at 11:00 AM in the Council Chambers.

building-codesafetyconstructionhousinglocal-law
✓ Decided: Committee approves two local laws on gas detectors and site artwork

The Housing and Buildings Committee approved Introduction 1281-2025-A, a local law amending the administrative code and building code to set deadlines for installing natural gas detectors and repeal section 908.10. The committee also approved Introduction 1296-2025-A, a local law amending the building code to require a solid acceptable color or artwork on temporary protective structures at construction sites. Both motions passed unanimously with all seven members voting in favor.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1281-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 1296-2025 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Mon Jun 30, 2025 · 11:00 AM

Committee on Sanitation and Solid Waste Management

Local law amendment on removal of derelict vehicles

The Sanitation and Solid Waste Management Committee will consider a proposed local law amendment to the New York City Administrative Code. The amendment, identified as Int. No. 3-A, addresses the removal of derelict vehicles. The committee will discuss and vote on this proposal during the June 30, 2025 meeting.

sanitationsolid-wastelocal-lawvehiclescode-amendment
✓ Decided: Committee approves Local Law to amend code on removal of derelict vehicles

The Committee on Sanitation and Solid Waste Management voted to approve Introduction Int 0003-2024-A, a local law amending the city’s administrative code regarding removal of derelict vehicles. The motion passed by roll call with eight members voting affirmative. Members Gennaro and Salamanca Jr. were absent and Zhuang was recorded as medically absent.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0003-2024 — Approved by Committee
8 yea · 2 absent · 1 medical
Shaun Abreu yea · Chris Banks yea · David M. Carr yea · James F. Gennaro absent · Julie Menin yea · Sandy Nurse yea · Vickie Paladino yea · Rafael Salamanca, Jr. absent · Sandra Ung yea · Inna Vernikov yea · Susan Zhuang medical
Mon Jun 30, 2025 · 10:30 AM

Committee on Women and Gender Equity

Committee considers resolution for gender-affirming care funding

The Committee on Women and Gender Equity is meeting to discuss a resolution regarding healthcare accessibility. The body is considering a call for the New York State Legislature to provide funds for gender-affirming care services.

healthcarefundinggender-affirming-carestate-legislature
✓ Decided: Committee approves resolution urging state funding for gender‑affirming care

The Committee on Women and Gender Equity considered Resolution 0817‑2025, which calls on the New York State Legislature to provide necessary funds to keep hospital and health‑provider services for gender‑affirming care accessible in New York City. The committee voted to approve the resolution. All five members voted affirmative.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0817-2025 — Approved by Committee
5 yea
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov yea
Mon Jun 30, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Council will consider a bill to allow curbside overnight truck parking in industrial zones

The Committee on Transportation and Infrastructure will consider two proposed local laws. The first, Int. 0099-2024 (Int. No. 99‑B), would amend the city’s administrative code to create curbside overnight truck parking in industrial business zones and to provide for its repeal. The second, Int. 0857-2024 (Int. No. 857‑B), would amend the code regarding vehicles reported as abandoned to the Department of Sanitation. No other items are listed on the agenda.

transportationparkingsanitationzoninglocal-law
✓ Decided: Committee approves two local laws on truck parking and abandoned vehicles

The Transportation and Infrastructure Committee approved Introduction 0099-2024-B, creating curbside overnight truck parking in industrial zones, with an 8‑0 vote. The Committee also approved Introduction 0857-2024-B, amending the code on vehicles reported as abandoned to the Department of Sanitation, also by an 8‑0 vote.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0099-2024 — Approved by Committee
8 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera absent · Julie Won yea
Int 0857-2024 — Approved by Committee
8 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera absent · Julie Won yea
Mon Jun 30, 2025 · 9:30 AM

Committee on Immigration

Council will consider a local law requiring notices on immigration‑assistance ads

The Committee on Immigration will consider Int. No. 980-A, a local law amendment that would require a notice on advertisements for immigration assistance services and increase penalties for violations. The committee will also consider Resolution 0931-2025, which condemns the Trump Administration for disappearing immigrants to prisons in other countries.

immigrationlocal-lawpenaltiesresolutionhuman-rights
✓ Decided: Committee approves Local Law requiring notices on immigration assistance ads

The Committee on Immigration approved Introduction Int 0980-2024-A, a local law amending the city’s administrative code to require a notice on advertisements of immigration assistance services and to increase penalties for violations. The committee also approved Resolution 0931-2025 condemning the Trump Administration for sending immigrants to prisons abroad. Both motions passed by roll call with five members voting affirmative and two members absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0980-2024 — Approved by Committee
5 yea · 2 absent
Alexa Avilés yea · Erik D. Bottcher absent · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan absent
Res 0931-2025 — Approved by Committee
5 yea · 2 absent
Alexa Avilés yea · Erik D. Bottcher absent · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan absent
Mon Jun 30, 2025 · Deferred

Committee on Contracts

Committee considers three proposed local laws amending the city charter and code

The Committee on Contracts will consider three proposed local laws. Int 1247‑2025 would amend the city charter to allow a percentage of contract awards to be paid to nonprofit organizations immediately upon registration by the comptroller. Int 1248‑2025 would amend the charter to create an office of contract services. Int 1249‑2025 would amend the administrative code to require agency action plans for retroactive human services contract registration.

contractslocal-lawcharterhuman-servicesnonprofits
Committee Room - City Hall VOTE*
Fri Jun 27, 2025 · Deferred

Committee on Oversight and Investigations

Committee to examine corruption reporting in the Department of Investigation

The Committee on Oversight and Investigations will hold a meeting to discuss how the Department of Investigation encourages city employees to report corruption.

oversightcorruptioncity-employeesdepartment-of-investigation
Council Chambers - City Hall
Thu Jun 26, 2025 · Deferred

Committee on Children and Youth

Council will evaluate the DYCD crisis management system under oversight bill T2025-3598

The Committee on Children and Youth will conduct oversight of the crisis management system of the Department of Youth and Community Development (DYCD) as outlined in bill T2025-3598. It will also consider several local law amendments affecting foster care youth, including provisions for luggage, additional data collection, a support program for youth aging out of foster care, and required training for staff at juvenile detention facilities.

oversightfoster-carejuvenile-detentionyouth-serviceslegislation
Council Chambers - City Hall
Thu Jun 26, 2025 · 1:00 PM

Committee on Civil Service and Labor

Resolution to create a practical exam for painters in civil service testing

The Committee on Civil Service and Labor will hold an oversight hearing on the impact of automation on the New York City workforce. It will consider several local law proposals concerning permit approval timelines, a cloud‑first policy, an AI task force, and a centralized FOIL request system. The committee will also vote on a resolution directing the Department of Citywide Administrative Services to develop a qualifying practical exam for painters as part of civil service testing.

civil-servicelaborautomationtechnologypermitsaifoilpainters
✓ Decided: Committee held hearings on labor and tech bills, then postponed several introductions

The Civil Service and Labor Committee held a hearing on Oversight T2025-3692. It also heard introductions of four local laws (Int 0372‑2024, Int 0540‑2024, Int 1066‑2024, Int 1235‑2025) and a resolution (Res 0860‑2025). After the hearings, the committee laid over each of these items. No vote tallies were recorded.

Council Chambers - City Hall Jointly with the Committee on Technology.
Thu Jun 26, 2025 · 1:00 PM

Committee on Technology

Committee on Technology to review AI impacts and city permit tracking

The Committee on Technology will hold an oversight hearing on automation's impact on the NYC workforce. Members will also consider legislation regarding permit approval timelines, cloud-first policies, and AI's effect on civil service employees.

automationartificial-intelligencecivil-servicepermitstechnology-policyfoil
✓ Decided: Committee held hearings on multiple technology proposals

The Technology Committee held a hearing on Oversight T2025-3793 and introduced several local law items (Int 0372-2024, Int 0540-2024, Int 1066-2024, Int 1235-2025). It also held a hearing on Resolution 0860-2025 concerning a practical exam for painters. No votes or final approvals were recorded; the items were either heard or laid over for further action.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor
Thu Jun 26, 2025 · 11:30 AM

Committee on Land Use

Land Use Committee meeting agenda lists no specific items

The June 26, 2025 Land Use Committee agenda includes only the committee’s members, chair, date, time, and location. No rezoning proposals, contracts, ordinances, fee changes, or public hearings are listed for discussion or decision.

land-usecity-councilprocedural
✓ Decided: Committee approved seven land use applications with modifications, sending them to CPC.

The Land Use Committee considered seven applications ranging from zoning changes to special permits. Each application was approved with modifications and referred to the City Planning Commission, except one which was approved with a companion resolution. All votes were 8 in favor, with 1 member absent and 1 member noted for bereavement.

Committee Room - City Hall
🗳️ How they voted (14 roll-call votes)
Named votes as recorded in the official record.
LU 0294-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0295-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0296-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0297-2025 — Approved by Committee with Companion Resolution
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0298-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0299-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0300-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0301-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0302-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0313-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0314-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0315-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0316-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0320-2025 — P-C Item Approved by Committee with Companion Resolution
8 yea · 1 absent · 1 bereavement
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Kamillah Hanks bereavement · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Thu Jun 26, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee to review zoning map and special permit applications

The Subcommittee on Zoning and Franchises will consider several zoning map amendments and special permits, including a large-scale development at 109 Marcus Garvey Boulevard and a rezoning for North 7th Street.

zoningmap-amendmentspecial-permitdevelopmentmanhattanbrooklyn
✓ Decided: Subcommittee approved eight land‑use applications with modifications, referring them to CPC

The Zoning and Franchises Subcommittee voted to approve eight land‑use applications, each with modifications, and to refer them to the City Planning Commission. All six voting members voted affirmative, while one member was absent due to bereavement. The approvals cover projects in Manhattan and Brooklyn, including zoning map changes, inclusionary‑housing designations, and a special tower permit.

Committee Room - City Hall
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
LU 0294-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0295-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0296-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0297-2025 — Approved by Subcommittee
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0298-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0299-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0300-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0301-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0302-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 bereavement
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks bereavement · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Thu Jun 26, 2025 · 10:00 AM

Committee on Health

NYC Health Committee to consider coverage of blood pressure monitors for pregnant patients

The New York City Council Committee on Health will review a series of local laws and resolutions. Items include new training requirements for first responders, reporting on transgender health care training, and mandates for epinephrine devices in schools. The committee will also consider resolutions urging state action on Medicaid coverage for blood pressure monitors for pregnant and postpartum people and full telehealth reimbursement for community health centers.

healthtrainingtransgenderchild-careepinephrinetelehealthmedicaidpregnancy
✓ Decided: Committee held hearings and laid over multiple health‑related bill introductions

The New York City Council Committee on Health heard introductions for several local law proposals, including training for first responders on domestic‑violence brain injuries, signage for transgender patient rights, and a child‑care opioid‑antagonist program. Other introductions were laid over for future consideration. No votes, approvals, or denials were recorded during this meeting.

Council Chambers - City Hall
Thu Jun 26, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council subcommittee to consider zoning amendment for Carmen Villegas senior housing

The Subcommittee on Landmarks, Public Sitings and Dispositions will review five applications. Two applications (LU 0313-2025 and LU 0314-2025) propose amendments to the Zoning Resolution for the Carmen Villegas Apartments senior‑housing project in Manhattan Community District 11. Two other applications (LU 0315-2025 and LU 0316-2025) address the disposition and acquisition of a city‑owned property on East 110th Street. The committee will also consider a site‑selection proposal (T2025-3828) for a new 547‑ to 754‑seat primary/intermediate school in Halletts Point, Queens.

zoninghousingsenior-housingschoolland-usemanhattanqueens
✓ Decided: Subcommittee approved five land‑use applications, sending them to CPC

The Subcommittee on Landmarks, Public Sitings and Dispositions voted to approve five land‑use applications with modifications and refer them to the City Planning Commission. Four applications concern the Carmen Villegas Apartments senior‑housing project in Manhattan, and one concerns a new primary/intermediate school in Queens. The votes were five in favor, one absent, and one bereavement.

Committee Room - City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
LU 0313-2025 — Approved by Subcommittee with Modifications and Referred to CPC
5 yea · 1 bereavement · 1 absent
Kamillah Hanks bereavement · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0314-2025 — Approved by Subcommittee with Modifications and Referred to CPC
5 yea · 1 bereavement · 1 absent
Kamillah Hanks bereavement · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0315-2025 — Approved by Subcommittee with Modifications and Referred to CPC
5 yea · 1 bereavement · 1 absent
Kamillah Hanks bereavement · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0316-2025 — Approved by Subcommittee with Modifications and Referred to CPC
5 yea · 1 bereavement · 1 absent
Kamillah Hanks bereavement · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0320-2025 — P-C Item Approved by Subcommittee with Companion Resolution
5 yea · 1 bereavement · 1 absent
Kamillah Hanks bereavement · Justin L. Brannan absent · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
Wed Jun 25, 2025 · Deferred

Committee on Criminal Justice

Committee will consider oversight of probation and three state-level criminal-justice resolutions

The Committee on Criminal Justice will review the Department of Probation's Organizational Strategy (T2025-3645). It will also consider three resolutions urging the New York State Legislature and Governor to enact specific bills: the Gender Identity Respect, Dignity and Safety Act (Resolution 0272-2024), the Prison Safety is Public Safety legislative package (Resolution 0734-2025), and the SUPPORT Act (Resolution 0872-2025). Each resolution calls for state action on gender‑identity treatment of incarcerated people, transparency and accountability in prisons, and requirements for institutions housing defendants with mental disease or defect.

criminal-justiceprobationlegislationgender-identityprison-safetymental-health
Council Chambers - City Hall
Wed Jun 25, 2025 · Deferred

Committee on Fire and Emergency Management

Committee reviews fire safety and siting for community energy storage

The Committee on Fire and Emergency Management will hold an oversight hearing on fire safety and permitting for community energy storage facilities. The body will also consider a resolution urging New York State to pass legislation regarding the distance between battery energy storage systems and neighboring properties.

fire-safetyenergy-storagepermittingzoningpublic-safety
Committee Room - City Hall
Wed Jun 25, 2025 · 1:00 PM

Committee on Small Business

Committee will review containerization rules for Business Improvement Districts.

The Small Business Committee will hold an oversight hearing on containerization requirements for Business Improvement Districts. Members will consider any needed changes or enforcement actions. No other agenda items are listed.

small-businessbusiness-improvement-districtsoversightregulation
✓ Decided: Committee held hearing on containerization requirements for Business Improvement Districts

The Small Business Committee convened a hearing on oversight item T2025-3751 concerning containerization requirements on Business Improvement Districts. After the hearing, the committee filed the oversight item. No vote or further action was recorded.

Council Chambers - City Hall
Mon Jun 23, 2025 · 10:00 AM

Committee on Public Safety

Law enforcement’s role in keeping city parks safe

The Committee on Public Safety will hold an oversight meeting on law enforcement’s role in maintaining safety in city parks. Council members will discuss policies and practices related to park security. No specific actions or decisions are detailed in the agenda.

public-safetyparkslaw-enforcementoversight
✓ Decided: Committee held oversight hearing on law enforcement’s role in city parks

The Committee on Public Safety met on June 23, 2025, and conducted an oversight hearing titled T2025-3716 concerning law enforcement’s role in keeping city parks safe. The hearing included a committee report, testimony, and transcript. No motions, approvals, or votes were recorded, so no substantive decisions were made.

Council Chambers - City Hall
Mon Jun 23, 2025 · 1:00 PM

Committee on Contracts

Council considers three contract‑related local law amendments

The Committee on Contracts will review three proposed local law amendments. The first would create standards and procedures to identify conflicts of interest and misconduct in city contracts. The second would establish a public procurement database. The third would prohibit city agencies from purchasing single‑use water containers.

contractsprocurementethicssustainabilitylocal-law
✓ Decided: Committee held hearings and laid over three contract proposals

The Committee on Contracts heard introductions for three local laws—Int 0479-2024 on conflicts of interest, Int 0482-2024 on a public procurement database, and Int 0741-2024 on prohibiting single-use water containers. After the hearings, each introduction was laid over by the committee. No votes or approvals were recorded.

Council Chambers - City Hall
Fri Jun 20, 2025 · 1:00 PM

Committee on Environmental Protection, Resiliency and Waterfronts

Council adopts NY State Climate Smart Communities pledge to cut emissions

The Committee will consider a local law to study feasibility of solar‑ready measures for commercial buildings. It will also review proposals to amend the city charter and administrative code to require the environmental justice advisory board to review the long‑term sustainability plan, update reporting requirements, and repeal several code sections. A separate bill would amend the code to create maintenance easements for post‑construction stormwater management facilities and set civil penalties for water‑pollution violations. In addition, the Committee will pre‑consider a resolution adopting the New York State Climate Smart Communities pledge.

climatesustainabilitysolarstormwaterenvironmental-justicelegislation
✓ Decided: Committee held hearings and laid over multiple environmental proposals

The Environmental Protection, Resiliency and Waterfronts Committee held hearings on four local law introductions (Int. 0499‑2024, Int. 1271‑2025, Int. 1302‑2025, Int. 1327‑2025) and on Resolution 0926‑2025. After the hearings, each item was laid over by the committee. No final approvals or rejections were recorded.

Council Chambers - City Hall
Wed Jun 18, 2025 · Deferred

Committee on Technology

Local law to create a centralized system for processing Freedom of Information requests

The Committee on Technology will consider three local law proposals. One would amend the administrative code to set timelines for permit approvals and expand real‑time tracking of pending permits. Another would assess a cloud‑first policy for city technology systems, and a third would amend the city charter to create a centralized system for processing Freedom of Information Law requests. The agenda also includes an oversight item on improving accountability and transparency through technology.

technologypermitscloudfreedom-of-informationtransparencyaccountabilitycharter
Committee Room - City Hall
Wed Jun 18, 2025 · 1:00 PM

Committee on Civil and Human Rights

Resolution urging state to pass the Protect Our Schools Act

The Committee on Civil and Human Rights will consider several local law amendments concerning school internet access, after‑school program reporting, and airway clearance devices. It will also discuss two resolutions: one urging the New York State Education Department to adopt oral health education for elementary students, and another urging the state legislature and governor to enact the Protect Our Schools Act to protect students, faculty, and staff from civil arrest during school activities.

civil-rightseducationschoolslegislationequity
✓ Decided: Committee held hearings and laid over multiple education bills

The Civil and Human Rights Committee heard a series of education‑related bills and resolutions. Each item was subsequently laid over for further consideration, with no votes recorded. No approvals, rejections, or other final actions were taken during this meeting.

Council Chambers - City Hall Jointly with the Committee on Education
Wed Jun 18, 2025 · 1:00 PM

Committee on General Welfare

Council committee will consider several local laws on housing, legal aid, and shelter services

The Committee on General Welfare will review four proposed local laws: one requiring the Department of Social Services to post vacant supportive housing data, another expanding civil legal services for domestic‑violence survivors in divorce cases, a third requesting a report on air‑conditioning in homeless shelters, and a fourth improving notifications for emergency rental assistance grants. The committee will also consider two resolutions urging the New York State Legislature and Governor to enact the Social Worker Workforce Act and a SNAP and cash‑assistance fraud victims compensation fund.

housingsocial-serviceslegal-aidhomeless-sheltersrental-assistancelegislation
✓ Decided: General Welfare Committee held hearings on multiple bills and resolutions

The Committee on General Welfare heard four introductions and two resolutions. Each item was either heard or laid over by the committee, and no votes or approvals were recorded.

Committee Room - City Hall
Wed Jun 18, 2025 · 1:00 PM

Committee on Education

Resolution urging state to adopt oral health education in elementary schools

The Education Committee will consider three proposed local laws and two resolutions. The local laws would require the Department of Education to conduct a biannual study on student internet and device access, issue annual after‑school program reports, and require schools to stock airway clearance devices. One resolution asks the State Education Department to adopt oral health education for all elementary students. Another resolution urges the state legislature and governor to pass the Protect Our Schools Act, which would protect students, faculty, and staff from civil arrest during school activities.

educationequitytechnology-accesshealthschool-safetylegislation
✓ Decided: Education Committee held hearings and laid over multiple proposals

The Committee on Education conducted hearings on several oversight items and local law introductions, including T2025-3502, Int 0142-2024, Int 0955-2024, and Int 1002-2024. It also considered resolutions Res 0718-2025 and Res 0929-2025. All items were either heard or laid over by the committee, with no votes recorded.

Council Chambers - City Hall Jointly with the Committee on Civil and Human Rights.
Tue Jun 17, 2025 · 1:00 PM

Committee on Children and Youth

Council will consider a local law to support youth aging out of foster care

The Committee on Children and Youth will review oversight of the crisis management system under the Department of Youth and Community Development. It will also consider several local law proposals that amend the city charter and administrative code concerning foster‑care youth services and juvenile‑detention staff training.

youthfoster-carejuvenile-detentionoversightlocal-lawcity-charter
✓ Decided: Committee held hearings and filed bills; no decisions made

The Committee on Children and Youth held hearings on five items, including an oversight of the DYCD crisis‑management system and several proposed local laws affecting foster‑care youth and juvenile‑detention staff. Each item was subsequently filed by the committee. No votes or formal approvals were recorded during the meeting.

250 Broadway - Committee Room, 14th Floor
Tue Jun 17, 2025 · Deferred

Committee on General Welfare

Committee on General Welfare to review housing and social service legislation

The Committee on General Welfare is meeting to discuss several proposed local laws and resolutions. The agenda includes measures regarding supportive housing data, domestic violence legal services, and homeless shelter conditions.

housingsocial-servicesdomestic-violencehomeless-shelterslegal-services
Council Chambers - City Hall
Tue Jun 17, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee considers laws on self-storage fees and food service pricing

The Committee on Consumer and Worker Protection is reviewing several proposed local laws. These include regulations on self-storage occupancy fees and licensing, as well as consumer warnings for firearms.

consumer-protectionbusiness-licensingself-storagefirearmstax-preparationfood-service
✓ Decided: Committee heard six bills and laid them over without vote

The Consumer and Worker Protection Committee held hearings on six local law introductions and then laid each of them over for further consideration. No votes or approvals were recorded.

250 Broadway - Committee Room, 14th Floor
Tue Jun 17, 2025 · Deferred

Committee on Immigration

Committee will discuss oversight of immigrant mental health needs in NYC

The NYC Council Committee on Immigration will hold an oversight hearing on the mental health needs of immigrants in the city. The meeting is scheduled for June 17, 2025 at 10:00 AM in the Council Chambers. No specific actions or decisions are listed; the agenda item calls for discussion and review.

immigrationmental-healthoversightcity-council
Council Chambers - City Hall
Mon Jun 16, 2025 · 10:00 AM

Committee on Public Housing

Committee on Public Housing to review NYCHA vacancies and crime reporting

The Committee on Public Housing will hold an oversight hearing regarding NYCHA vacancies and transfers. The body will also consider two local laws concerning the reporting of vacant public housing units and the publication of crime statistics for NYCHA developments.

public-housingnychacrime-statisticsoversightvacancies
✓ Decided: Committee held hearings on NYCHA vacancies and housing-related bills

The Committee on Public Housing conducted a hearing on Oversight – NYCHA Vacancies and Transfers (T2025-3593). It also introduced Local Law Int 0111-2024 to amend reporting on vacant public housing units and Local Law Int 0122-2024 to require police crime statistics for NYCHA developments. No votes or formal decisions were recorded.

Council Chambers - City Hall
Mon Jun 16, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

Council votes to waive six community board reporting requirements

The Committee on Governmental Operations, State & Federal Legislation will consider a series of local law amendments affecting community board training, support offices, and charter provisions. It will also vote on a resolution (Res 0933-2025) that approves the Report and Advisory Board Review Commission’s recommendation to waive or partially waive six reporting requirements. The items are presented for discussion and possible approval at the June 16 meeting.

community-boardscharterreportingtraininggovernance
✓ Decided: Committee held hearings and laid over multiple local law introductions; no votes recorded

The Committee on Governmental Operations, State & Federal Legislation held hearings on several local law introductions and on Resolution 0933-2025. Each item was either heard or laid over by the committee. No vote tallies or final approvals were recorded in the minutes.

Committee Room - City Hall
Fri Jun 13, 2025 · 1:30 PM

Committee on Oversight and Investigations

Committee examines how the Dept. of Investigation urges employee corruption reports

The Oversight and Investigations Committee will meet on June 13, 2025 at 1:30 PM in the Council Chambers, City Hall. Agenda item T2025‑3650 calls for the committee to examine how the Department of Investigation encourages city employees to report corruption.

oversightinvestigationscorruptioncity-employeesgovernance
✓ Decided: Committee held oversight hearing on corruption reporting by city employees

The Committee on Oversight and Investigations held a hearing on item T2025-3650, which examines how the Department of Investigation encourages city employees to report corruption. The committee filed the oversight after the hearing. No vote tally was recorded.

Council Chambers - City Hall
Thu Jun 12, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council subcommittee to consider zoning amendment for Mandatory Inclusionary Housing

The Subcommittee on Landmarks, Public Sitings and Dispositions will review four applications related to the Carmen Villegas Apartments senior housing project in Manhattan Community District 11. Items include a zoning amendment to create a Mandatory Inclusionary Housing area, a rezoning from R7‑2/R7B to R9‑1, and the disposition and acquisition of a city‑owned lot on East 110th Street. Decisions will affect land use and housing policy in Council District 8.

zoninghousingland-usepublic-sitingslandmarks
✓ Decided: Subcommittee laid over four Carmen Villegas senior‑housing land‑use applications

The Subcommittee on Landmarks, Public Sitings and Dispositions heard four land‑use applications (LU 0313‑2025, LU 0314‑2025, LU 0315‑2025, LU 0316‑2025) concerning the Carmen Villegas senior‑housing project in Manhattan Community District 11, Council District 8. After the hearings, each application was laid over by the subcommittee for further consideration. No approvals or rejections were recorded.

250 Broadway - Committee Room, 16th Floor
Thu Jun 12, 2025 · 1:00 PM

Committee on Economic Development

Committee to oversee Brooklyn Marine Terminal redevelopment

The Committee on Economic Development is holding an oversight hearing regarding the Brooklyn Marine Terminal Redevelopment.

economic-developmentbrooklynmarine-terminaloversight
✓ Decided: Committee held oversight hearing on Brooklyn Marine Terminal redevelopment

The Committee on Economic Development held an oversight hearing on the Brooklyn Marine Terminal redevelopment (T2025-3590). The hearing materials, including a committee report, testimony, and transcript, were filed with the committee. No votes or decisions were recorded.

250 Broadway - Committee Room, 14th Floor
Thu Jun 12, 2025 · Deferred

Committee on Civil and Human Rights

Committee considers diversity study, school internet access, and safety resolutions

The Civil and Human Rights Committee will review an oversight item on advancing diversity and equity in NYC public schools. It will consider three proposed local laws: one requiring a biannual study of student home internet and device access, one mandating annual after‑school program reports, and one requiring schools to stock airway clearance devices. The committee will also vote on two resolutions: one urging the state education department to adopt oral‑health education for elementary students, and another urging the state legislature and governor to pass the Protect Our Schools Act to protect school participants from civil arrest.

educationequityinternet-accessafterschoolschool-safetylegislation
250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Education
Thu Jun 12, 2025 · Deferred

Committee on Education

Council proposes resolution urging state to pass the Protect Our Schools Act

The Education Committee will consider an oversight item on advancing diversity and equity in NYC public schools. It will also review three local law amendments concerning a biannual study of student internet access, annual after‑school program reports, and stocking airway clearance devices in schools. Two resolutions will be considered, one urging oral health education for elementary students and another urging passage of the Protect Our Schools Act.

educationequitytechnologyhealthsafetylegislation
250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Civil and Human Rights.
Thu Jun 12, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee to review map amendments for The Coney Development

The Subcommittee on Zoning and Franchises is reviewing a land use application for The Coney Development. The proposal involves closing specific street sections and modifying block dimensions in Brooklyn's Community District 13.

zoningland-usebrooklyncity-mapinfrastructure
✓ Decided: Subcommittee held hearing on Coney Development land use application

The Subcommittee on Zoning and Franchises heard the LU 0297-2025 application for The Coney Development. The application was subsequently laid over by the subcommittee. No votes or substantive approvals were recorded.

250 Broadway - Committee Room, 16th Floor
Thu Jun 12, 2025 · Deferred

Committee on Governmental Operations, State & Federal Legislation

Committee to consider new office for community board support and related charter changes

The Committee on Governmental Operations, State & Federal Legislation will review several local law proposals that amend the New York City charter and administrative code. The items focus on community board resources, training, data reporting, bylaws publication, newsletters, videoconferencing, and the creation of support offices within borough presidents' offices and the Department of Citywide Administrative Services. The committee will also oversee the broader oversight of community board resources and support.

community-boardscharter-amendmenttrainingdata-collectionborough-presidentscitywide-administrative-services
Committee Room - City Hall
Thu Jun 12, 2025 · Deferred

Committee on Fire and Emergency Management

Council reviews fire safety and permitting for community energy storage

The Committee on Fire and Emergency Management will hold an oversight hearing. The discussion focuses on fire safety and the permitting approval process for community energy storage facilities.

fire-safetyenergy-storagepermittingoversight
250 Broadway - Committee Room, 14th Floor
Thu Jun 12, 2025 · Deferred

Committee on Public Housing

NYC Public Housing Committee reviews two local law amendments on vacancies and crime data

The Committee on Public Housing will hold oversight on NYCHA vacancies and resident transfers. It will consider Int 0111-2024, a local law amendment to require reporting of vacant public housing units. It will also consider Int 0122-2024, a local law amendment directing the police department to publish crime statistics for each NYCHA development on its website. No other agenda items are listed.

public-housingnychavacanciescrime-datalocal-lawoversight
Committee Room - City Hall
Wed Jun 11, 2025 · 1:30 PM

City Council Stated Meeting

Council to consider removing parkland in Bronx’s Ferry Point Park

The City Council will vote on a proposal to discontinue parkland and alienate land within Ferry Point Park in the Bronx. It will also review a mayoral initiative to launch a demonstration program using photo devices to monitor speed violations in school zones. Additional items include a land‑use review of the Carmen Villegas senior‑housing project and several resolutions granting real‑property tax exemptions for specific properties.

parklandland-usespeed-monitoringsenior-housingtax-exemptionsstate-legislation
✓ Decided: Council approved a $2.0 billion FY2025 revenue appropriation

The City Council approved a $2.0 billion appropriation of new city revenues for Fiscal Year 2025. It also adopted a resolution directing review of the City Planning Commission’s senior‑housing applications for the Carmen Villegas Apartments. The Council approved a local law introducing opioid antagonists in correctional housing and consented to several land‑use applications and tax‑exemption resolutions.

Council Chambers - City Hall
Wed Jun 11, 2025 · 12:00 PM

Committee on Land Use

Committee considers zoning changes for Grace Houses and tax exemption for Ocean Crest

The Committee on Land Use will review two applications regarding Grace Houses in Brooklyn and a tax exemption request for a property in Queens. The body is discussing zoning map and resolution amendments and a real property tax exemption.

zoninghousingtax-exemptionbrooklynqueens
✓ Decided: Committee approved zoning changes for Grace Houses in Brooklyn

The Land Use Committee approved three applications. The Grace Houses zoning amendment (LU 0287‑2025) was approved with modifications and referred to the City Planning Commission. The Grace Houses mandatory inclusionary housing amendment (LU 0288‑2025) was also approved with modifications and referred to the City Planning Commission. The Ocean Crest tax‑exemption request (LU 0317‑2025) was approved as a P‑C item with a companion resolution.

Committee Room - City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0287-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0288-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0317-2025 — P-C Item Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Wed Jun 11, 2025 · 11:45 AM

Subcommittee on Zoning and Franchises

Council subcommittee will consider rezoning Grace Houses from R5B to R6A in Brooklyn.

The Subcommittee on Zoning and Franchises will review three applications. Two applications from Grace Housing Development Fund Company propose changes to the zoning map and zoning resolution for the Grace Houses project in Brooklyn's Community District 5. A third application from the NYC Department of Housing Preservation and Development seeks a property tax exemption for 29-32 Beach Channel Drive in Queens.

zoninghousingtaxbrooklynqueens
✓ Decided: Subcommittee approved three land‑use applications with modifications

The Zoning and Franchises Subcommittee voted to approve the Grace Houses zoning amendment (R5B to R6A) and the Grace Houses Mandatory Inclusionary Housing amendment, both with modifications and referral to the City Planning Commission. The subcommittee also approved the Ocean Crest Article XI tax‑exemption request with a companion resolution. All seven members voted in favor of each action.

Committee Room - City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0287-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0288-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0317-2025 — P-C Item Approved by Subcommittee with Companion Resolution
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed Jun 11, 2025 · Deferred

Committee on Consumer and Worker Protection

Council to repeal misdemeanor penalties for general and mobile food vendors

The Committee on Consumer and Worker Protection will consider Int. No. 47-B, a local law amendment to the New York City administrative code. The proposal seeks to repeal misdemeanor criminal penalties for general vendors and mobile food vendors. The committee will discuss and vote on this amendment at the June 11, 2025 meeting.

consumer-protectionvendor-regulationlocal-law
Council Chambers - City Hall VOTE*
Wed Jun 11, 2025 · 11:00 AM

Committee on Criminal Justice

Committee considers opioid antagonist requirements for Department of Correction

The Committee on Criminal Justice will discuss a local law regarding opioid antagonists in housing units and training for correction officers. The body will also consider a resolution urging New York State to provide money upon release for certain incarcerated individuals.

criminal-justicedepartment-of-correctionopioidsincarceration
✓ Decided: Committee approves opioid‑antagonist law and release‑funding resolution

The Committee on Criminal Justice approved Introduction Int 0206-2024-B, a local law requiring the Department of Correction to make opioid antagonists available in housing units and to train correction officers. The Committee also approved Resolution 0371-2024-A, urging the New York State Legislature and the Governor to enact S4078/A193 to provide money to individuals upon release. Both actions received affirmative votes from all listed members.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0206-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Res 0371-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Wed Jun 11, 2025 · 11:00 AM

Committee on Governmental Operations, State & Federal Legislation

Committee preconsiders multiple state legislation resolutions on safety, retirement, and property

The Committee on Governmental Operations, State & Federal Legislation will preconsider a series of state legislation resolutions. Topics include parkland disposition in Ferry Point Park, school speed‑zone photo monitoring, retirement benefits for city employees, access to sealed records for the civilian complaint review board, and property conveyance to a volunteer ambulance corps. No decisions are being made at this meeting; items are listed for preconsideration only.

retirementsafetypropertyrecordstransportation
✓ Decided: Committee approved multiple state legislation resolutions and a parkland change

The Committee on Governmental Operations, State & Federal Legislation approved a mayoral request to discontinue parkland in Ferry Point Park and a request to amend vehicle and traffic law for speed‑violation monitoring. It also approved a series of State Legislation Resolutions urging the New York State Legislature to pass bills on speed limits, accidental death benefits, World Trade Center rescue verification, sealed‑record access, service‑credit transfers, and a heart‑disease presumption for probation officers.

Committee Room - City Hall VOTE*
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
M 0144-2025 — P-C Item Approved by Comm
5 yea · 4 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif nay · Vickie Paladino nay · Lynn C. Schulman nay · Inna Vernikov yea
M 0145-2025 — P-C Item Approved by Comm
6 yea · 3 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
SLR 0006-2025 — P-C Item Approved by Comm
6 yea · 3 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
SLR 0012-2025 — P-C Item Approved by Comm
6 yea · 3 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
The other 16 items passed by unanimous or near-unanimous consent.
Wed Jun 11, 2025 · 10:30 AM

Committee on Hospitals

Resolution urges state to pass Local Input in Community Healthcare Act

The Committee on Hospitals will consider Resolution 0339‑2024, which calls on the New York State Assembly to pass Assembly Bill 6004 and the Governor to sign Senate Bill 1226/Assembly Bill 6004, known as the Local Input in Community Healthcare (LICH) Act. The resolution seeks state action to implement the LICH Act.

healthcarelegislationhospitalsstate-action
✓ Decided: Committee on Hospitals approves Resolution 0339-2024 urging state healthcare act

The Committee on Hospitals approved Resolution 0339-2024, which calls on the New York State Assembly to pass A.6004 and the Governor to sign S.1226/A.6004, the Local Input in Community Healthcare (LICH) Act. The committee also adopted the amendment to the resolution (Resolution 0339-2024-B). The motion was approved unanimously by all seven members present.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0339-2024 — Approved by Committee
7 yea
Mercedes Narcisse yea · Selvena N. Brooks-Powers yea · Jennifer Gutiérrez yea · Kristy Marmorato yea · Francisco P. Moya yea · Vickie Paladino yea · Carlina Rivera yea
Wed Jun 11, 2025 · 10:00 AM

Committee on Civil Service and Labor

Council to vote on resolution condemning Trump labor policies

The Committee on Civil Service and Labor will consider a resolution that strongly condemns the Trump administration's efforts to dismantle federal labor protections and affirms the right of workers to organize.

laborunionizationcouncilresolutioncivil-service
✓ Decided: Committee approves resolution condemning Trump administration's labor actions

The Committee on Civil Service and Labor approved Resolution 0066-2024-A, which strongly condemns the Trump administration's efforts to dismantle federal labor protections and affirms the right of all workers to organize and bargain collectively. The motion to approve the resolution was made and passed by roll call, with all nine committee members voting affirmative.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0066-2024 — Approved by Committee
9 yea
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks yea · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Wed Jun 11, 2025 · 10:00 AM

Committee on Civil and Human Rights

Council committee to consider resolution recognizing Thurgood Marshall Day

The Committee on Civil and Human Rights will meet to discuss a resolution regarding the annual recognition of Thurgood Marshall Day. The body is reviewing the legacy and contributions of Thurgood Marshall to the Civil Rights movement.

civil-rightsresolutioncommemoration
✓ Decided: Committee approved a resolution naming July 2 Thurgood Marshall Day

The Committee on Civil and Human Rights voted to adopt Resolution 0520-2024, which designates July 2 each year as Thurgood Marshall Day in New York City. Four members voted in favor and one member was absent. The resolution was approved by the committee.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0520-2024 — Approved by Committee
4 yea · 1 absent
Nantasha M. Williams yea · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley absent · Rafael Salamanca, Jr. yea
Wed Jun 11, 2025 · 9:30 AM

Committee on Finance

City to appropriate $2.0 billion of new revenues for FY 2025

The Finance Committee will consider a communication from the Office of Management and Budget requesting appropriation of $2.0 billion in new city revenues for fiscal year 2025 under Section 107(e) of the charter. It will also vote on Resolution 0938-2025 that modifies the same charter provision. In addition, the committee will pre‑consider a series of land‑use items across Brooklyn, Manhattan, Queens, and the Bronx.

financebudgetland-usehousingdevelopment
✓ Decided: Committee approved $2.0 billion appropriation of new city revenues

The Finance Committee approved Communication M 0136-2025, appropriating $2.0 billion of new city revenues for FY 2025. It also approved Resolution No. 938 modifying Section 107(e) of the City Charter. In the same meeting the committee approved ten land‑use applications as P‑C items, each with a companion resolution.

Council Chambers - City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
M 0136-2025 — Approved by Committee
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Res 0938-2025 — Approved by Committee
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0303-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0304-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0305-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0306-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0307-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0308-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0309-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0310-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0311-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0312-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Wed Jun 11, 2025 · 11:30 AM

Committee on Public Safety

Council considers resolution on using VINs in vehicle notices of violation

The Committee on Public Safety is meeting to discuss a resolution regarding vehicle identification. The proposal asks New York State to allow Vehicle Identification Numbers (VIN) to be used in notices of violation when license plates are missing or obscured.

public-safetytraffic-lawvehicleslegislation
✓ Decided: Committee approves resolution urging state VIN change in traffic notices

The New York City Council Committee on Public Safety approved Resolution 0853-2025. The resolution asks the New York State Legislature and the Governor to amend the vehicle and traffic law so a vehicle’s VIN can be listed in a Notice of Violation when the license plate is missing, concealed, obscured, or distorted. All committee members present voted affirmative.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0853-2025 — Approved by Committee
11 yea
Yusef Salaam yea · Joann Ariola yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden yea · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé yea · Carlina Rivera yea · Althea V. Stevens yea
Wed Jun 11, 2025 · 11:30 AM

Committee on Veterans

Council to recognize 75th anniversary of Korean War

The Committee on Veterans will consider a resolution to officially recognize June 25, 2025, as the 75th anniversary of the Korean War and to designate June 25 annually as Korean War Remembrance Day in New York City.

veteranskorean-warresolutionanniversarynew-york-city
✓ Decided: Committee approves resolution naming June 25 Korean War Remembrance Day

The Committee on Veterans approved Resolution 0896-2025, which designates June 25, 2025 as the 75th anniversary of the Korean War’s start and establishes Korean War Remembrance Day to be observed annually in New York City. The motion was approved by roll call with all five committee members voting in favor.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0896-2025 — Approved by Committee
5 yea
Robert F. Holden yea · Joann Ariola yea · Kristy Marmorato yea · Sandy Nurse yea · Vickie Paladino yea
Wed Jun 11, 2025 · 10:30 AM

Committee on Parks and Recreation

Council committee considers requiring outdoor drinking fountains at park entrances

The Committee on Parks and Recreation is meeting to discuss Int 0573-2024. This proposed local law would require the installation of outdoor drinking fountains near entrances to parks managed by the Department of Parks and Recreation.

parkspublic-healthinfrastructurelegislation
✓ Decided: Committee approves drinking fountain law for park entrances

The Committee on Parks and Recreation considered Introduction Int 0573-2024-A, a local law requiring the installation of outdoor drinking fountains near park entrances. A motion to approve the introduction was made and passed by roll call. All eight committee members voted affirmative.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0573-2024 — Approved by Committee
8 yea
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino yea · Sandra Ung yea
Wed Jun 11, 2025 · 9:30 AM

Committee on Transportation and Infrastructure

Committee considers laws on public bathroom reporting and taxi insurance

The Committee on Transportation and Infrastructure will meet to discuss two proposed local laws. These items involve reporting requirements for public bathrooms and insurance coverage limits for licensed taxi and limousine vehicles.

transportationpublic-bathroomstaxisinsuranceinfrastructure
✓ Decided: Committee approves two local law introductions on public bathrooms and taxi insurance

The Transportation and Infrastructure Committee approved Introduction 0272-2024-A, a local law to amend reporting on previously identified public bathroom sites, by a 7‑0 vote (Rivera and Won absent). The committee also approved Introduction 1050-2024-A, a local law to limit the personal injury insurance coverage the Taxi and Limousine Commission may require for licensed vehicles, by a 7‑0 vote (Rivera and Won absent). Both motions were adopted by roll call.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0272-2024 — Approved by Committee
7 yea · 2 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera absent · Julie Won absent
Int 1050-2024 — Approved by Committee
7 yea · 2 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera absent · Julie Won absent
Tue Jun 10, 2025 · 1:00 PM

Committee on Hospitals

Committee on Hospitals to hold oversight hearing on language access

The Committee on Hospitals will meet to conduct an oversight hearing regarding language access in hospitals. No other items are listed on the agenda.

hospitalslanguage-accesshealthcareoversight
✓ Decided: Committee held oversight hearing on language access in hospitals

The Committee on Hospitals met on June 10, 2025. Members Narcisse, Brooks-Powers, Marmorato, Paladino, and Rivera were present; Gutiérrez and Moya were absent. The committee held a hearing on oversight item T2025-3523 concerning language access in hospitals and filed the oversight documentation.

Council Chambers - City Hall
Tue Jun 10, 2025 · 11:00 AM

Committee on Veterans

Council Committee to consider Korean War Remembrance Day resolution

The Committee on Veterans will discuss an oversight item (T2025-3528) about increasing self-identification by New York City veterans. The committee will consider Resolution 0896-2025, which would recognize June 25, 2025 as the 75th anniversary of the start of the Korean War and designate June 25 as Korean War Remembrance Day each year in New York City.

veteranskorean-warcommemorationresolutioncity-council
✓ Decided: Committee held hearings on veteran oversight and Korean War remembrance resolution

The Committee on Veterans heard the T2025-3528 oversight on increasing veteran self‑identification and reviewed Resolution 0896-2025 designating June 25, 2025 as Korean War Remembrance Day. No votes or formal approvals were recorded; the items were filed and laid over by the committee.

250 Broadway - Committee Room, 14th Floor
Tue Jun 10, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Resolution urging NY State to grant permanent design‑build authority to all NYC agencies

The Transportation and Infrastructure Committee will review the Department of Design and Construction’s implementation of design‑build processes. It will consider Resolution 0886‑2025, which asks the New York State Legislature and Governor to enact permanent, expanded design‑build authority for all city agencies. No other agenda items are listed.

design-buildlegislationoversighttransportationinfrastructure
✓ Decided: Committee held hearings and filed items, no decisions taken

The Transportation and Infrastructure Committee held a hearing on oversight of the Department of Design and Construction’s design‑build processes (T2025‑3599). The committee also considered Resolution 0886‑2025 urging state legislation for permanent design‑build authority for city agencies. Both items were heard and the resolution was laid over; no votes or approvals were recorded.

Committee Room - City Hall
Tue Jun 10, 2025 · Deferred

Committee on Land Use

Council will consider rezoning Grace Houses from R5B to R6A in Brooklyn.

The Land Use Committee will consider three applications. Two applications from Grace Housing Development Fund seek to change the zoning map and add a Mandatory Inclusionary Housing area in Brooklyn’s Community District 5. The third application from the Department of Housing Preservation and Development requests a property tax exemption for the Ocean Crest development at 29‑32 Beach Channel Drive in Queens.

zoninghousingtax-exemptionbrooklynqueensland-use
250 Broadway - Committee Room, 16th Floor
Tue Jun 10, 2025 · Deferred

Subcommittee on Zoning and Franchises

Zoning map and tax exemption applications for Brooklyn and Queens

The Subcommittee on Zoning and Franchises will consider a zoning map amendment for Grace Houses in Brooklyn and an exemption from real property taxation for Ocean Crest in Queens. The meeting agenda lists these items for discussion and potential approval.

zoninghousingtax-exemptionbrooklynqueenssubcommittee
250 Broadway - Committee Room, 16th Floor
Tue Jun 10, 2025 · Deferred

Committee on General Welfare

Council committee urges state to pass Social Worker Workforce Act

The Committee on General Welfare will consider several local laws and resolutions at its June 10, 2025 meeting. Items include a law requiring the Department of Social Services to post data on vacant supportive housing units, a law expanding civil legal services for domestic‑violence survivors in divorce proceedings, and a law requesting a report on air‑conditioning in homeless shelters. The committee will also consider resolutions urging the New York State Legislature and Governor to enact the Social Worker Workforce Act and to establish a SNAP and cash‑assistance fraud victims compensation fund.

housingsocial-serviceslegal-aidemergency-rentalsnapwelfarelegislation
Council Chambers - City Hall
Mon Jun 9, 2025 · 1:00 PM

Committee on Mental Health, Disabilities and Addiction

Committee to discuss mental health services for older New Yorkers

The Committee on Mental Health, Disabilities and Addiction is holding a joint meeting with the Committee on Aging. The body will conduct oversight on mental health and older New Yorkers and consider several resolutions regarding disability exemptions and funding.

mental-healthagingdisabilitysocial-securityhealthcare-funding
✓ Decided: Committee held hearings on mental‑health resolutions, no decisions recorded

The Committee on Mental Health, Disabilities and Addiction heard an oversight hearing (T2025-3572) and reviewed several resolutions, including Res 0106‑2024, Res 0736‑2025, and Res 0852‑2025. Introductory items such as Int 1257‑2025 were also presented. All items were either heard or laid over by the committee, and no votes, approvals, or denials were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Aging
Mon Jun 9, 2025 · Deferred

Committee on Education

Council committee to consider afterschool reporting law and Marshall Day resolution

The Committee on Education will meet on June 9, 2025 at 1:00 PM in the Council Chambers, City Hall. The agenda includes an oversight hearing on advancing diversity and equity in NYC public schools (T2025-3502). Members will consider Int 0955-2024, a local law amendment requiring annual reports on afterschool programs. The committee will also consider Res 0520-2024, a resolution designating July 2 as Thurgood Marshall Day in New York City.

educationdiversity-equityafterschoollegislationcivil-rights
Council Chambers - City Hall Jointly with the Committee on Civil and Human Rights.
Mon Jun 9, 2025 · Deferred

Committee on Civil and Human Rights

Committee to discuss diversity in public schools and afterschool reporting

The Committee on Civil and Human Rights will hold a joint meeting with the Committee on Education. The body will conduct oversight on diversity and equity in NYC public schools and consider a law regarding annual reports for afterschool programs.

educationcivil-rightspublic-schoolsafterschool-programs
Council Chambers - City Hall Jointly with the Committee on Education
Mon Jun 9, 2025 · 1:00 PM

Committee on Aging

Council to consider expanding Disability Rent Increase Exemption eligibility

The Committee on Aging will review a local law directing the cabinet for older New Yorkers to study services for older adults with neurological and mental health conditions. It will consider a resolution urging the New York State Legislature and the Governor to expand the Disability Rent Increase Exemption program to additional qualifying household members. Additional resolutions will call for increased funding for Assertive Community Treatment teams and request federal action to protect Social Security.

aginghousingmental-healthdisabilitylegislation
✓ Decided: Committee held hearings and filed resolutions; no actions approved

The Committee on Aging, meeting jointly with the Committee on Mental Health, Disabilities and Addiction, held a hearing on Oversight T2025-3573 and filed it. The committee also filed and laid over Res 0106-2024, Res 0736-2025, and Res 0852-2025, and introduced Int 1257-2025 and its amendment. No votes, approvals, or other substantive decisions were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Mental Health, Disabilities and Addiction.
Thu Jun 5, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will review multiple zoning amendments and a tax exemption request

The Subcommittee on Zoning and Franchises will consider several applications to amend the Zoning Map and Zoning Resolution for projects in Brooklyn, Manhattan, and Queens. Items include a rezoning of Grace Houses from R5B to R6A and a Mandatory Inclusionary Housing amendment, a special permit for One45 for Harlem to modify tower regulations, rezoning and inclusionary housing proposals for North 7th Street and 109 Marcus Garvey Boulevard, and a tax‑exemption request for the Ocean Crest property at 29‑32 Beach Channel Drive. The committee will vote on each application as presented.

zoninginclusionary-housingrezoningtax-exemptionbrooklynmanhattanqueens
✓ Decided: Subcommittee laid over nine land‑use applications, postponing decisions

The Zoning and Franchises Subcommittee heard a series of land‑use applications and then voted to lay them over, meaning the items were postponed without final action. Applications included zoning map changes for Grace Houses, a special permit for One45 Lenox, rezoning and inclusionary‑housing proposals for North 7th Street and 109 Marcus Garvey Boulevard, and a tax‑exemption request for Ocean Crest. No vote tallies were recorded in the minutes.

Council Chambers - City Hall
Wed Jun 4, 2025 · Deferred

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee meeting scheduled with no specific agenda items listed

The Subcommittee on Landmarks, Public Sitings and Dispositions will meet on June 4, 2025 at 11:00 AM in Committee Room 250 Broadway, 16th Floor. The agenda released does not list any specific items for discussion or decision. No rezoning proposals, contracts, ordinances, or fee changes are mentioned.

landmarkspublic-sitingsdispositionscity-councilprocedural
250 Broadway - Committee Room, 16th Floor
Tue Jun 3, 2025 · 1:00 PM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Committee to hold oversight discussion on NYC’s youngest readers program

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will meet on June 3, 2025. The agenda lists item T2025-3511, an oversight discussion of the city’s program for its youngest readers. No other agenda items are provided.

educationyouthlibrariescultureoversightyoung-readers
✓ Decided: Committee held oversight hearing on NYC’s youngest readers

The Committee on Cultural Affairs, Libraries and International Intergroup Relations held an oversight hearing titled “Supporting New York City’s Youngest Readers.” No votes, approvals, or other decisions were recorded in the minutes.

Committee Room - City Hall
Tue Jun 3, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee to discuss social housing and land bank laws

The Committee on Housing and Buildings will review several local laws related to social housing, including a study on establishing a social housing agency and creating a land bank. The committee will also consider measures regarding community land trusts, tenant protections, and building code updates.

housingsocial-housingland-bankcommunity-land-trusttenant-rightsoversightpublic-benefit-corp
✓ Decided: Housing and Buildings Committee held hearings on numerous bills

The committee heard introductions and testimonies for several local law proposals covering social housing, land banks, affordable housing task forces, rent exemptions, building‑code changes, and tenant‑sale rights. No votes or approvals were recorded; the items were presented and laid over for further consideration.

Council Chambers - City Hall
Tue Jun 3, 2025 · 10:00 AM

Committee on Women and Gender Equity

Committee on Women and Gender Equity to review STEM reporting and doula training laws

The Committee on Women and Gender Equity is meeting to discuss several proposed local laws and resolutions. The items focus on education reporting, healthcare training, and legal record corrections.

educationhealthcaregender-equitystempublic-healthcivil-rights
✓ Decided: Committee held hearings on multiple items and laid them over without action

The Committee on Women and Gender Equity heard introductions on STEM reporting, female genital mutilation training, death record sex designations, and doula services, and also heard two resolutions on natural hair care and gender‑affirming care. After the hearings, each item was laid over by the committee, meaning no further action was taken at this meeting.

Committee Room - City Hall
Fri May 30, 2025 · 10:00 AM

Committee on Finance

Committee on Finance to hold Fiscal Year 2026 Executive Budget hearings

The Committee on Finance is conducting hearings regarding the New York City Council Fiscal Year 2026 Executive Budget. The body will hear testimony from four city financial offices.

budgetfinancefiscal-year-2026
✓ Decided: Committee held FY2026 executive budget hearing; no actions taken

The Finance Committee met on May 30, 2025 at City Hall. Members present included Brannan, Ayala, Brewer, Brooks-Powers, Carr, Farías, Hanks, Hudson, Louis, Moya, Salaam, Sanchez, Stevens and Williams; Ossé, Powers and Won were absent. The committee conducted an oversight hearing on the FY2026 executive budget with scheduled sessions from 10:00‑1:00 with the Office of Management & Budget, 1:30‑2:30 with the Comptroller, 2:30‑3:30 with the Department of Finance, and 3:30‑4:30 with the Independent Budget Office. No votes, approvals, or other decisions were recorded.

Council Chambers - City Hall *
Thu May 29, 2025 · 10:00 AM

Committee on Public Safety

Public Safety Committee conducts FY2026 budget hearings for NYPD and Justice Office

The Committee on Public Safety will hold executive budget hearings for Fiscal Year 2026. Hearings will cover the New York City Police Department and the Mayor's Office of Criminal Justice. A public hearing segment follows, and the session is joint with the Committee on Finance.

budgetpublic-safetypolicecriminal-justicefinance
✓ Decided: Public Safety Committee held oversight hearings; no actions taken

The Committee on Public Safety met on May 29, 2025 with Chair Yusef Salaam and members present. The session was held jointly with the Committee on Finance and scheduled hearings for the NYPD and the Mayor's Office of Criminal Justice. No substantive decisions, approvals, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Thu May 29, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearings

The Committee on Finance, jointly with the Committee on Public Safety, will conduct budget hearings for the Fiscal Year 2026 executive budget. The session includes reviews of the New York City Police Department and the Mayor's Office of Criminal Justice.

budgetpolicecriminal-justicefinance
✓ Decided: Finance Committee schedules FY2026 budget hearings with NYPD and Mayor's office

The Committee on Finance held a joint meeting with the Committee on Public Safety on May 29, 2025. Members present included Chair Justin L. Brannan and 13 other council members; three members were absent. The committee set the schedule for FY2026 executive budget hearings, allocating time for the NYPD (10:00 a.m.–12:00 p.m.) and the Mayor's Office of Criminal Justice (12:00 p.m.–2:00 p.m.). No votes or formal approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Public Safety.
Wed May 28, 2025 · 11:15 AM

Subcommittee on Zoning and Franchises

Subcommittee reviews multiple Brooklyn rezoning and Manhattan rail‑yard permit proposals

The Subcommittee on Zoning and Franchises will consider a series of zoning map amendment applications for properties in Brooklyn, including rezoning of Empire Boulevard, Kings Highway, Maspeth Avenue, and Neptune Avenue. It will also review applications to modify the Western Rail Yard in Manhattan, covering special‑permit changes, zoning‑resolution amendments, a mapping action, and a restrictive‑declaration update. Each item is presented as a separate application (LU 0275‑2025 through LU 0286‑2025) and will be voted on by the council members.

zoningrezoningspecial-permithousingdevelopmentmanhattanbrooklyn
✓ Decided: Subcommittee approved six rezoning applications with modifications

The Zoning and Franchises Subcommittee voted to approve six land‑use applications—four Empire Boulevard rezoning filings, two 19 Maspeth Avenue rezoning filings, and two Kings Highway rezoning filings—with modifications. Each motion received affirmative votes from all seven members (Riley, Abreu, Carr, Hanks, Moya, Salaam, Schulman). The approved applications were referred to the City Planning Commission for further review where noted.

Committee Room - City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
LU 0275-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0276-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0277-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0278-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0279-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0280-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0281-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0282-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0283-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0284-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0285-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0286-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed May 28, 2025 · 11:00 AM

Committee on Transportation and Infrastructure

Committee to consider study on electric for-hire vehicles and charging infrastructure

The Committee on Transportation and Infrastructure will meet to discuss Int 0676-2024. This proposed local law relates to requiring a study on increasing the use of electric for-hire vehicles and the installation of new charging infrastructure.

transportationelectric-vehiclesinfrastructurefor-hire-vehicles
✓ Decided: Committee approves Introduction 676‑A for electric for‑hire vehicle study

The Transportation and Infrastructure Committee voted to approve Introduction No. 676‑A, which calls for a study on increasing the use of electric for‑hire vehicles and installing new charging infrastructure. All nine committee members voted affirmative, resulting in the measure’s approval by the committee.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0676-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Wed May 28, 2025 · 10:30 AM

Committee on Civil Service and Labor

Committee considers resolution supporting Living Wage for Musicians Act

The Committee on Civil Service and Labor is meeting to discuss a resolution regarding the Living Wage for Musicians Act. The body is reviewing a call for the U.S. Congress to pass and the President to sign the legislation.

labormusiciansfederal-legislationwages
✓ Decided: Committee approved resolution urging Congress to pass Living Wage for Musicians Act

The Committee on Civil Service and Labor voted to approve Resolution 0368-2024-A, which calls on the United States Congress to reintroduce and pass, and the President to sign, the Living Wage for Musicians Act. All nine committee members present voted in favor. The resolution was accompanied by related hearing transcripts and reports.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0368-2024 — Approved by Committee
9 yea
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks yea · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Wed May 28, 2025 · 10:30 AM

Committee on Finance

Committee on Finance to review FY2026 tax rates and land use applications

The Committee on Finance is discussing the establishment of the East Harlem 125th Street business improvement district and funding designations for organizations. The body is also considering interest rates for non-payment of taxes and early payment discounts for Fiscal Year 2026. Additionally, the committee will review several land use applications in Manhattan and Queens.

taxeszoningland-usebusiness-improvement-districtbudget
✓ Decided: Committee approved new tax discount and interest rates for FY 2026

The Finance Committee approved a resolution changing funding designations for certain organizations and set a 0.5% early‑payment tax discount for FY 2026. It also adopted five resolutions establishing interest rates of 2.5%, 6%, 9% and 16% for delinquent property taxes based on assessed value. Additionally, five land‑use applications for housing projects were approved with companion resolutions.

Committee Room - City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0875-2025 — P-C Item Approved by Comm
13 yea · 3 absent · 1 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won absent
The other 11 items passed by unanimous or near-unanimous consent.
Wed May 28, 2025 · 11:30 AM

Committee on Land Use

Committee reviews several Brooklyn rezoning and Manhattan rail yard permit proposals.

The New York City Council Land Use Committee will consider a series of zoning map amendments and special permit applications. Items include rezoning of properties on Empire Boulevard, Kings Highway, Maspeth Avenue, and Neptune Avenue in Brooklyn, as well as multiple modifications to the Western Rail Yard in Manhattan. The agenda also contains applications to establish Mandatory Inclusionary Housing areas in the affected districts.

rezoningzoningspecial-permithousingrail-yardbrooklynmanhattan
✓ Decided: Committee approved six rezoning applications with modifications, sending them to CPC

The Committee on Land Use approved six rezoning applications—four for Empire Boulevard, two for Kings Highway, and two for 19 Maspeth Avenue—each with modifications and referred to the City Planning Commission. All ten members voted in favor of each motion. The approvals cover both zoning map amendments and mandatory inclusionary housing designations.

Committee Room - City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
LU 0275-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0276-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0277-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0278-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0279-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0280-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0281-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0282-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0283-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0284-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0285-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0286-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Wed May 28, 2025 · 11:30 AM

Committee on Contracts

Council reviews a six-month pilot for food quality feedback surveys

The Committee on Contracts will consider a proposed Local Law (Int. No. 905‑A) that would start a six‑month pilot program to collect food‑quality feedback surveys from food service contractors. The proposal outlines a feedback system to assess contractor performance. The committee will decide whether to adopt the Local Law.

contractsfood-qualitypilot-programlocal-law
✓ Decided: Committee on Contracts approves six‑month food‑quality feedback pilot

The Committee on Contracts voted to approve Introduction No. 905‑A, a local law establishing a six‑month pilot program for food‑quality feedback surveys from food‑service contractors. The vote was three in favor, with one member absent and one member on medical leave. The approval moves the pilot program forward for implementation.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0905-2024 — Approved by Committee
3 yea · 1 absent · 1 medical
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens absent · Inna Vernikov medical
Wed May 28, 2025 · 10:00 AM

Committee on Rules, Privileges and Elections

Council to advise and consent on mayor’s Landmarks Preservation appointments

The Committee on Rules, Privileges and Elections will receive communications from the Mayor naming individuals for the Council’s advice and consent. The nominees include Stephen Chu, Angie Master, Stephen Wilder, Erasmus Ikpemgbe, Frank Mahan for the Landmarks Preservation Commission, and Robert J. Firestone as president of the New York City Tax Commission. The Council will consider each appointment under the relevant sections of the City Charter.

appointmentslandmarkstax-commissioncity-chartercouncil
✓ Decided: Committee approved six mayor‑appointed Landmarks and Tax Commission nominees

The Rules, Privileges and Elections Committee voted to approve the mayor's messages recommending re‑appointment of Stephen Chu, Angie Master, Stephen Wilder, Erasmus Ikpemgbe, and Frank Mahan to the Landmarks Preservation Commission, and the appointment of Robert J. Firestone as president of the New York City Tax Commission. All six motions were adopted, with vote totals ranging from 7‑1‑2 to 8‑0‑2. The two absent members for each vote were Councilmembers Ayala and Salamanca Jr.

Council Chambers - City Hall VOTE*
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
M 0122-2025 — Approved by Committee with Companion Resolution
8 yea · 2 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
M 0123-2025 — Approved by Committee with Companion Resolution
8 yea · 2 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
M 0124-2025 — Approved by Committee with Companion Resolution
7 yea · 2 absent · 1 abstain
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
M 0125-2025 — Approved by Committee with Companion Resolution
7 yea · 2 absent · 1 abstain
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
M 0126-2025 — Approved by Committee with Companion Resolution
7 yea · 2 absent · 1 abstain
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer abstain · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
M 0127-2025 — Approved by Committee with Companion Resolution
8 yea · 2 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. absent · Pierina Ana Sanchez yea
Wed May 28, 2025 · 9:30 AM

Committee on General Welfare

Local Law to require benefit application confirmations from Dept. of Social Services

The Committee on General Welfare will consider Int. No. 1148-A, a proposed amendment to the city’s administrative code. The bill would require the Department of Social Services to issue a confirmation notice and provide document receipts for benefit applications. The committee will vote on the proposal.

welfaresocial-servicesbenefitslegislationlocal-law
✓ Decided: Committee approves Local Law requiring benefit application confirmations

The Committee on General Welfare approved Introduction 1148-2024-A, a local law that requires the Department of Social Services to provide confirmation notices and document receipts for benefit applications. The motion passed with all eight present members voting in favor and one member absent. The approval advances the measure toward enactment.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1148-2024 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens absent · Sandra Ung yea
Wed May 28, 2025 · 9:30 AM

Committee on Housing and Buildings

Council will consider a local law on posting info in rent‑stabilized buildings

The Committee on Housing and Buildings will consider Local Law Int 1037‑2024, which would amend the city’s administrative code to require posting certain information in multiple dwellings that contain rent‑stabilized units. The committee will also consider Local Law Int 1207‑2025, which would amend the code to allow practical experience earned separately but concurrently with an apprenticeship to count toward the supervised experience required for high‑pressure boiler operating engineer licenses.

housingrent-stabilizationbuilding-regulationlicensingboiler
✓ Decided: Committee approved two local law introductions, each 6-1

The Committee on Housing and Buildings approved two introductions. Int 1037-2024-A, a law on posting information in rent‑stabilized units, passed 6‑1. Int 1207-2025-A, a law allowing apprenticeship experience toward boiler engineer licenses, also passed 6‑1.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1037-2024 — Approved by Committee
6 yea · 1 absent
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz absent · Crystal Hudson yea · Lincoln Restler yea
Int 1207-2025 — Approved by Committee
6 yea · 1 absent
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz absent · Crystal Hudson yea · Lincoln Restler yea
Wed May 28, 2025 · 1:30 PM

City Council Stated Meeting

City Council receives FY 2026 Executive Budget and Capital Strategy

The City Council is reviewing the Mayor's proposed Expense, Revenue, and Capital Budgets for Fiscal Year 2026. The body is also considering several local laws regarding food service surveys, custody notifications, and flood adaptation in southeast Queens.

budgetzoningtaxeshousingenvironment
✓ Decided: Council places three major land‑use applications under review

The City Council approved land‑use call‑ups for Application C 250117 ZSM (One45 for Harlem), Application C 240400 ZSK (109 Marcus Garvey Boulevard LSGD) and Application C 250108 MMK (The Coney Development), directing each to be subject to Council review and referring them to the Committee on Land Use. The Council also passed its consent agenda by a 47‑yes, 2‑non‑voting, 2‑absent vote and approved three local‑law introductions (Int 0905‑2024‑A, Int 0412‑2024‑A, Int 1067‑2024‑B) by consent.

Council Chambers - City Hall
Wed May 28, 2025 · 12:00 PM

Committee on Governmental Operations, State & Federal Legislation

Committee preconsiders five state resolutions on traffic, retirement, and benefits

The Committee on Governmental Operations, State & Federal Legislation will preconsider four state legislation resolutions requesting the New York State Legislature to pass specific bills. The items address vehicle and traffic law owner liability for street‑cleaning parking rules, restoration of 20‑year service retirement for certain corrections officers and sanitation workers, death benefits for active transit authority members, and police retirement eligibility based on prior traffic‑enforcement service. All resolutions are listed as preconsidered items on the agenda.

state-legislationtrafficretirementpublic-safetygovernment
✓ Decided: Committee approved four state legislation resolutions

The Committee on Governmental Operations, State & Federal Legislation approved four State Legislation Resolutions (SLR 0002‑2025, 0003‑2025, 0004‑2025, and 0005‑2025). Each resolution requests the New York State Legislature to pass specific bills on vehicle parking rules, retirement benefits for corrections and sanitation workers, death benefits for transit workers, and police retirement eligibility. The votes were 6‑3 for SLR 0002‑2025 and unanimous 9‑0 for the other three resolutions.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
SLR 0002-2025 — P-C Item Approved by Comm
6 yea · 3 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
The other 3 items passed by unanimous or near-unanimous consent.
Wed May 28, 2025 · 9:00 AM

Committee on Criminal Justice

Committee to consider notification rules for injured individuals in custody

The Committee on Criminal Justice will meet to discuss Int 0412-2024. This proposed local law relates to notifying attorneys and emergency contacts when a person in custody is seriously injured, hospitalized, or attempts suicide.

criminal-justicepublic-safetylegal-notificationcustody-rights
✓ Decided: Committee approves Local Law on notifying contacts for detained individuals

The Committee on Criminal Justice approved Introduction Int 0412-2024-A, a local law amending the city administrative code to require notification of emergency contacts and attorneys when a person in custody attempts suicide, is hospitalized, or is seriously injured. The motion passed with eight members voting in favor and one member absent. No other actions were taken at this meeting.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0412-2024 — Approved by Committee
8 yea · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens absent
Wed May 28, 2025 · 9:00 AM

Committee on Environmental Protection, Resiliency and Waterfronts

Council to discuss flood adaptation assistance in southeast Queens

The Committee on Environmental Protection, Resiliency and Waterfronts will consider a local law to amend the administrative code regarding flood adaptation assistance and create a southeast Queens flooding adaptation assistance task force.

environmentresiliencywaterfrontsqueensfloodtask-force
✓ Decided: Committee approves flood‑adaptation task force legislation

The Committee on Environmental Protection, Resiliency and Waterfronts approved Introduction 1067‑2024‑B, a local law to amend the city code to provide flood‑adaptation information, create a southeast Queens flooding adaptation assistance task force, and repeal section 24‑530.1. The motion passed by roll call with eight members voting affirmative and one member absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1067-2024 — Approved by Committee
8 yea · 1 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan yea · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. absent · Susan Zhuang yea
Tue May 27, 2025 · 12:00 PM

Committee on Immigration

Committee reviews FY 2026 budget for the Mayor's Office of Immigrant Affairs

The Committee on Immigration will hold executive budget hearings for the city’s FY 2026 budget. The hearings will focus on the Mayor’s Office of Immigrant Affairs from 12:00 p.m. to 2:00 p.m., followed by a public session at 2:00 p.m. The meeting is conducted jointly with the Committee on Finance.

budgetimmigrationfinancecity-councilfiscal-year-2026
✓ Decided: Immigration Committee held a joint oversight hearing with Finance

The Committee on Immigration met on May 27, 2025, with the Committee on Finance for an oversight hearing on the Mayor's Office of Immigrant Affairs. No formal actions, approvals, or denials were recorded; the meeting was procedural.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 27, 2025 · 10:00 AM

Committee on Finance

Executive budget hearings for FY 2026 with Corrections and Immigrant Affairs

The Finance Committee will hold executive budget hearings for Fiscal Year 2026. Sessions include a hearing on the Department of Corrections, a hearing on the Mayor's Office of Immigrant Affairs, and a public hearing. The Corrections hearing is joint with the Committee on Criminal Justice, and the Immigrant Affairs hearing is joint with the Committee on Immigration.

budgetfinancecorrectionsimmigrationpublic-hearing
✓ Decided: Finance Committee held oversight hearing, no decisions taken

The Committee on Finance met on May 27, 2025, with a roll call of members present and absent. The meeting consisted of an oversight hearing on the Department of Corrections and the Mayor's Office of Immigrant Affairs, held jointly with the Criminal Justice and Immigration committees. No substantive decisions, approvals, or denials were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Criminal Justice and the Committee on Immigration.
Tue May 27, 2025 · 10:00 AM

Committee on Criminal Justice

Committee on Criminal Justice to hold FY 2026 budget hearing for Department of Corrections

The Committee on Criminal Justice and the Committee on Finance will jointly hold an executive budget hearing for Fiscal Year 2026. The session focuses on the Department of Corrections.

budgetcorrectionscriminal-justice
✓ Decided: No decisions made; committee held Department of Corrections budget hearing

The Criminal Justice Committee met jointly with the Finance Committee for a fiscal year 2026 executive budget hearing on the Department of Corrections. The meeting consisted of a public hearing and did not record any votes, approvals, denials, or other formal actions.

Council Chambers - City Hall Jointly with the Committee on Finance
Fri May 23, 2025 · 10:00 AM

Committee on Finance

Finance Committee holds FY 2026 health budget hearings

The Committee on Finance will conduct executive budget hearings for Fiscal Year 2026. Hearings will cover the Department of Health and Mental Hygiene's Mental Health program (10:00‑12:00), its Public Health program (12:00‑2:00), and a public hearing jointly with the Committee on Health and the Committee on Mental Health, Disabilities and Addiction (2:00‑?).

budgethealthmental-healthpublic-healthhearings
✓ Decided: Finance Committee held health budget hearings, no actions taken

The Committee on Finance met on May 23, 2025, jointly with the Health and Mental Health, Disabilities and Addiction committees. The meeting consisted of roll call and scheduled hearings on the Department of Health and Mental Hygiene’s mental health and public health budgets for fiscal year 2026. No motions, approvals, or votes were recorded; the committee only held oversight hearings.

Council Chambers - City Hall Jointly with the Committee on Health and the Committee on Mental Health, Disabilities and Addiction.
Fri May 23, 2025 · 10:00 AM

Committee on Health

Health Committee holds FY 2026 budget hearings for mental and public health

The Committee on Health will conduct executive budget hearings for Fiscal Year 2026. The hearings cover the Department of Health and Mental Hygiene's Mental Health division from 10:00 a.m. to 12:00 p.m., and the Public Health division from 12:00 p.m. to 2:00 p.m. The session is held jointly with the Committee on Mental Health, Disabilities and Addiction and the Committee on Finance.

budgethealthmental-healthpublic-healthcity-council
✓ Decided: No substantive decisions were made; the meeting was procedural

The Committee on Health held a procedural session with roll call and a schedule of fiscal year 2026 budget hearings for the Department of Health and Mental Hygiene. The agenda listed hearings on mental health and public health but recorded no motions, approvals, or votes. No substantive actions were decided.

Council Chambers - City Hall Jointly with the Committee on Mental Health, Disabilities and Addiction and the Committee on Finance
Fri May 23, 2025 · 10:00 AM

Committee on Mental Health, Disabilities and Addiction

Committee holds Fiscal Year 2026 executive budget hearings

The Committee on Mental Health, Disabilities and Addiction is conducting budget hearings for the Fiscal Year 2026 executive budget. The body is reviewing the Department of Health and Mental Hygiene's mental health and public health budgets. These hearings are held jointly with the Committee on Health and the Committee on Finance.

budgetmental-healthpublic-healthdepartment-of-health-and-mental-hygiene
✓ Decided: Committee held oversight hearing; no actions taken

The Committee on Mental Health, Disabilities and Addiction met on May 23, 2025. Members held an oversight hearing on Department of Health and Mental Hygiene topics and scheduled FY 2026 executive budget hearings. No motions were adopted, approved, denied, or tabled during the meeting.

Council Chambers - City Hall Jointly with the Committee on Health and the Committee on Finance
Thu May 22, 2025 · Deferred

Committee on Land Use

Land Use Committee reviews multiple Brooklyn rezoning and Manhattan rail yard proposals

The Committee on Land Use will consider a series of zoning amendment applications. Items include rezoning changes for properties on Empire Boulevard, Kings Highway, 19 Maspeth Avenue, and Neptune Avenue in Brooklyn, as well as special permit and zoning modifications for the Western Rail Yard in Manhattan. The agenda also contains mapping and restrictive declaration updates for the rail yard project.

zoninghousingdevelopmentbrooklynmanhattanrail-yard
250 Broadway - Committee Room, 16th Floor
Thu May 22, 2025 · Deferred

Subcommittee on Zoning and Franchises

Subcommittee reviews Western Rail Yard special permit and multiple Brooklyn rezoning proposals

The Subcommittee on Zoning and Franchises will consider a special permit application for the Western Rail Yard in Manhattan that seeks changes to retail continuity, building heights, setbacks, open spaces, and curb cuts. It will also review several rezoning applications in Brooklyn that propose district changes and the creation of Mandatory Inclusionary Housing areas. Decisions will affect zoning maps, land use designations, and potential housing requirements in the listed neighborhoods.

zoningrezoninginclusionary-housingspecial-permitmanhattanbrooklyn
250 Broadway - Committee Room, 16th Floor
Thu May 22, 2025 · 10:00 AM

Committee on Finance

Committee on Finance to hold Fiscal Year 2026 executive budget hearings

The Committee on Finance and the Committee on Hospitals will conduct joint executive budget hearings for Fiscal Year 2026. The sessions will focus on Health + Hospitals and the public budget.

budgethealth-hospitalsfinance
✓ Decided: Finance Committee held budget hearings, no decisions taken

The New York City Council Committee on Finance met on May 22, 2025. It conducted fiscal year 2026 executive budget hearings covering Health + Hospitals from 10:00 a.m. to 12:30 p.m. and Public matters thereafter. No votes, approvals, or other substantive actions were recorded.

Council Chambers - City Hall Jointly with the Committee on Hospitals.
Thu May 22, 2025 · 10:00 AM

Committee on Hospitals

Executive budget hearings for Health + Hospitals and public input

The Committee on Hospitals will hold FY 2026 executive budget hearings. The Health + Hospitals portion runs from 10:00 a.m. to 12:30 p.m., followed by a public hearing at 12:30 p.m. The session is conducted jointly with the Committee on Finance.

budgethealthhospitalsfinancecity-council
✓ Decided: Committee held FY 2026 health budget hearing, no decisions made

The Committee on Hospitals met with the Committee on Finance to hold a fiscal year 2026 executive budget hearing on health and hospitals. No actions, approvals, or denials were recorded; the meeting was procedural.

Council Chambers - City Hall Jointly with the Committee on Finance
Wed May 21, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearings

The Committee on Finance is conducting executive budget hearings for Fiscal Year 2026. The body will review budgets for Libraries and the Department of Cultural Affairs.

budgetlibrariescultural-affairsfinance
✓ Decided: Committee held FY2026 budget hearings for libraries and cultural affairs

The Finance Committee, together with the Cultural Affairs, Libraries and International Intergroup Relations Committee, conducted oversight hearings on the 2026 executive budget. Hearings covered the Libraries budget from 10:00 a.m. to 12:00 p.m. and the Department of Cultural Affairs budget from 12:00 p.m. to 2:00 p.m. No motions, votes, or formal decisions were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Cultural Affairs, Libraries and International Intergroup Relations.
Wed May 21, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council committee holds FY 2026 executive budget hearings

The Committee on Cultural Affairs, Libraries and International Intergroup Relations is conducting budget hearings for Fiscal Year 2026. The committee will review funding for Libraries and the Department of Cultural Affairs jointly with the Committee on Finance.

budgetlibrariescultural-affairsfinance
✓ Decided: Committee held oversight hearing and scheduled FY 2026 budget hearings

The Cultural Affairs, Libraries and International Intergroup Relations Committee conducted an oversight hearing and set the schedule for FY 2026 executive budget hearings for Libraries and the Department of Cultural Affairs. No substantive motions, approvals, or denials were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 20, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee will preconsider two One45 Lenox zoning amendment applications in Harlem

The Subcommittee on Zoning and Franchises will preconsider two applications submitted by One45 Lenox LLC. Application T2025-3588 proposes amending the Zoning Map to replace portions of an R7-2 district with C4-6 districts and to replace a C8-3 district with a C4-6 district in Manhattan Community District 10, Council District 9. Application T2025-3589 proposes amending the Zoning Resolution, specifically modifying Appendix F to create a Mandatory Inclusionary Housing area in the same district.

zoninghousingmandatory-inclusionary-housingmanhattancommunity-district-10
✓ Decided: Subcommittee heard two One45 Harlem zoning applications, no decisions made

The Subcommittee on Zoning and Franchises held a hearing on application LU 0294-2025 and a hearing on application LU 0295-2025, both submitted by One45 Lenox LLC. No approvals, denials, or votes were recorded for either application. The items were simply heard and laid over by the committee.

250 Broadway - Committee Room, 16th Floor
Tue May 20, 2025 · 10:00 AM

Committee on Education

NYC Education Committee holds FY 2026 budget hearing

The Committee on Education will conduct executive budget hearings for Fiscal Year 2026. The Department of Education budget will be reviewed from 10:00 a.m. to 2:00 p.m., followed by a public hearing from 2:00 p.m. The session is held jointly with the Committee on Finance.

budgeteducationfinancecity-council
✓ Decided: Education Committee held FY2026 budget hearing, no actions taken

The Committee on Education met on May 20, 2025, jointly with the Committee on Finance. The meeting consisted of a fiscal year 2026 executive budget hearing for the Department of Education, scheduled from 10:00 a.m. to 2:00 p.m. No votes, approvals, or other substantive decisions were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 20, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearing for Department of Education

The Committee on Finance and the Committee on Education are jointly conducting a budget hearing. The session focuses on the Department of Education's Fiscal Year 2026 executive budget.

budgeteducationfinance
✓ Decided: No substantive decisions were made at the Finance Committee meeting

The Committee on Finance held a roll call and scheduled FY 2026 executive budget hearings with the Department of Education, jointly with the Committee on Education. No actions were approved, denied, or tabled during this meeting.

Council Chambers - City Hall Jointly with the Committee on Education.
Mon May 19, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearings

The Committee on Finance is conducting budget hearings for Fiscal Year 2026. The body will review the budgets for the Administration for Children's Services and the Department of Youth and Community Development.

budgetfinancechildren-servicesyouth-development
✓ Decided: Finance Committee held FY 2026 budget hearings for children's services

The Committee on Finance, together with the Committee on Children and Youth, conducted hearings on the FY 2026 executive budget for Administration for Children’s Services and the Department of Youth and Community Development. No votes or formal approvals were recorded; the meeting was procedural.

Council Chambers - City Hall Jointly with the Committee on Children and Youth.
Mon May 19, 2025 · 10:00 AM

Committee on Children and Youth

FY 2026 executive budget hearings for children's services and youth department

The Committee on Children and Youth will hold executive budget hearings for fiscal year 2026. The hearings cover the Administration for Children’s Services from 10:00 a.m. to 12:00 p.m. and the Department of Youth and Community Development from 12:00 p.m. to 2:00 p.m. A public hearing follows at 2:00 p.m. The session is conducted jointly with the Committee on Finance.

budgetchildren-servicesyouth-developmentfinancecity-council
✓ Decided: No substantive actions; meeting covered hearing schedule and filings

The committee conducted a roll call and set FY 2026 budget hearing times for Administration for Children's Services (10:00 a.m.–12:00 p.m.) and the Department of Youth and Community Development (12:00 p.m.–2:00 p.m.). Attachments and oversight filings were recorded. No policy approvals, denials, or votes were made.

Council Chambers - City Hall Jointly with the Committee on Finance
Fri May 16, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearings

The Committee on Finance and the Committee on General Welfare are conducting joint hearings regarding the Fiscal Year 2026 executive budget. The session focuses on the Department of Homeless Services and the Human Resources Administration.

budgethomeless-serviceshuman-resources-administrationfinance
✓ Decided: Finance Committee held oversight hearing on homeless services and HR

The Committee on Finance met on May 16, 2025, with Chair Justin L. Brannan and members present. The committee conducted an oversight hearing concerning the Department of Homeless Services and the Human Resources Administration. The hearing was filed by the committee, and no votes, approvals, or other substantive actions were recorded.

Council Chambers - City Hall Jointly with the Committee on General Welfare.
Fri May 16, 2025 · 10:00 AM

Committee on General Welfare

Committee on General Welfare to hold FY 2026 budget hearings

The Committee on General Welfare and the Committee on Finance will conduct joint executive budget hearings for Fiscal Year 2026. The session focuses on the Department of Homeless Services and the Human Resources Administration.

budgethomeless-serviceshuman-resources-administrationfiscal-year-2026
✓ Decided: Committee held FY 2026 budget hearings for Homeless Services and HR

The General Welfare Committee, meeting jointly with the Finance Committee, conducted an oversight hearing on the FY 2026 executive budget for the Department of Homeless Services and the Human Resources Administration. No motions, approvals, or votes were recorded during the session. The meeting consisted of a roll call and scheduling of the budget hearings.

Council Chambers - City Hall Jointly with the Committee on Finance
Thu May 15, 2025 · 12:00 PM

Committee on Governmental Operations, State & Federal Legislation

City Council holds FY 2026 executive budget hearing for Campaign Finance Board

The Committee on Governmental Operations, State & Federal Legislation is conducting a budget hearing for the Campaign Finance Board. This session is held jointly with the Committee on Finance to review the Fiscal Year 2026 executive budget.

budgetcampaign-financegovernment-operations
✓ Decided: Committee held budget hearing; no actions taken

The Committee on Governmental Operations, State & Federal Legislation met on May 15, 2025. Members conducted a fiscal year 2026 executive budget hearing with the Campaign Finance Board. No votes, approvals, or other decisions were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Thu May 15, 2025 · 10:00 AM

Committee on Finance

Committee on Finance holds FY 2026 executive budget hearings

The Committee on Finance is conducting executive budget hearings for Fiscal Year 2026. The meeting includes reviews of the City University of New York and the Campaign Finance Board.

budgethigher-educationcampaign-financefiscal-year-2026
✓ Decided: Committee held oversight hearing; no decisions were made

The Finance Committee held an oversight hearing jointly with the Higher Education and Governmental Operations committees. Roll call was taken and the committee scheduled fiscal year 2026 executive budget hearings for the City University of New York (10:00 a.m.–12:00 p.m.) and the Campaign Finance Board (12:00 p.m.–2:00 p.m.). No votes or formal actions were recorded.

Council Chambers - City Hall Jointly with the Committee on Higher Education and the Committee on Governmental Operations, State & Federal Legislation.
Thu May 15, 2025 · 10:00 AM

Committee on Higher Education

CUNY FY 2026 budget hearing by Higher Education Committee

The Committee on Higher Education will hold executive budget hearings for the City University of New York. The hearing is part of the FY 2026 budget process. It will be conducted jointly with the Committee on Finance.

higher-educationbudgetcunyfinancecity-council
✓ Decided: Higher Education Committee held budget hearing; no actions taken

The Committee on Higher Education met on May 15, 2025, chaired by Eric Dinowitz with members present. The session featured the FY 2026 executive budget hearing for the City University of New York, conducted jointly with the Committee on Finance. No formal approvals, denials, or other decisions were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Wed May 14, 2025 · 10:00 AM

Committee on Finance

Committee on Finance to hold FY 2026 executive budget hearings

The Committee on Finance is conducting executive budget hearings for Fiscal Year 2026. The session includes reviews of the Housing Preservation and Development and New York City Public Housing Authority budgets.

budgethousingpublic-housing
✓ Decided: No substantive decisions were made at the Finance Committee meeting

The May 14, 2025 Finance Committee meeting consisted of a roll call and a schedule of fiscal year 2026 budget hearings. The committee heard from Housing Preservation and Development, the New York City Public Housing Authority, and a public hearing. No motions were voted on or approved. The meeting was procedural.

Council Chambers - City Hall Jointly with the Committee on Housing and Buildings and the Committee on Public Housing.
Wed May 14, 2025 · 10:00 AM

Committee on Housing and Buildings

City Council Housing & Buildings Committee holds FY2026 executive budget hearing

The Committee on Housing and Buildings will hold an executive budget hearing for Fiscal Year 2026. The hearing focuses on the Housing Preservation and Development budget. It is conducted jointly with the Committee on Finance. No specific decisions are listed in the agenda.

budgethousingfinancecity-councilfiscal-year-2026
✓ Decided: Housing and Buildings Committee held hearing, no actions taken

The Committee on Housing and Buildings met on May 14, 2025 with Chair Pierina Ana Sanchez and members present. The agenda included the FY 2026 executive budget hearings on Housing Preservation and Development and a public hearing. No decisions, approvals, denials, or vote tallies were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Finance
Wed May 14, 2025 · 12:00 PM

Committee on Public Housing

Committee on Public Housing to hold FY 2026 executive budget hearing

The Committee on Public Housing, jointly with the Committee on Finance, will conduct a hearing regarding the New York City Public Housing Authority's Fiscal Year 2026 executive budget.

budgetpublic-housingfinance
✓ Decided: Committee held a budget hearing for NYCHA, no decisions made

The Committee on Public Housing met jointly with the Committee on Finance to hold a hearing on the FY 2026 executive budget for the New York City Housing Authority. No motions, approvals, denials, or tables were recorded. The meeting consisted of roll call and the hearing testimony.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 13, 2025 · 12:00 PM

Committee on Parks and Recreation

Committee on Parks and Recreation holds FY2026 executive budget hearing

The Committee on Parks and Recreation and the Committee on Finance are conducting a joint hearing. The session focuses on the New York City Council Fiscal Year 2026 executive budget for the Department of Parks and Recreation.

budgetparks-and-recreationfinance
✓ Decided: Committee held FY2026 budget hearing; no actions taken

The Parks and Recreation Committee met jointly with the Finance Committee on May 13, 2025 for a fiscal year 2026 executive budget hearing. The meeting consisted of a roll call and a hearing on the Department of Parks and Recreation. No motions, approvals, denials, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 13, 2025 · Deferred

Committee on Land Use

Committee on Land Use meeting scheduled for May 13, 2025

The Committee on Land Use will meet on May 13, 2025. The provided agenda contains only procedural boilerplate and does not list specific items for decision or discussion.

land-usecity-councilnew-york-city
Committee Room - City Hall
Tue May 13, 2025 · Deferred

Subcommittee on Zoning and Franchises

Subcommittee meeting with no agenda items listed

The New York City Council Subcommittee on Zoning and Franchises met on May 13, 2025 at 11:30 AM in City Hall. The agenda provided contains only the meeting header and member list, with no specific items, proposals, or decisions recorded.

zoningfranchisescity-council
Committee Room - City Hall
Tue May 13, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

DOT&I FY 2026 executive budget hearing with Finance Committee

The Transportation and Infrastructure Committee will hold executive budget hearings for the Department of Transportation and Infrastructure for Fiscal Year 2026. The hearings are conducted jointly with the Committee on Finance. The meeting runs from 10:00 a.m. to 12:00 p.m. on May 13, 2025.

budgettransportationinfrastructurefinancecity-council
✓ Decided: Transportation and Infrastructure Committee held FY2026 budget hearing

The Committee on Transportation and Infrastructure met on May 13, 2025. The meeting consisted of a roll call and a hearing on the FY2026 executive budget for the Department of Transportation and Infrastructure, held jointly with the Committee on Finance. No motions were voted on or decisions recorded. The session was procedural in nature.

Council Chambers - City Hall Jointly with the Committee on Finance
Tue May 13, 2025 · 10:00 AM

Committee on Finance

City Council holds hearings on Fiscal Year 2026 executive budget

The Committee on Finance will hold public hearings on the Fiscal Year 2026 executive budget, specifically reviewing the Department of Transportation and Infrastructure and the Department of Parks and Recreation.

budgethearingstransportationparksinfrastructurefinance
✓ Decided: Finance Committee held FY2026 budget hearing, no actions taken

The Committee on Finance convened a hearing on the FY 2026 executive budget. The hearing covered the Department of Transportation and Infrastructure and the Department of Parks and Recreation, with related testimony and transcripts attached. No approvals, denials, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Parks and Recreation and the Committee on Transportation and Infrastructure.
Mon May 12, 2025 · 3:15 PM

Committee on Land Use

Committee to review Atlantic Avenue Mixed-Use Plan and Kings Highway rezoning

The Committee on Land Use is considering a comprehensive mixed-use plan for Atlantic Avenue in Brooklyn, including zoning map amendments and property acquisitions. The body will also review a rezoning application for 166 Kings Highway.

zoninghousingbrooklynland-usereal-estate
✓ Decided: Committee approved eight Atlantic Avenue mixed-use land-use applications with modifications

The Committee on Land Use voted to approve, with modifications and referral to the City Planning Commission, eight land-use applications concerning the Atlantic Avenue mixed-use plan in Brooklyn. All motions passed with seven members voting affirmative, two members absent, and one member recorded as medical. The approved applications involve zoning amendments, property acquisitions, and designations for residential, commercial, and industrial development in Council District 35.

Committee Room - City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
LU 0257-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0258-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0259-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0260-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0261-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0262-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0263-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0264-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0265-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0266-2025 — Approved by Committee with Modifications and Referred to CPC
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0273-2025 — Approved by Committee with Companion Resolution
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0274-2025 — Approved by Committee with Companion Resolution
7 yea · 2 absent · 1 medical
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías absent · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya medical · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
Mon May 12, 2025 · 3:00 PM

Subcommittee on Zoning and Franchises

Subcommittee to review Atlantic Avenue zoning changes

The Subcommittee on Zoning and Franchises will review multiple applications related to the Atlantic Avenue Mixed-Use Plan, including zoning map amendments and the disposition of city-owned properties.

zoninghousingdevelopmentatlantic-avenuebrooklyncity-planninghpd
✓ Decided: Subcommittee approved seven Atlantic Avenue mixed-use applications with modifications

The Subcommittee on Zoning and Franchises reviewed seven land‑use applications for the Atlantic Avenue Mixed‑Use Plan in Brooklyn. Each application was approved by the subcommittee with modifications and referred to the City Planning Commission. All votes were 6‑1, with the six council members voting affirmative and Councilmember Moya voting medical.

Committee Room - City Hall
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
LU 0257-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0258-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0259-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0260-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0261-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0262-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0263-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0264-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0265-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0266-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0273-2025 — Approved by Subcommittee
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0274-2025 — Approved by Subcommittee
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
Mon May 12, 2025 · 12:00 PM

Committee on Aging

Committee on Aging holds FY2026 executive budget hearing

The Committee on Aging and the Committee on Finance are conducting a joint hearing regarding the New York City Council Fiscal Year 2026 executive budget. The session includes a hearing for the Department for the Aging followed by a public comment period.

budgetagingdepartment-for-the-agingfinance
✓ Decided: Committee on Aging held FY2026 budget hearing, no actions taken

The Committee on Aging met on May 12, 2025, with a roll call of members and a joint hearing with the Committee on Finance on the FY2026 executive budget. The hearing covered the Department for the Aging and included testimony and a transcript. No votes or formal decisions were recorded.

Council Chambers - City Hall Jointly with the Committee on Finance
Mon May 12, 2025 · 10:00 AM

Committee on Sanitation and Solid Waste Management

Sanitation Committee holds FY 2026 executive budget hearing

The Committee on Sanitation and Solid Waste Management will hold an executive budget hearing for Fiscal Year 2026. The hearing will focus on the Department of Sanitation's budget and is conducted jointly with the Committee on Finance. The meeting is scheduled for Monday, May 12, 2025, from 10:00 a.m. to 12:00 p.m. in the Council Chambers at City Hall.

budgetsanitationfinancecity-council
✓ Decided: Sanitation Committee held oversight hearing, no decisions taken

The Committee on Sanitation and Solid Waste Management met on May 12, 2025, with Chair Shaun Abreu and the listed members present and absent. The meeting included a joint hearing with the Committee on Finance on the FY 2026 executive budget for the Department of Sanitation. No substantive actions, approvals, or votes were recorded; the session was procedural.

Council Chambers - City Hall Jointly with the Committee on Finance
Mon May 12, 2025 · 10:00 AM

Committee on Finance

Finance Committee holds FY 2026 budget hearings for Sanitation and Aging

The Committee on Finance will conduct executive budget hearings for Fiscal Year 2026. Hearings will cover the Department of Sanitation and the Department for the Aging. A public hearing will follow. The Sanitation hearing is joint with the Committee on Sanitation and Solid Waste Management, and the Aging hearing is joint with the Committee on Aging.

budgetfinancesanitationagingcity-councilhearings
✓ Decided: Finance Committee held FY 2026 budget hearings, no decisions taken

The Committee on Finance met on May 12, 2025, jointly with the Committee on Sanitation and Solid Waste Management and the Committee on Aging. The meeting consisted of roll call and scheduled executive budget hearings for the Department of Sanitation (10:00‑12:00) and the Department for the Aging (12:00‑2:00). No substantive actions, approvals, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Sanitation and Solid Waste Management and the Committee on Aging.
Fri May 9, 2025 · 1:00 PM

Committee on Civil and Human Rights

Committee reviews accessibility compliance and support for small businesses

The Committee on Civil and Human Rights and the Committee on Small Business are holding a joint meeting. The body will conduct oversight on ADA compliance for small businesses and consider three local laws regarding accessibility and worker inclusion.

adaaccessibilitysmall-businesscivil-rightsdisability-rights
✓ Decided: Committee held hearings on accessibility bills and filed a resolution, no votes taken

The Committee on Civil and Human Rights held hearings on several accessibility‑related introductions (Int. 0282‑2024, Int. 0639‑2024, Int. 1260‑2025) and an oversight item (T2025‑3350). It also heard a resolution (Res. 0520‑2024) recognizing Thurgood Marshall Day. No votes were recorded; the items were filed or laid over by the committee.

Council Chambers - City Hall Jointly with the Committee on Small Business.
Fri May 9, 2025 · 1:00 PM

Committee on Small Business

Committee on Small Business reviews accessibility laws for small businesses

The Committee on Small Business is conducting oversight on ADA and local accessibility law compliance. Members will discuss three proposed local laws regarding accessibility requirements, training, and legal assistance for small business tenants.

small-businessaccessibilityadadisability-rightslegal-assistance
✓ Decided: Committee held hearings on accessibility bills and a civil‑rights resolution

The Small Business Committee heard testimony on three proposed accessibility laws (Int 0282‑2024, Int 0639‑2024, Int 1260‑2025) and on a resolution to recognize Thurgood Marshall Day (Res 0520‑2024). No votes or formal approvals were recorded; the items were simply heard and laid over for further action.

Council Chambers - City Hall Jointly with the Committee on Civil and Human Rights
Wed May 7, 2025 · 1:00 PM

Committee on Environmental Protection, Resiliency and Waterfronts

Council committee reviews nature-based climate resiliency and stormwater laws

The Committee on Environmental Protection, Resiliency and Waterfronts will hold an oversight hearing on nature-based solutions for disaster preparedness. The body will also consider legislation regarding bioswale installation notices and stormwater capture metrics.

climate-resiliencystormwaterenvironmentgreen-infrastructureoversight
✓ Decided: Committee held hearings and filed items; no votes recorded

The Environmental Protection, Resiliency and Waterfronts Committee held a hearing on Oversight T2025-3357 and introduced Local Laws Int 1253-2025 and Int 1254-2025. It also considered Resolutions 0131-2024 and 0143-2024. All items were heard and laid over by the committee, but no votes or approvals were recorded.

Council Chambers - City Hall
Tue May 6, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee reviews multiple street‑vending licensing and enforcement bills

The Consumer and Worker Protection Committee will consider several bills that would amend the city charter and administrative code. The measures aim to create a new division in the Department of Small Business Services, update licensing programs, establish an inter‑agency enforcement portal, and create supervisory licenses for mobile food vendors. All items relate to street‑vending regulation and enforcement.

street-vendinglicensingenforcementsmall-business-servicescity-charteradministrative-code
✓ Decided: Committee held hearings and filed street‑vendor legislation introductions

The Consumer and Worker Protection Committee held hearings on four proposed local laws related to street vending and filed the introductions. No votes or final approvals/denials were recorded; the items were simply laid over for further action.

Council Chambers - City Hall
Thu May 1, 2025 · 1:30 PM

City Council Stated Meeting

City Council considers rezoning for Coney Island Avenue and Queens Boulevard

The City Council is reviewing land use applications for two major rezoning projects in Brooklyn and Queens. The body is also considering several local laws regarding food delivery fees, school library reporting, and taxi safety decals.

zoningland-usetransportationeducationappointments
✓ Decided: Council approves three Coney Island Avenue rezoning applications with modifications

The City Council approved three land‑use applications for Coney Island Avenue and Queens Boulevard, each with modifications and referral to the City Planning Commission. The Council also approved three introductions: a food‑delivery fee exemption, a minority‑ and women‑owned business procurement report, and a school‑librarian reporting requirement. All actions were recorded as approved during the May 1, 2025 stated meeting.

Council Chambers - City Hall
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
Int 0762-2024 — Approved by Council
42 yea · 5 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph absent · Shekar Krishnan nay · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino absent · Keith Powers nay · Lincoln Restler nay · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won nay · Susan Zhuang yea
Res 0862-2025 — Approved, by Council
41 yea · 6 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph absent · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino absent · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang nay
Res 0863-2025 — Approved, by Council
41 yea · 6 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph absent · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino absent · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang nay
The other 10 items passed by unanimous or near-unanimous consent.
Thu May 1, 2025 · 11:30 AM

Committee on Consumer and Worker Protection

City Council to consider exempting third‑party food delivery services from fee caps

The Committee on Consumer and Worker Protection will consider Local Law Int. 0762‑2024. The bill would amend the city’s administrative code to create exemptions for third‑party food delivery services from the limits on fees they may charge food service establishments. Council members will vote on the proposal.

food-deliveryconsumer-protectionfeesrestaurantscity-legislation
✓ Decided: Committee approves exemptions for third‑party food delivery fees

The Committee on Consumer and Worker Protection voted to approve Introduction 0762-2024-B, a local law amending the city administrative code to create exemptions for third‑party food delivery services from fee limits. The vote was 5‑1 with one member absent. The amendment was adopted by the committee.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0762-2024 — Approved by Committee
5 yea · 1 nay · 1 absent
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan nay · Chi A. Ossé yea · Julie Won absent
Thu May 1, 2025 · 11:30 AM

Committee on Parks and Recreation

Committee will consider a local law to adopt a wildfire mitigation plan for city parks.

The Committee on Parks and Recreation will consider Int. No. 1185‑A, a local law amendment to the city’s administrative code. The proposal would adopt a strategic planning report aimed at mitigating wildfires in parks managed by the Department of Parks and Recreation. The council will vote on whether to approve the amendment.

parkswildfire-mitigationlegislationenvironmentcity-council
✓ Decided: Committee approves wildfire mitigation law amendment

The Parks and Recreation Committee voted to approve Introduction No. 1185‑A, a local law amending the city’s administrative code to require a wildfire‑mitigation strategic planning report for city parks. The vote was 7‑0 in favor, with one member absent. The amendment now proceeds to the full City Council.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1185-2025 — Approved by Committee
7 yea · 1 absent
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino absent · Sandra Ung yea
Thu May 1, 2025 · 11:15 AM

Committee on Land Use

Land Use Committee will review rezoning and inclusionary housing proposals for two sites

The Committee on Land Use will consider four applications. Two are rezoning requests that would change the zoning map for 2510 Coney Island Avenue in Brooklyn and 102‑51 Queens Boulevard in Queens. Two are amendments to the Zoning Resolution to create Mandatory Inclusionary Housing areas at the same locations. No decisions have been made yet.

zoningland-useinclusionary-housingbrooklynqueensrezoning
✓ Decided: Committee approves four land‑use applications, including 2510 Coney Island Ave rezoning

The Land Use Committee voted unanimously to approve two rezoning applications and two mandatory inclusionary housing applications. The 2510 Coney Island Avenue rezoning and its inclusionary housing amendment were approved with modifications and sent to the City Planning Commission. The 102‑51 Queens Boulevard rezoning and its inclusionary housing amendment were approved with companion resolutions. All votes were 10‑0 in favor.

Committee Room - City Hall VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
LU 0267-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0268-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0269-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0270-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Thu May 1, 2025 · 11:00 AM

Committee on Contracts

Council to consider a law requiring an annual report on minority and women-owned business enterprise procurement

The Committee on Contracts will hold a meeting to discuss a proposed local law that would amend the New York City Charter to require an annual report on minority and women-owned business enterprise (MWBE) procurement. The meeting is scheduled for Thursday, May 1, 2025, at 11:00 AM in Council Chambers at City Hall.

contractsmwbecity-charterlegislationcouncil-meeting
✓ Decided: Committee on Contracts approved Introduction 0023‑2024‑A to amend charter reporting

At the May 1, 2025 Committee on Contracts meeting, Council members Won, Bottcher, Nurse, and Stevens voted to approve Introduction 0023‑2024‑A, a local law amending the city charter concerning the annual report on minority and women‑owned business‑enterprise procurement. The motion passed with four affirmative votes and one member absent. The approval moves the proposal forward for further consideration by the full Council.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0023-2024 — Approved by Committee
4 yea · 1 absent
Julie Won yea · Erik D. Bottcher yea · Sandy Nurse yea · Althea V. Stevens yea · Inna Vernikov absent
Thu May 1, 2025 · 10:30 AM

Committee on Transportation and Infrastructure

Committee considers decal requirement for taxis and for-hire vehicles

The Committee on Transportation and Infrastructure is meeting to discuss Int 0193-2024. This proposed local law would require taxis and for-hire vehicles to display decals warning passengers to look for cyclists when opening doors.

transportationtaxiscycling-safetypublic-safety
✓ Decided: Committee approves decal law for taxis to warn passengers about cyclists

The Transportation and Infrastructure Committee voted to approve Introduction 0193-2024-A, a local law that requires taxis and for‑hire vehicles to display a decal warning passengers to look for cyclists when opening the door. All nine committee members voted affirmative, resulting in a unanimous 9‑0 approval. The amendment was adopted by the committee.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0193-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Thu May 1, 2025 · 10:00 AM

Committee on Health

Health Committee considers resolutions on fertility treatment and medical cost caps

The Committee on Health is meeting to discuss two resolutions calling on the New York State Legislature and Governor to sign specific bills. These include the Equity in Fertility Treatment Act and a proposal to cap costs for routine medical procedures.

healthfertility-treatmentmedical-costsstate-legislation
✓ Decided: Committee approves two health resolutions, including fertility equity act

The Health Committee approved Resolution 0165-2024-B urging the state legislature and governor to pass the Equity in Fertility Treatment Act (S.5545/A.885) with a 7‑0 vote among members present. The committee also approved Resolution 0822-2025-A calling for a cap on routine medical procedure costs at 150% of Medicare rates (S.705/A.2140) with a 6‑1 vote. Both resolutions were adopted despite two members being absent.

Committee Room - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0822-2025 — Approved by Committee
6 yea · 2 absent · 1 nay
Lynn C. Schulman yea · Joann Ariola absent · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato nay · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
The other 1 item passed by unanimous or near-unanimous consent.
Thu May 1, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council to designate May 10 as Judith Jamison Day

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will consider two resolutions. Resolution 0741-2025 would designate May 10 annually as Judith Jamison Day to honor the dancer and artistic director of the Alvin Ailey American Dance Theater. Resolution 0844-2025 would recognize May 10 annually as Chinese American Railroad Workers Memorial Day. No other items are on the agenda.

cultural-affairscommemorationsholidays
✓ Decided: Committee approves two May 10 heritage resolutions

The Committee on Cultural Affairs, Libraries and International Intergroup Relations approved Resolution 0741‑2025, designating May 10 annually as Judith Jamison Day, and Resolution 0844‑2025, recognizing May 10 annually as Chinese American Railroad Workers Memorial Day. Both motions were approved by roll‑call with eight members voting affirmative and one member recorded as medical.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0741-2025 — Approved by Committee
8 yea · 1 medical
Carlina Rivera yea · David M. Carr yea · Shahana K. Hanif medical · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams yea
Res 0844-2025 — Approved by Committee
8 yea · 1 medical
Carlina Rivera yea · David M. Carr yea · Shahana K. Hanif medical · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams yea
Thu May 1, 2025 · 9:00 AM

Committee on Education

Committee to consider reporting requirements for school librarians

The Committee on Education is meeting to discuss Int 1125-2024. This proposed local law would require the Department of Education to report on school librarians and library access in New York City public schools.

educationlibrariesreportingpublic-schools
✓ Decided: Education Committee approves local law on school librarian reporting

The Committee on Education approved Introduction 1125-2024-A, a local law amendment that requires the Department of Education to report on school librarians and library access in New York City public schools. The approval was recorded with affirmative votes from all members except Councilmember James F. Gennaro, who was absent. No other actions were taken.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1125-2024 — Approved by Committee
12 yea · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro absent · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Wed Apr 30, 2025 · Deferred

Committee on Environmental Protection, Resiliency and Waterfronts

Int 1254-2025: Local Law to create a greened‑acre metric for stormwater capture

The Committee on Environmental Protection, Resiliency and Waterfronts will review several resolutions and legislative proposals. Items include a resolution urging the state to adopt the New York Deforestation‑Free Procurement Act, a resolution recognizing the federal Endangered Species Act, and two local law proposals to set a greened‑acre metric for stormwater capture and to require notice for bioswale and rain‑garden installations. The meeting also includes oversight of nature‑based solutions for climate resiliency and disaster preparedness.

environmentclimate-resiliencegreen-infrastructurelegislationdeforestationendangered-species
Committee Room - City Hall
Wed Apr 30, 2025 · Deferred

Committee on Land Use

Rezoning 2510 Coney Island Avenue from R4 to R7D with new C2-4 district

The Land Use Committee will consider four applications to amend the city’s zoning. Two applications (LU 0267-2025 and LU 0269-2025) propose rezoning of 2510 Coney Island Avenue in Brooklyn and 102-51 Queens Boulevard in Queens, changing the districts and adding new C2-4 districts. Two additional applications (LU 0268-2025 and LU 0270-2025) seek to modify Appendix F of the Zoning Resolution to create Mandatory Inclusionary Housing areas at the same sites.

zoningrezoningmandatory-inclusionary-housingbrooklynqueens
250 Broadway - Committee Room, 16th Floor
Wed Apr 30, 2025 · 10:45 AM

Subcommittee on Zoning and Franchises

Council subcommittee to consider rezoning and housing amendment for 102-51 Queens Blvd

The Subcommittee on Zoning and Franchises will review two applications submitted by QBM Properties, LLC. Application LU 0269-2025 proposes rezoning 102-51 Queens Boulevard, changing an R7-1 district to an R8X district and creating C1-2 and C2-4 districts. Application LU 0270-2025 seeks to amend Appendix F of the Zoning Resolution to establish a Mandatory Inclusionary Housing area at the same site.

zoninghousingrezoninginclusionary-housingqueenscity-council
✓ Decided: Subcommittee approves two Queens Boulevard zoning applications

The Subcommittee on Zoning and Franchises approved application LU 0269-2025 to amend the zoning map, changing an R7-1 district to R8X and creating C1-2 and C2-4 districts in Queens. It also approved application LU 0270-2025 to amend the zoning resolution and establish a Mandatory Inclusionary Housing area in Queens. Both motions passed by roll‑call vote with six members voting affirmative and one member absent.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0269-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam absent · Lynn C. Schulman yea
LU 0270-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam absent · Lynn C. Schulman yea
Wed Apr 30, 2025 · 10:00 AM

Committee on Contracts

City Council to examine late payments to human service providers

The Committee on Contracts will hold an oversight hearing regarding late payments to human service providers. The committee will also consider three local laws related to the city charter and administrative code concerning contract disbursement and a new department of contract services.

contractsoversighthuman-serviceslegislationcharternon-profits
✓ Decided: Committee on Contracts held oversight hearings, no decisions made

The Committee on Contracts met on April 30, 2025, with Chair Julie Won and members Bottcher, Nurse, Stevens, and Vernikov (absent). The committee held oversight hearings and introductions for items Int 1247-2025, Int 1248-2025, and Int 1249-2025. No approvals, denials, or votes were recorded for any of these items.

Council Chambers - City Hall Jointly with the Committee on Children and Youth.
Wed Apr 30, 2025 · 10:00 AM

Committee on Children and Youth

Committee reviews late payments to human service providers and three contract laws

The Committee on Children and Youth will hold an oversight hearing on late payments to human service providers (item T2025-3419). It will consider Local Law 1247‑2025 to amend the city charter to require immediate disbursement of a percentage of awards to nonprofit organizations upon registration by the comptroller. It will consider Local Law 1248‑2025 to amend the charter to create a Department of Contract Services. It will consider Local Law 1249‑2025 to amend the administrative code to require agency corrective action plans for retroactive contract registration, in a joint meeting with the Committee on Contracts.

children-youthoversightcontractslocal-lawchartercity-council
✓ Decided: Committee held hearings on three contract‑related introductions and filed oversight

The Committee on Children and Youth conducted a hearing on Oversight T2025-3419 concerning late payments to human service providers. It also held hearings on three local law introductions (Int 1247‑2025, Int 1248‑2025, Int 1249‑2025) related to contract disbursements, a department of contract services, and corrective action plans. No votes or approvals were recorded; the items were filed and laid over by the committee.

Council Chambers - City Hall Jointly with the Committee on Contracts
Tue Apr 29, 2025 · 1:00 PM

Committee on Higher Education

Committee will consider removing small financial barriers for CUNY students

The City Council Committee on Higher Education will meet on April 29, 2025 to discuss oversight item T2025-3338, which focuses on removing small financial barriers for City University of New York (CUNY) students. The committee will review the proposal and consider any actions needed.

higher-educationeducationfinancestudent-aidoversight
✓ Decided: Committee held hearing on removing small financial barriers for CUNY students

The Higher Education Committee convened a hearing on oversight item T2025-3338, which addresses removing small financial barriers for CUNY students. No vote tally or formal approval was recorded; the item was subsequently filed by the committee.

Committee Room - City Hall
Tue Apr 29, 2025 · 10:00 AM

Committee on Housing and Buildings

Council will consider reforming NYC’s affordable housing lottery via Housing Connect.

The Committee on Housing and Buildings will hold oversight of Housing Connect and consider reforms to the city’s affordable‑housing lottery. It will also consider several local law proposals: Int 1207‑2025 to allow apprenticeship time to count toward boiler operator licensing, Int 1264‑2025 to change how vacant affordable units are rented through the housing portal, Int 1265‑2025 to set notification procedures for housing portal applications and designate a representative, and Int 1266‑2025 to require the Department of Housing Preservation and Development to create an in‑person assistance program for the housing portal.

housingaffordable-housinglicensinghousing-portaloversight
✓ Decided: Committee held hearings and laid over multiple housing introductions

The Committee on Housing and Buildings held an oversight hearing on T2025-3336 concerning the Affordable Housing Lottery. The committee also held hearings on four local law introductions—Int 1207-2025, Int 1264-2025, Int 1265-2025, and Int 1266-2025. Each of these introductions was laid over by the committee, meaning no action was taken. No vote tallies were recorded.

250 Broadway - Committee Room, 16th Floor
Tue Apr 29, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Rezoning of 2510 Coney Island Avenue from R4 to R7D district

The Subcommittee on Zoning and Franchises will consider several zoning map amendment applications. Items include a rezoning of 2510 Coney Island Avenue in Brooklyn from an R4 to an R7D district and the creation of a C2‑4 district, along with a Mandatory Inclusionary Housing amendment for the same site. Additional proposals cover a rezoning of 102‑51 Queens Boulevard from R7‑1 to R8X with related district changes, and multiple special‑permit and inclusionary‑housing amendments for the Western Rail Yard in Manhattan.

zoninginclusionary-housingrezoningbrooklynqueensmanhattan
✓ Decided: Subcommittee approved rezoning of 2510 Coney Island Ave and a housing inclusion area

The Zoning and Franchises Subcommittee voted to approve, with modifications, the rezoning application LU 0267‑2025 for 2510 Coney Island Avenue, changing the district from R4 to R7D and creating a C2‑4 district, and referred it to the City Planning Commission. The subcommittee also approved, with modifications, the mandatory inclusionary housing amendment LU 0268‑2025 for the same site and referred it to the City Planning Commission. A third application, LU 0269‑2025 rezoning of 102‑51 Queens Boulevard, was likewise approved with modifications and sent to the City Planning Commission. Five other applications (LU 0270‑2025, LU 0283‑2025, LU 0284‑2025, LU 0285‑2025) were laid over by the subcommittee without a vote.

Council Chambers - City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0267-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
LU 0268-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 medical
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya medical · Yusef Salaam yea · Lynn C. Schulman yea
Tue Apr 29, 2025 · 10:00 AM

Committee on Technology

Committee to review NYC internet access plans and laws

The Committee on Technology will meet to oversee the city's plan to connect all New Yorkers to internet. The agenda includes several proposed local laws regarding reporting on discounted internet service, improving outreach, and establishing a website for cable franchise agreements.

technologyinternetbroadbandcounciloversightpublic-accesscharter
✓ Decided: Committee held hearings on several internet‑related local law introductions

The Technology Committee heard introductions for six local law proposals concerning discounted internet service reporting, affordable internet programs, public wireless access, student internet information, a cable franchise website, and broadband home access. Each introduction was either heard or laid over by the committee. No votes or approvals were recorded.

Committee Room - City Hall
Mon Apr 28, 2025 · 10:00 AM

Committee on Public Safety

NYC Council considers VIN-based violation notices and speed‑assist devices

The Committee on Public Safety will review two resolutions urging the New York State Legislature to amend vehicle and traffic law to allow a VIN in a Notice of Violation, and to require intelligent speed assistance devices for repeated speed‑limit violations. It will also consider two local law proposals to amend the city administrative code regarding police tow‑pound capacity and police parking enforcement, plus an oversight item on NYPD parking and traffic enforcement.

public-safetypolicetrafficlegislationparkingvehicle-identificationspeed-assistance
✓ Decided: Public Safety Committee held hearings and filed items, no decisions made

The Committee on Public Safety held a hearing on Oversight T2025-3294 and filed the item. It also held hearings and laid over introductions Int 0179-2024 and Int 1252-2025 concerning police department tow‑pound capacity and parking enforcement. Resolutions 0853-2025 and 0854-2025 urging state legislation on VIN notices and intelligent speed devices were heard and laid over. No approvals, denials, or votes were recorded.

Council Chambers - City Hall
Mon Apr 28, 2025 · 10:00 AM

Committee on Rules, Privileges and Elections

Council will consider multiple mayoral appointments to city commissions

The Committee on Rules, Privileges and Elections will consider several mayoral submissions for advice and consent, including appointments to the Board of Correction, the Landmarks Preservation Commission, and the Tax Commission. Resolutions will approve Helen Skipper and Dr. Robert Cohen as members of the Board of Correction. The Mayor’s communications propose Stephen Chu, Angie Master, Stephen Wilder, Erasmus Ikpemgbe, and Frank Mahan for the Landmarks Preservation Commission, and Robert J. Firestone as president of the New York City Tax Commission. All items are listed as pre‑considered.

appointmentsboard-of-correctionlandmarks-preservationtax-commissioncity-council
✓ Decided: Council approves two Board of Correction appointments, postpones six mayoral nominations

The Rules, Privileges and Elections Committee approved Res. 0862-2025 appointing Helen Skipper and Res. 0863-2025 appointing Dr. Robert Cohen to the New York City Board of Correction, each by a 9‑0 vote. The committee laid over six mayor‑submitted nominations for the Landmarks Preservation Commission and the Tax Commission, postponing further action.

Committee Room - City Hall
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0862-2025 — P-C Item Approved by Comm
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams absent · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Res 0863-2025 — P-C Item Approved by Comm
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams absent · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Mon Apr 28, 2025 · 1:00 PM

Committee on Veterans

Council committee will oversee implementation of Report Card Initiative recommendations.

The Committee on Veterans will review the City Council’s Report Card Initiative recommendations. Members will discuss how to implement those recommendations. No other agenda items are listed.

veteransoversightreport-cardcity-council
✓ Decided: Committee held oversight hearing on T2025-3226, no actions taken

The Veterans Committee convened a hearing on oversight item T2025-3226, which addresses implementing recommendations from the City Council’s Report Card Initiative. The hearing was conducted and the matter was filed by the committee. No votes, approvals, or other substantive decisions were recorded.

250 Broadway - Committee Room, 16th Floor
Thu Apr 24, 2025 · 1:30 PM

City Council Stated Meeting

City Council to review Western Rail Yard zoning and Brownsville land use

The City Council is considering several local laws regarding gender identity resources, helicopter noise regulation, and stormwater planning. The body is also reviewing land use applications for the Western Rail Yard in Manhattan and property dispositions in Brownsville, Brooklyn.

zoningland-useenvironmentgender-equitytransportationbudget
✓ Decided: Council approves review of Western Rail Yard modifications

The City Council adopted a land‑use call‑up requiring review of the City Planning Commission’s actions on the Western Rail Yard modification applications. Several local‑law introductions were also approved, some by roll call and others by consent. A resolution designating funding for certain organizations was adopted. All actions were recorded with the indicated vote counts.

Council Chambers - City Hall
🗳️ How they voted — 8 divided votes
Named votes as recorded in the official record.
M 0121-2025 — Approved, by Council
46 yea · 2 absent · 1 medical · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov absent · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0026-2024 — Approved by Council
46 yea · 1 absent · 1 abstain · 1 medical · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 0246-2024 — Approved by Council
41 yea · 5 nay · 2 abstain · 1 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy abstain · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
SLR 0001-2025 — Approved, by Council
41 yea · 5 abstain · 2 nay · 1 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy nay · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse abstain · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1200-2025 — Approved by Council
45 yea · 2 nay · 1 absent · 1 abstain · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1201-2025 — Approved by Council
41 yea · 5 nay · 2 abstain · 1 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy abstain · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1203-2025 — Approved by Council
41 yea · 5 nay · 2 abstain · 1 absent · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy abstain · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Int 1204-2025 — Approved by Council
42 yea · 5 nay · 1 absent · 1 abstain · 1 medical
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr absent · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Simcha Felder abstain · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 15 items passed by unanimous or near-unanimous consent.
Thu Apr 24, 2025 · 11:30 AM

Committee on Civil Service and Labor

Committee to consider resolution on industrial laundry contracting standards

The Committee on Civil Service and Labor will meet to discuss a resolution regarding healthcare institution contracts. The proposal focuses on industrial laundry companies' adherence to wage, benefit, and legal rights standards.

laborhealthcarecontractswages
✓ Decided: Committee approves resolution urging hospitals to use fair‑pay laundry firms

The Committee on Civil Service and Labor approved Resolution 0598-2024, which calls on New York City health care institutions to contract with industrial laundry companies that respect workers’ legal rights and meet area standards for wages and benefits. The vote was eight affirmative votes with one member recorded as medical and no negative votes. The resolution was adopted by the committee.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0598-2024 — Approved by Committee
8 yea · 1 medical
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks medical · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Thu Apr 24, 2025 · 11:30 AM

Committee on Governmental Operations, State & Federal Legislation

Resolution urging state to pass bills to discontinue parkland in Flushing Meadows

The Committee on Governmental Operations will consider two proposed local laws amending the New York City charter—one to add an “X” gender option on certain agency forms and another addressing communications in adjudicative proceedings by public servants. It will also preconsider a state legislation resolution urging the New York State Legislature to enact bills S.7121‑A and A.6781‑B that would authorize the discontinuance of parkland in Flushing Meadows‑Corona Park, Queens.

gender-identitycharter-amendmentparklandstate-legislationcity-council
✓ Decided: Committee approves gender‑option charter amendment and two other measures

The Committee on Governmental Operations approved a Local Law amending the city charter to require an “X” gender option on certain agency forms (6‑2 vote, 1 absent). It also approved a charter amendment on communications in adjudicative proceedings (unanimous 8‑0, 1 absent) and a State Legislation Resolution urging the state to discontinue parkland in Flushing Meadows‑Corona Park (unanimous 8‑0, 1 absent).

Council Chambers - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0246-2024 — Approved by Committee
6 yea · 2 nay · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr absent · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
The other 2 items passed by unanimous or near-unanimous consent.
Thu Apr 24, 2025 · 11:00 AM

Committee on Women and Gender Equity

Committee considers laws and resolutions on gender-affirming and reproductive health care

The Committee on Women and Gender Equity is discussing four proposed local laws and four resolutions. These items focus on health care access, data privacy for sensitive health information, and support services for transgender and non-binary individuals.

gender-equityhealth-carereproductive-rightslgbtq-rightsprivacymigrants
✓ Decided: Committee approves three gender‑identity related local law introductions

The Committee on Women and Gender Equity approved three introductions by roll call: Int 1200‑2025‑A on publicly available gender‑identity rights information, Int 1201‑2025‑A on a cause of action for interference with reproductive or gender‑affirming health care, and Int 1203‑2025‑A requiring an assessment and plan for transgender, non‑binary, and intersex migrants. Each vote was 4‑1, with Councilmembers Louis, Cabán, Gutiérrez, and Riley affirmative and Vernikov negative. No other substantive actions were recorded.

Committee Room - City Hall VOTE*
🗳️ How they voted — 8 divided votes
Named votes as recorded in the official record.
Int 1200-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Int 1201-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Int 1203-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Int 1204-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Res 0771-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Res 0774-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Res 0781-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Res 0793-2025 — Approved by Committee
4 yea · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Inna Vernikov nay
Thu Apr 24, 2025 · 11:00 AM

Committee on Environmental Protection, Resiliency and Waterfronts

Committee considers stormwater planning and water infrastructure funding

The Committee on Environmental Protection, Resiliency and Waterfronts will discuss a local law regarding a comprehensive stormwater plan and dashboard. The body will also consider resolutions regarding the allocation of grants and loans for lead service line replacement and water infrastructure upgrades.

stormwaterwater-infrastructureenvironmentfundinglead-pipes
✓ Decided: Committee approves stormwater plan law and two funding resolutions

The Environmental Protection, Resiliency and Waterfronts Committee approved a local law to create a comprehensive stormwater plan and dashboard (Int 1150-2024-A). It also approved two resolutions: one urging state agencies to allocate lead service line replacement funds (Res 0008-2024) and another urging removal of barriers to water infrastructure funding (Res 0144-2024). Each item passed with eight affirmative votes and one member absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1150-2024 — Approved by Committee
8 yea · 1 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang yea
Res 0008-2024 — Approved by Committee
8 yea · 1 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang yea
Res 0144-2024 — Approved by Committee
8 yea · 1 absent
James F. Gennaro yea · Alexa Avilés yea · Justin L. Brannan absent · Robert F. Holden yea · Kristy Marmorato yea · Sandy Nurse yea · Lincoln Restler yea · Rafael Salamanca, Jr. yea · Susan Zhuang yea
Thu Apr 24, 2025 · 10:30 AM

Committee on Economic Development

Committee considers laws and resolutions to restrict helicopter operations

The Committee on Economic Development is reviewing proposals to regulate helicopter noise and flight operations. The body is also discussing reporting requirements for contracted entities regarding community hiring and benefits.

helicoptersnoise-reductioncommunity-benefitshiringaviation
✓ Decided: Committee approved new helicopter noise law and related measures

The Economic Development Committee approved Local Law Int 0026‑2024‑A to regulate helicopter operations at city‑owned heliports, voting 6‑1. It also approved Local Laws Int 0860‑2024‑A and Int 0861‑2024‑A, each with a 7‑0 vote, requiring contracted entities to publish annual reports on community hiring and community‑benefit agreements. Additionally, the committee adopted Resolution 0085‑2024‑A calling for a state noise tax on non‑essential helicopter and seaplane flights, voting 6‑1. All approvals were recorded with their respective enactment numbers.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Int 0026-2024 — Approved by Committee
6 yea · 1 nay
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov nay
Res 0085-2024 — Approved by Committee
6 yea · 1 nay
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov nay
Res 0226-2024 — Approved by Committee
6 yea · 1 nay
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov nay
Res 0233-2024 — Approved by Committee
6 yea · 1 nay
Amanda C. Farías yea · Alexa Avilés yea · Erik D. Bottcher yea · Jennifer Gutiérrez yea · Kevin C. Riley yea · Rafael Salamanca, Jr. yea · Inna Vernikov nay
The other 2 items passed by unanimous or near-unanimous consent.
Thu Apr 24, 2025 · 10:00 AM

Committee on Finance

Finance Committee considers East Harlem BID and budget process changes

The Committee on Finance is meeting to discuss several local laws and resolutions. Key items include the establishment of a business improvement district and changes to the executive budget process.

budgetreal-estatebusiness-improvement-districttax-exemptionsfinance
✓ Decided: Committee on Finance approves three local law amendments and two resolutions

The Finance Committee approved three Local Law introductions that amend the city’s administrative code and charter: Int 0889‑2024‑A, Int 1086‑2024‑A, and Int 1234‑2025‑A. It also approved two resolutions, Res 0327‑2024 urging state legislation on tax‑exemption retroactivity and Res 0849‑2025 designating funding for certain organizations. All approvals were recorded with 13 members voting affirmative, three absent, and one member on medical leave.

Committee Room - City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0889-2024 — Approved by Committee
13 yea · 3 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks medical · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Int 1086-2024 — Approved by Committee
13 yea · 3 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks medical · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Int 1234-2025 — Approved by Committee
13 yea · 3 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks medical · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Res 0327-2024 — Approved by Committee
13 yea · 3 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks medical · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Res 0849-2025 — P-C Item Approved by Comm
13 yea · 3 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr absent · Amanda C. Farías yea · Kamillah Hanks medical · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Wed Apr 23, 2025 · Deferred

Committee on Veterans

Committee on Veterans to review Report Card Initiative recommendations

The Committee on Veterans will meet to conduct oversight regarding the implementation of recommendations from the City Council’s Report Card Initiative.

veteransoversightcity-council
Council Chambers - City Hall
Wed Apr 23, 2025 · 1:00 PM

Committee on Parks and Recreation

Committee to consider expanding school playground access and park drinking fountains

The Parks and Recreation Committee will review three local law proposals. One would amend the city’s administrative code to create an annual plan for expanding access to school playgrounds. Another would amend the code to increase the number of drinking fountains near public parks and greenstreets. A third proposal outlines a plan to identify and facilitate the use of indoor facilities for basketball games.

parksrecreationplaygroundsdrinking-fountainsbasketballlocal-law
✓ Decided: Committee held hearings on park proposals but took no action

The Parks and Recreation Committee held a hearing on Oversight item T2025-3289 to improve access to athletic fields and playgrounds. It also heard introductions for Local Laws Int 0566-2024, Int 0573-2024, and Int 0643-2024 concerning school playground access, drinking fountains, and indoor basketball facilities. No votes, approvals, or rejections were recorded; the items were filed or laid over by the committee.

Committee Room - City Hall
Wed Apr 23, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee reviews Dining Out NYC program and towing‑vehicle local law

The New York City Council Committee on Consumer and Worker Protection will hold oversight of the Dining Out NYC program (item T2025-3180). It will also consider Int. No. 857‑A, a proposed local law to amend the administrative code regarding towing vehicles that block the street, in partnership with the Committee on Transportation and Infrastructure.

consumer-protectionworker-protectiontowinglocal-lawtransportationoversight
✓ Decided: Committee held hearings and filed items; no decisions taken

The Committee on Consumer and Worker Protection held a hearing on oversight item T2025-3180 for the Dining Out NYC program and on Introduction No. 857-A concerning towing vehicles that block streets. Both items were filed and the introduction was laid over by the committee. No votes, approvals, or denials were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Transportation and Infrastructure.
Wed Apr 23, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Subcommittee preconsiders several Brooklyn rezoning applications

The Subcommittee on Zoning and Franchises will preconsider eight rezoning applications submitted by private developers. The proposals involve changes to existing zoning districts and the creation of Mandatory Inclusionary Housing areas in Brooklyn neighborhoods. No final decisions are indicated; the items are listed as preconsidered.

zoninginclusionary-housingbrooklynrezoningland-use
✓ Decided: Subcommittee held hearings and laid over eight rezoning applications

The Subcommittee on Zoning and Franchises met on April 23, 2025. It held hearings on eight land‑use applications and then laid each over, meaning no approvals or rejections were recorded. No vote tallies were provided in the minutes.

250 Broadway - Committee Room, 16th Floor
Wed Apr 23, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee to review towing laws and Dining Out NYC program

The Committee on Transportation and Infrastructure will hold an oversight hearing on the Dining Out NYC program. The committee will also consider a local law regarding the towing of vehicles that encumber streets.

transportationtowingdining-out-nycinfrastructure
✓ Decided: Transportation committee held hearings on dining program oversight and towing bill

The Committee on Transportation and Infrastructure held an oversight hearing on the Dining Out NYC program (T2025-3181). It reviewed Local Law Int 0857-2024 concerning towing vehicles that block the street and considered the proposed amendment Int 857-A. No votes or formal approvals were recorded in the minutes.

Council Chambers - City Hall Jointly with the Committee on Consumer and Worker Protection
Wed Apr 23, 2025 · 10:00 AM

Committee on Sanitation and Solid Waste Management

Committee reviews oversight of commercial waste zones and two waste‑disposal law amendments

The Sanitation and Solid Waste Management Committee will consider oversight of commercial waste zones (T2025-3220). It will also examine two proposed Local Laws: one to create a tracking system for yellow and brown grease disposal (Int 0784-2024) and another to expand the types of businesses required to manage commercial organic waste (Int 1228-2025). The meeting is scheduled for April 23, 2025 at 10:00 AM in the Committee Room, City Hall.

sanitationwaste-managementcommercial-wasteorganic-wastelocal-law
✓ Decided: Committee filed waste oversight and held hearings on two waste‑tracking bills

The Sanitation and Solid Waste Management Committee filed oversight item T2025-3220 on commercial waste zones. It held a hearing on Introduction 0784-2024 to establish a tracking system for yellow and brown grease. It also held a hearing on Introduction 1228-2025 to expand categories of businesses subject to commercial organic waste disposal requirements. No votes or approvals were recorded.

Committee Room - City Hall
Tue Apr 22, 2025 · Deferred

Committee on Land Use

Council will consider rezoning 2510 Coney Island Avenue from R4 to R7D.

The Committee on Land Use will review four zoning applications. Two applications from 2510 CIA, LLC propose rezoning 2510 Coney Island Avenue and creating a Mandatory Inclusionary Housing area in Brooklyn. Two applications from QBM Properties, LLC propose rezoning 102-51 Queens Boulevard and creating a Mandatory Inclusionary Housing area in Queens.

zoninghousingrezoninginclusionary-housingbrooklynqueens
Committee Room - City Hall
Tue Apr 22, 2025 · Deferred

Subcommittee on Zoning and Franchises

Council subcommittee will consider rezoning 2510 Coney Island Ave and Queens Blvd

The Subcommittee on Zoning and Franchises will review four applications. Two applications from 2510 CIA, LLC propose rezoning 2510 Coney Island Avenue from an R4 to an R7D district and creating a C2-4 district, and also seek to add a Mandatory Inclusionary Housing area in the same location. Two applications from QBM Properties, LLC propose rezoning 102-51 Queens Boulevard from an R7-1 to an R8X district, eliminating a C1-2 district and creating a C2-4 district, and also seek to add a Mandatory Inclusionary Housing area there. Decisions will amend the Zoning Map and the Zoning Resolution as outlined in the applications.

zoninghousingrezoninginclusionary-housingbrooklynqueens
Committee Room - City Hall
Mon Apr 21, 2025 · Deferred

Committee on Civil and Human Rights

Committee reviews small business accessibility and human rights compliance

The Committee on Civil and Human Rights is meeting to conduct oversight on coordination between Small Business Services and the Commission on Human Rights. The body will also consider two proposed laws regarding accessibility and disability inclusion in small businesses.

civil-rightssmall-businessaccessibilitydisability-rightsoversight
Committee Room - City Hall Jointly with the Committee on Small Business.
Mon Apr 21, 2025 · 1:00 PM

Committee on Hospitals

Oversight review of health‑care access for patients with disabilities

The Committee on Hospitals will hold an oversight meeting to evaluate the current state of health‑care access for patients with disabilities. The session is conducted jointly with the Committee on Mental Health, Disabilities and Addiction. No specific actions or decisions are listed beyond the evaluation discussion.

healthcaredisabilitiesoversighthospitalpolicy
✓ Decided: No substantive actions were taken; the committee held an oversight hearing

The Committee on Hospitals met with the Committee on Mental Health, Disabilities and Addiction to conduct an oversight hearing (T2025-3253) evaluating health‑care access for patients with disabilities. No votes, approvals, or denials were recorded. The meeting consisted of roll call and the filing of the oversight document.

Council Chambers - City Hall Jointly with the Committee on Mental Health, Disabilities and Addiction
Mon Apr 21, 2025 · 1:00 PM

Committee on Mental Health, Disabilities and Addiction

Committee will evaluate health‑care access for patients with disabilities

The Committee on Mental Health, Disabilities and Addiction will hold an oversight hearing to assess the current state of health‑care access for patients with disabilities. The session is conducted jointly with the Committee on Hospitals. No other agenda items are listed.

health-caredisabilitiesoversightmental-healthhospitals
✓ Decided: Committee held oversight hearing on health care access for disabled patients

The Committee on Mental Health, Disabilities and Addiction convened a hearing to evaluate the current state of health care access for patients with disabilities (item T2025-3252). No votes or formal decisions were recorded. The hearing and related documents were filed by the committee.

Council Chambers - City Hall Jointly with the Committee on Hospitals.
Mon Apr 21, 2025 · Deferred

Committee on Small Business

Committee on Small Business to discuss small business accessibility laws

The Committee on Small Business is meeting to conduct oversight on coordination between Small Business Services and the Commission on Human Rights. The body will also consider two proposed local laws regarding accessibility in small businesses and workplace inclusion for workers with disabilities.

small-businessaccessibilitydisability-rightshuman-rightsoversight
Committee Room - City Hall Jointly with the Committee on Civil and Human Rights
Mon Apr 21, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee to discuss parking laws and infrastructure

The Committee on Transportation and Infrastructure will hold an oversight meeting on parking infrastructure and the Department of Transportation. The agenda includes three local laws regarding overnight truck parking, parking penalty waivers, and crosswalk safety.

transportationparkinginfrastructuresafetynyc-councillocal-law
✓ Decided: Committee held hearings and filed oversight on several parking proposals

The Transportation and Infrastructure Committee conducted a hearing on the T2025-3146 oversight of parking infrastructure and DOT, and held hearings on three local law introductions concerning curbside overnight truck parking (Int 0099‑2024‑A), automatic waiver of parking penalties (Int 0340‑2024), and crosswalk parking restrictions (Int 1138‑2024). Each introduction was subsequently laid over by the committee. No approvals, denials, or vote tallies were recorded.

Committee Room - City Hall
Thu Apr 17, 2025 · 10:00 AM

Committee on Civil Service and Labor

Local Law to create task force studying gender pay disparity in NYC workforce

The Committee on Civil Service and Labor will consider a local law to establish a task force that will study gender pay disparity and economic self‑sufficiency among the city’s labor force. It will also consider three resolutions: one expressing solidarity with unionization drives and affirming the right to free union elections; one urging the New York State Legislature and governor to pass and sign A.1435, the New York City Teleworking Expansion Act; and one urging the U.S. Congress and president to pass the Living Wage for Musicians Act.

laboruniongender-payteleworkingliving-wageworkforce
✓ Decided: Committee held hearings and laid over several oversight items and resolutions

The Civil Service and Labor Committee conducted hearings on Oversight T2025-3238, Introduction Int 0675-2024, and Resolutions 0066-2024, 0109-2024, and 0368-2024. After each hearing, the committee laid the items over for further consideration. No votes or approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Women and Gender Equity.
Thu Apr 17, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Queens Blvd rezoning and inclusionary housing amendment considered

The Subcommittee on Zoning and Franchises will review two applications from QBM Properties, LLC. LU 0269-2025 proposes amending the Zoning Map at 102-51 Queens Boulevard, changing an R7-1 district to an R8X district and creating C1-2 and C2-4 districts. LU 0270-2025 seeks to amend the Zoning Resolution Appendix F to establish a Mandatory Inclusionary Housing area at the same location. Both items are slated for discussion on April 17, 2025.

zoninghousingrezoninginclusionary-housingqueenscity-council
✓ Decided: Subcommittee heard and laid over two Queens Blvd rezoning applications

The Subcommittee on Zoning and Franchises held hearings on two land‑use applications for the 102‑51 Queens Boulevard rezoning. After the hearings, both applications were laid over by the subcommittee, so no final approval or denial was made.

250 Broadway - Committee Room, 16th Floor
Thu Apr 17, 2025 · 10:00 AM

Committee on Women and Gender Equity

Task force to study gender pay disparity proposed in local law

The Committee on Women and Gender Equity will consider a local law to create a task force that will study gender pay disparity and economic self‑sufficiency among city workers. It will also review resolutions supporting unionization, urging state and federal action on teleworking and musicians’ wages, and addressing equitable representation in the workforce. All items are scheduled for the April 17, 2025 meeting.

gender-payworkforce-equityunionteleworkingmusicians-wagelocal-lawresolution
✓ Decided: Committee held hearings and filed resolutions; no votes recorded

The Committee on Women and Gender Equity met on April 17, 2025. It held hearings on Oversight T2025-3314 and Introduction Int 0675-2024, and filed Res 0066-2024, Res 0109-2024, and Res 0368-2024. No votes, approvals, or rejections were recorded; the actions were procedural.

Council Chambers - City Hall Jointly with the Committee on Civil Service and Labor
Wed Apr 16, 2025 · 12:00 PM

Committee on Criminal Justice

Committee reviews recommendations to close Rikers Island

The Criminal Justice Committee will examine the Independent Rikers Commission’s Blueprint for closing Rikers Island. It will also consider several local law proposals that would amend the administrative code on supportive housing eligibility, technology for evidence review, holistic needs assessments, early release programs, and coordination of jail transitions. Additionally, the committee will consider a resolution urging the state legislature and governor to pass a bill providing money to individuals upon release.

riker-islandcriminal-justicehousingtechnologyevidencereleaselegislation
✓ Decided: Criminal Justice Committee held hearings and filed multiple bills

The Committee on Criminal Justice conducted a hearing on Oversight T2025-3316 and filed it. It also held hearings and filed five local law introductions (Int 1100‑2024, Int 1238‑2025, Int 1240‑2025, Int 1241‑2025, Int 1242‑2025) and a resolution (Res 0371‑2024). No votes or final approvals were recorded.

Council Chambers - City Hall
Wed Apr 16, 2025 · 10:00 AM

Committee on Finance

Council will consider a charter amendment on public servants' communications in hearings.

The Finance Committee will hold a pre‑consideration hearing on T2025‑3345, an oversight review of how NYC will prepare for changes in federal funding. It will also pre‑consider T2025‑3384, a proposed local law to amend the city charter regarding communications by certain public servants in adjudicative proceedings. Both items are scheduled jointly with the Committee on Governmental Operations, State & Federal Legislation.

financeoversightfederal-fundingcharter-amendmentgovernment-operationsadjudicative-proceedings
✓ Decided: No substantive decisions were made at the Finance Committee meeting

The Committee on Finance held hearings on Oversight T2025-3345 regarding federal funding changes and on Introduction Int 1263-2025 to amend the city charter. No votes, approvals, or denials were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor Jointly with Committee on Governmental Operations, State & Federal Legislation
Wed Apr 16, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

NYC Council reviews federal funding changes and charter amendment

The Committee on Governmental Operations, State & Federal Legislation will consider oversight of NYC's preparation for changes in federal funding (T2025-3346). It will also review a proposed local law to amend the city charter concerning communications in adjudicative proceedings by certain public servants (T2025-3384). The items are pre‑considered jointly with the Committee on Finance.

federal-fundingcity-charterlegislationoversightgovernmental-operations
✓ Decided: Committee held hearings on federal funding oversight and charter amendment

The Committee on Governmental Operations, State & Federal Legislation held an oversight hearing on preparing NYC for changes in federal funding (T2025-3346). It also heard a public hearing on Intro No. 1263-2025, a proposed amendment to the city charter concerning communications in adjudicative proceedings. No votes or formal approvals were recorded in the minutes.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Finance.
Wed Apr 16, 2025 · 10:00 AM

Committee on Aging

Committee on Aging to discuss Adult Protective Services and personal needs allowances

The Committee on Aging will conduct an oversight hearing regarding Adult Protective Services referrals. The committee will also consider a resolution urging New York State to increase personal needs allowance amounts for eligible individuals.

agingadult-protective-servicesstate-legislationsocial-services
✓ Decided: Committee on Aging laid over Resolution 0016-2024

The Committee on Aging held a hearing on Oversight T2025-3282 concerning Adult Protective Services referrals and filed the oversight. The committee also considered Resolution 0016-2024 urging the New York State Legislature and Governor to pass legislation to increase personal needs allowance amounts, and the resolution was laid over (postponed). No vote tally was recorded for the resolution.

Committee Room - City Hall
Tue Apr 15, 2025 · 10:00 AM

Committee on Immigration

Committee to discuss combating immigration services fraud

The Committee on Immigration is meeting jointly with the Committee on Consumer and Worker Protection. The body will conduct oversight on immigration services fraud and consider two local laws regarding fraudulent schemes and provider penalties.

immigrationconsumer-protectionfraudlocal-law
✓ Decided: Committee held hearings and introduced two immigration assistance bills

The Committee on Immigration held a hearing on Oversight – Combating Immigration Services Fraud (T2025-3174) and filed that oversight. It also held hearings on two local law introductions, Int 0205-2024 and Int 0980-2024, and laid both over for further action. No votes or final approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Consumer and Worker Protection.
Tue Apr 15, 2025 · 10:00 AM

Committee on Consumer and Worker Protection

Committee will consider two local laws targeting immigration assistance fraud

The Committee on Consumer and Worker Protection will discuss two proposed local laws. One amends the city administrative code to expand outreach about fraudulent immigration assistance schemes. The other amends the code to increase penalties for violations of immigration assistance service requirements. Both items are presented jointly with the Committee on Immigration.

immigrationconsumer-protectionfraudlocal-law
✓ Decided: Committee held hearings on immigration fraud oversight and two law proposals

The Committee on Consumer and Worker Protection held a hearing on oversight of immigration services fraud (T2025-3175). It also held hearings on two proposed local laws, Int 0205-2024 concerning outreach about fraudulent immigration assistance schemes, and Int 0980-2024 concerning increased penalties for violations. No votes or formal approvals were recorded.

Council Chambers - City Hall Jointly with the Committee on Immigration
Tue Apr 15, 2025 · 10:00 AM

Committee on Public Housing

Public Housing Committee will review oversight of security, fire guards and contractors

The City Council Committee on Public Housing will meet on April 15, 2025. The agenda item T2025-3337 calls for oversight of NYCHA security guards, fire guards, and the agency’s contractors. Committee members will review policies and performance related to these positions.

housingoversightsecurityfire-guardscontractors
✓ Decided: Committee held oversight hearing on NYCHA security and contractor oversight

The Committee on Public Housing met on April 15, 2025. Members Banks, Bottcher and Sanchez were present; Brannan, Mealy, Ossé, Salamanca Jr. and Won were also present, while Avilés was absent. The committee conducted Oversight Hearing T2025-3337 concerning security guards, fire guards, and NYCHA’s oversight of contractors and filed the hearing materials.

250 Broadway - Committee Room, 14th Floor
Thu Apr 10, 2025 · 11:30 AM

Committee on Civil Service and Labor

City Council Committee to consider exam fee waivers and subminimum wage resolution

The Committee on Civil Service and Labor will consider a local law that would amend the city’s administrative code to provide civil service examination fee waivers for high‑school students and first‑time applicants. The committee will also discuss a resolution urging the New York State Legislature and Governor to pass legislation (S. 28A/A. 1006) that would eliminate the subminimum wage for workers based on disability or age.

civil-servicelaborwagesexam-feesdisability
✓ Decided: Committee approved resolution urging state to end subminimum wage for disabled workers

The Civil Service and Labor Committee approved Local Law Int 0671-2024-A, which amends the city administrative code to provide civil service examination fee waivers for high‑school students and first‑time applicants. The committee also approved Resolution 0333-2024-A, urging the New York State Legislature and Governor to pass S.28A/A.1006 to eliminate the subminimum wage for employees based on disability or age. Both measures passed with an 8‑1 vote; Councilmember Kamillah Hanks was absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0671-2024 — Approved by Committee
8 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks absent · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Res 0333-2024 — Approved by Committee
8 yea · 1 absent
Carmen N. De La Rosa yea · Tiffany L. Cabán yea · Erik D. Bottcher yea · Eric Dinowitz yea · Oswald J. Feliz yea · Kamillah Hanks absent · Julie Menin yea · Francisco P. Moya yea · Yusef Salaam yea
Thu Apr 10, 2025 · 11:30 AM

Committee on Technology

Committee to consider law requiring 311 to provide tree pruning resources

The Committee on Technology will meet to discuss Int 0978-2024-A. This proposed local law would amend the city administrative code regarding how the 311 customer service center responds to tree pruning requests.

311city-servicestree-pruningadministrative-code
✓ Decided: Committee on Technology approves local law on 311 tree‑pruning resources

The Committee on Technology voted to approve Introduction 0978‑2024‑A, a local law requiring the 311 customer service center to provide resources for tree‑pruning requests. The vote was 4 in favor and 1 absent. The approval carries Enactment No. 2025/061.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0978-2024 — Approved by Committee
4 yea · 1 absent
Jennifer Gutiérrez yea · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino yea · Julie Won absent
Thu Apr 10, 2025 · 11:00 AM

Committee on Fire and Emergency Management

Local law to amend code on flash-flood outreach and evacuation guidance

The Committee will consider a proposed local law that would amend the New York City Administrative Code to add provisions for flash-flood preparedness outreach and evacuation guidance. The measure, identified as Int. 0807-2024-A, is scheduled for discussion at the April 10, 2025 meeting.

emergency-managementfloodcode-amendmentpublic-safetylocal-law
✓ Decided: Committee approves flash‑flood preparedness introduction

The Committee on Fire and Emergency Management approved Introduction 0807‑2024‑A, a local law amendment concerning flash flood preparedness outreach and evacuation guidance. The motion passed with five members voting affirmative and two members absent. No other actions were taken.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0807-2024 — Approved by Committee
5 yea · 2 absent
Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kevin C. Riley absent · Lynn C. Schulman yea · Susan Zhuang yea
Thu Apr 10, 2025 · 1:30 PM

City Council Stated Meeting

Council to consider MTA environmental study for QueensLink and other resolutions

The New York City Council will adopt resolutions urging the MTA to conduct a comprehensive environmental impact study for the proposed QueensLink project and an environmental statement for the Gun Hill Road electric bus depot charging facility. It will also consider a resolution calling for the elimination of the subminimum wage for employees based on disability or age. Additional items include tax‑exemption resolutions for properties on Stratford Road in Brooklyn and Plimpton Avenue in the Bronx, and local law amendments on civil‑service exam fee waivers, flash‑flood preparedness, and police surveillance oversight.

transportationenvironmentlaborhousingpublic-safetyelections
✓ Decided: Council approves three Brownsville housing projects with modifications

The Council approved three Brownsville housing development applications, each with modifications and referral to the City Planning Commission. It also approved tax‑exemption resolutions for properties in Brooklyn and the Bronx, and adopted several committee introductions by consent.

Council Chambers - City Hall
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Int 0480-2024 — Approved by Council
40 yea · 7 nay · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro nay · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0820-2025 — Approved, by Council
41 yea · 6 nay · 1 medical · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
M 0117-2025 — Approved, by Council
39 yea · 7 nay · 1 medical · 1 absent · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro nay · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Res 0847-2025 — Approved, by Council
39 yea · 7 nay · 1 medical · 1 absent · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro nay · Jennifer Gutiérrez yea · Shahana K. Hanif medical · Kamillah Hanks absent · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
The other 18 items passed by unanimous or near-unanimous consent.
Thu Apr 10, 2025 · 11:00 AM

Committee on Governmental Operations, State & Federal Legislation

City council considers a local law on a citywide bathroom strategy

The Committee on Governmental Operations, State & Federal Legislation will consider Int. No. 694‑A, a proposed local law to amend the city’s administrative code. The amendment addresses a long‑term citywide bathroom strategy and includes other technical changes. The committee will discuss the proposal and determine next steps.

public-facilitiescity-serviceslegislation
✓ Decided: Committee approves Introduction 0694-2024

The Committee on Governmental Operations, State & Federal Legislation approved Introduction 0694-2024. The vote recorded seven members in favor and two members absent. No other actions were taken.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0694-2024 — Approved by Committee
7 yea · 2 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif absent · Vickie Paladino yea · Lynn C. Schulman yea · Inna Vernikov absent
Thu Apr 10, 2025 · 10:45 AM

Committee on Parks and Recreation

City council to consider a local law prioritizing tree maintenance near buildings

The Committee on Parks and Recreation will consider Int. No. 800‑A, a proposed local law to amend the city’s administrative code. The amendment would set a priority for maintaining trees that are adjacent to buildings and structures. The committee will discuss the proposal and decide whether to advance it to the full council.

parkstreesenvironmentlocal-lawmaintenance
✓ Decided: Committee approves Introduction 800‑A to prioritize tree maintenance

The Committee on Parks and Recreation approved Introduction 800‑A, a local law amending the city’s administrative code to prioritize maintenance of trees adjacent to buildings and structures. The motion passed with all seven members present voting affirmative and one member absent. No other actions were taken at this meeting.

250 Broadway - Committee Room, 16th Floor VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0800-2024 — Approved by Committee
7 yea · 1 absent
Shekar Krishnan yea · David M. Carr yea · Robert F. Holden yea · Linda Lee yea · Julie Menin yea · Mercedes Narcisse yea · Vickie Paladino absent · Sandra Ung yea
Thu Apr 10, 2025 · 10:30 AM

Committee on Public Safety

Committee to review three bills on NYPD surveillance and facial recognition

The Committee on Public Safety is meeting to discuss three proposed local laws. These items focus on the Department of Investigation's oversight and the NYPD's use of surveillance and facial recognition technology.

public-safetysurveillancenypdfacial-recognitiontransparency
✓ Decided: Committee approves three police surveillance technology reforms

The City Council Committee on Public Safety approved three local law introductions. Int 0168-2024-A, amending oversight of police surveillance technology, passed unanimously. Int 0233-2024-A, establishing a facial‑recognition policy and audit requirements, also passed unanimously. Int 0480-2024-A, increasing police transparency on surveillance technology, was approved by a 9‑2 vote.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0480-2024 — Approved by Committee
9 yea · 2 nay
Yusef Salaam yea · Joann Ariola nay · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden nay · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé yea · Carlina Rivera yea · Althea V. Stevens yea
The other 2 items passed by unanimous or near-unanimous consent.
Thu Apr 10, 2025 · 10:30 AM

Committee on Transportation and Infrastructure

Council urges MTA to study environmental impact of the QueensLink project

The Transportation and Infrastructure Committee will consider two proposed local law amendments—one to track progress on the streets master plan and another to require an online capital‑project tracker. It will also consider two resolutions urging the Metropolitan Transportation Authority to conduct comprehensive environmental studies for the proposed QueensLink project and for the Gun Hill Road Electric Bus Depot charging facility.

transportationinfrastructureenvironmentplanninglegislation
✓ Decided: Committee approved environmental studies for QueensLink and Gun Hill projects

The Transportation and Infrastructure Committee approved two resolutions directing the MTA to conduct environmental studies for the QueensLink project and the Gun Hill Road electric bus depot charging facility. The committee also approved two introductions amending the city code to track progress on the streets master plan and to require an online capital project tracker. All approvals were unanimous with nine affirmative votes.

Committee Room - City Hall VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 1105-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Int 1114-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Res 0059-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Res 0187-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Thu Apr 10, 2025 · 10:00 AM

Committee on Finance

Finance Committee will preconsider two property items and other business

The Finance Committee will preconsider two agenda items concerning specific properties: 15 Stratford Road in Brooklyn (Block 5072, Lot 58) and 1383 Plimpton Avenue HDFC in the Bronx (Block 2522, Lot 109). Both items are listed as preconsidered. The committee will also address any other business as may be necessary.

financepropertypreconsiderationbrooklynbronx
✓ Decided: Committee on Finance approves two land‑use applications

The Committee on Finance voted to approve the land‑use application LU 0271‑2025 for 15 Stratford Road in Brooklyn and the application LU 0272‑2025 for 1383 Plimpton Avenue in the Bronx. Both items were approved with a 15‑vote affirmative and two members absent. No other actions were taken.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0271-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0272-2025 — P-C Item Approved by Committee with Companion Resolution
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Thu Apr 10, 2025 · 9:30 AM

Committee on Rules, Privileges and Elections

Council considers legal action to defend Sanctuary City Laws

The Committee on Rules, Privileges and Elections will review several appointments to city boards and commissions. The body is also considering a resolution to authorize the Speaker to take legal action regarding Sanctuary City Laws and actions by the Trump Administration.

appointmentslegal-actionsanctuary-citycity-government
✓ Decided: Committee approves five appointments and legal action resolution

The Rules, Privileges and Elections Committee approved five separate measures, including appointments to the Board of Corrections, Health and Hospitals Corporation, Planning Commission, and Commissioner of Elections, and a resolution authorizing the Speaker to pursue legal action. Each measure passed with a 9‑0 affirmative vote, with Councilmember Selvena Brooks‑Powers absent.

Committee Room - City Hall
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Res 0820-2025 — Approved by Committee
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Res 0821-2025 — Approved by Committee
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
M 0117-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Res 0836-2025 — P-C Item Approved by Comm
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
M 0119-2025 — P-C Item Approved by Committee with Companion Resolution
9 yea · 1 absent
Keith Powers yea · Adrienne E. Adams yea · Diana I. Ayala yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Amanda C. Farías yea · Crystal Hudson yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea
Thu Apr 10, 2025 · 9:00 AM

Committee on Civil and Human Rights

Council committee votes on resolution condemning federal DEI rollbacks

The Committee on Civil and Human Rights will consider Resolution 0729-2025. The resolution condemns President Trump’s revocation of diversity, equity, and inclusion programs at the federal level and expresses support for such programs at the city and state level. Council members will vote on whether to adopt the resolution.

civil-rightshuman-rightsdiversity-equity-inclusioncity-council
✓ Decided: Committee approves Resolution 0729 condemning Trump’s DEI rollbacks

The Committee on Civil and Human Rights voted to approve Resolution 0729‑2025, which condemns the President’s revocation of diversity, equity, and inclusion programs at the federal level and affirms support for such programs in New York City and State. The motion passed with three affirmative votes.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0729-2025 — Approved by Committee
3 yea · 1 absent · 1 medical
Nantasha M. Williams yea · Rita C. Joseph yea · Christopher Marte yea · Kevin C. Riley absent · Rafael Salamanca, Jr. medical
Wed Apr 9, 2025 · 1:00 PM

Committee on Land Use

Council to consider three HPD proposals for Brownsville development and zoning

The Land Use Committee will review three applications submitted by the Department of Housing Preservation and Development. One seeks designation of an Urban Development Action Area for properties on Mother Gaston Boulevard, Thomas S. Boyland Street, and Saint Mark’s Avenue. Another proposes amending the zoning map to change an M1-1 district to an R7A district with a C2-4 overlay. The third requests a zoning resolution amendment to create a Mandatory Inclusionary Housing area.

zoninghousingdevelopmentbrownsvilleurban-development-action-area
✓ Decided: Committee approves three Brownsville land‑use applications with modifications

The Land Use Committee voted unanimously to approve three Brownsville development applications, each with modifications, and to refer them to the City Planning Commission. All nine members voted in favor, with Councilmember Hudson absent. The approved applications are LU 0244‑2025 (C 250036 HAK), LU 0245‑2025 (C 250037 ZMK), and LU 0246‑2025 (N 250038 ZRK).

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0244-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson absent · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0245-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson absent · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0246-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson absent · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Wed Apr 9, 2025 · 11:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council to consider designating a Brownsville site as an Urban Development Action Area

The Subcommittee will review three applications submitted by the Department of Housing Preservation and Development. One proposes designating several Brownsville parcels as an Urban Development Action Area and disposing the property to a developer. The other two seek zoning changes: converting the area from M1‑1 to R7A with a C2‑4 overlay, and amending Appendix F to create a Mandatory Inclusionary Housing area.

zoningdevelopmenthousingbrownsvilleurban-development-action-areainclusionary-housing
✓ Decided: Subcommittee approved three Brownsville development applications, 6-1 each

The Subcommittee on Landmarks, Public Sitings and Dispositions met on April 9, 2025. It approved three land‑use applications (LU 0244‑2025, LU 0245‑2025, LU 0246‑2025) with modifications and referred each to the City Planning Commission. All three votes were six in favor and one absent.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0244-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0245-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
LU 0246-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte absent · Sandy Nurse yea · Yusef Salaam yea
Tue Apr 8, 2025 · 10:00 AM

Committee on Education

Committee on Education to discuss arts equity and school library reporting

The Committee on Education will hold an oversight hearing on equity and access in the arts. Members will also consider a law requiring the Department of Education to report on school librarians and library access.

educationartslibrariespublic-schoolsoversight
✓ Decided: Committee lays over two May 10 commemorative resolutions

The Education Committee heard Resolution 0741-2025 designating May 10 as Judith Jamison Day and Resolution 0844-2025 recognizing May 10 as Chinese American Railroad Workers Memorial Day. Both resolutions were laid over by the committee and were not adopted at this meeting. No vote tallies were recorded for either item.

Council Chambers - City Hall Jointly with the Committee on Cultural Affairs, Libraries and International Intergroup Relations.
Tue Apr 8, 2025 · 10:00 AM

Committee on Health

Committee on Health to discuss cooling centers and medical pricing

The Committee on Health is meeting to consider a local law regarding cooling centers. The committee will also review a resolution urging New York State to pass the Fair Pricing Act.

healthcooling-centersmedical-pricinghealthcare-costs
✓ Decided: Committee held hearings on cooling centers and medical cost cap proposals

The Health Committee heard testimony on Int. 0998‑2024, a local law to amend the city code for cooling centers, and on Res. 0822‑2025, a resolution urging the state to cap routine medical procedure costs at 150 % of Medicare rates. Both items were introduced and laid over by the committee, but no votes or final actions were recorded.

Committee Room - City Hall
Tue Apr 8, 2025 · 1:00 PM

Committee on Economic Development

City council committee holds oversight hearing on NYC food infrastructure

The Committee on Economic Development will hold an oversight hearing, together with the Committee on Oversight and Investigations, to examine New York City's food infrastructure and the cost and quality of produce. The meeting is scheduled for April 8, 2025 at 1:00 PM in the Committee Room at City Hall.

food-infrastructureproduceoversighteconomic-developmentinvestigations
✓ Decided: Committee held oversight hearing on NYC food infrastructure and produce costs

The Economic Development Committee, together with the Oversight and Investigations Committee, conducted an oversight hearing (T2025-3193) on New York City’s food infrastructure and the cost and quality of produce. No votes or formal approvals were recorded; the hearing and related documents were filed for the record.

Committee Room - City Hall Jointly with the Committee on Oversight and Investigations
Tue Apr 8, 2025 · 1:00 PM

Committee on Oversight and Investigations

Oversight of NYC food infrastructure and produce cost/quality

The Committee on Oversight and Investigations, together with the Committee on Economic Development, will hold an oversight session to examine New York City’s food infrastructure and the cost and quality of produce. The meeting is scheduled for April 8, 2025 at 1:00 PM in the Committee Room, City Hall. No decisions are indicated; the agenda item is for discussion and review.

foodinfrastructureproduceoversighteconomic-development
✓ Decided: Oversight committee held hearing on NYC food infrastructure and produce costs

The Committee on Oversight and Investigations, together with the Committee on Economic Development, conducted a hearing on the city’s food infrastructure and the cost and quality of produce in New York City. No motions, approvals, or votes were recorded; the hearing was filed with accompanying reports and transcripts. No substantive decisions were made during this meeting.

Committee Room - City Hall Jointly with the Committee on Economic Development.
Tue Apr 8, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Rezoning of 2510 Coney Island Avenue to R7D district approved

The Subcommittee on Zoning and Franchises will consider three agenda items. It will vote on a rezoning application for 2510 Coney Island Avenue that changes the area from an R4 and C8‑1 district to an R7D district with a C2‑4 sub‑district. It will also consider an amendment to the Zoning Resolution to create a Mandatory Inclusionary Housing area at the same site, and will pre‑consider two Article XI dispositions of city‑owned properties at 457 Nostrand Avenue and 1134‑1142 Pacific Street.

zoninghousinginclusionary-housingproperty-dispositionbrooklyn
✓ Decided: Subcommittee hears and lays over four Brooklyn land use applications

The Subcommittee on Zoning and Franchises held hearings on four land use applications, all of which were laid over without a vote. Two applications concern a rezoning and Mandatory Inclusionary Housing designation for 2510 Coney Island Avenue, and two concern the disposition of city-owned properties at 457 Nostrand Avenue and 1134-1142 Pacific Street. No final decisions were made.

250 Broadway - Committee Room, 16th Floor
Tue Apr 8, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council committee will consider two new commemorative days and a library access report

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will discuss a local law amendment (Int 1125-2024) that requires the Department of Education to report on school librarians and library access in New York City public schools. It will also consider Resolution 0741-2025 designating May 10 as Judith Jamison Day and Resolution T2025-3318 recognizing May 10 as Chinese American Railroad Workers Memorial Day. An oversight item (T2025-3212) on ensuring equity and access in the arts will be reviewed, with the agenda pre‑considered jointly with the Committee on Education.

cultural-affairslibrarieseducationcommemorationsartsequity
✓ Decided: Committee postpones two cultural resolutions

The Committee on Cultural Affairs, Libraries and International Intergroup Relations heard Resolution 0741-2025 designating May 10 as Judith Jamison Day and Resolution 0844-2025 recognizing May 10 as Chinese American Railroad Workers Memorial Day. Both resolutions were laid over (postponed) by the committee, and no vote tally was recorded.

Council Chambers - City Hall Jointly with the Committee on Education
Thu Apr 3, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee to consider new office for residential displacement remediation

The Housing and Buildings Committee will review four local law proposals and one resolution. The proposals include creating an office and online portal to address residential displacement, tightening demolition documentation and building‑violation timelines, establishing a fire‑emergency response guide, and studying a city‑sponsored low‑cost renter’s insurance program. The resolution urges state lawmakers and the governor to limit the period landlords can collect loss‑of‑rent insurance payments to three months without making repairs.

housingdisplacementrenter-insurancefire-safetybuilding-violationslandlord-regulation
✓ Decided: Committee held hearings and laid over several housing‑related bills and resolutions

The Committee on Housing and Buildings held hearings on six introductions: Int 0749‑2024, Int 0750‑2024, Int 0751‑2024, Int 0817‑2024, Res 0307‑2024, and Res 0802‑2025. After each hearing, the items were formally laid over by the committee. No vote tallies were recorded.

Council Chambers - City Hall Jointly with the Committee on Fire and Emergency Management.
Thu Apr 3, 2025 · 10:00 AM

Committee on Fire and Emergency Management

Create office and portal to remediate residential displacement after emergencies

The Committee on Fire and Emergency Management will consider a local law to amend the New York City charter and establish an Office of Residential Displacement Remediation with an online portal. It will also review amendments to the administrative code on building‑violation correction timelines, demolition documentation, a residential fire emergency response guide, and a study on a low‑cost city‑sponsored renter’s insurance program. Additionally, the committee will consider a resolution urging state legislation to limit landlords to three months of loss‑of‑rent insurance collection without meaningful repairs.

residential-displacementhousinginsurancebuilding-codefire-safetylegislation
✓ Decided: Committee urged state legislature to limit landlord rent‑collection time after fire damage

The Fire and Emergency Management Committee held hearings on the T2025-3192 oversight of residential displacement after emergencies and on four local‑law introductions (Int 0749‑2024, Int 0750‑2024, Int 0751‑2024, Int 0817‑2024). The committee also laid over two resolutions (Res 0307‑2024 and Res 0802‑2025) calling on the New York State Legislature and the Governor to act on rent‑insurance limits and tenant protection for fire‑displaced renters. No vote tallies were recorded.

Council Chambers - City Hall Jointly with the Committee on Housing and Buildings
Thu Apr 3, 2025 · 10:00 AM

Committee on General Welfare

Committee discusses food insecurity and city benefit applications

The Committee on General Welfare will hold an oversight hearing on hunger and food insecurity in New York City. The body will also consider three introduced local laws regarding city benefit applications and enrollment.

food-insecuritypublic-benefitssocial-servicescity-administration
✓ Decided: Committee held hearings and filed three local law introductions, no votes

The Committee on General Welfare heard the oversight hearing on hunger and food insecurity (T2025-3231). It also held hearings and filed three local law introductions: Int 0245-2024 on a universal benefits application, Int 1028-2024 on automatic enrollment in city benefit programs, and Int 1148-2024 requiring a receipt for benefit applications. No votes or formal approvals were recorded.

Committee Room - City Hall
Tue Apr 1, 2025 · 10:00 AM

Committee on Rules, Privileges and Elections

Committee reviews appointments for Board of Corrections and Health and Hospitals

The Committee on Rules, Privileges and Elections is meeting to consider several appointments to city boards and commissions. These include positions for the Board of Corrections and the New York City Health and Hospitals Corporation.

appointmentsboard-of-correctionshealth-and-hospitalsplanning-commissioncity-government
✓ Decided: Committee postpones three council appointments

The Rules, Privileges and Elections Committee held hearings on three appointments: Lauren Stosel to the NYC Board of Corrections, Patricia Marthone to the NYC Health and Hospitals Corporation, and Leah S. Goodridge to the NYC Planning Commission. Each resolution was laid over by the committee, meaning the appointments were postponed for future consideration.

Committee Room - City Hall
Thu Mar 27, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee reviews Atlantic Avenue Mixed-Use Plan and Queens Boulevard rezoning

The Subcommittee on Zoning and Franchises is reviewing a comprehensive mixed-use plan for Atlantic Avenue in Brooklyn, including zoning map amendments and property acquisitions. The body is also considering a rezoning application for 102-51 Queens Boulevard in Queens.

zoninghousingbrooklynqueensland-usemixed-use
✓ Decided: Subcommittee held hearings and postponed several Atlantic Avenue mixed‑use proposals

The Zoning and Franchises Subcommittee heard multiple land‑use applications related to the Atlantic Avenue mixed‑use plan and one Queens rezoning request. After the hearings, each application was laid over by the subcommittee, meaning no final action was taken.

Council Chambers - City Hall
Wed Mar 26, 2025 · 9:30 AM

Committee on Public Housing

Council committee considers resolutions on RAD/PACT study and resident engagement

The Committee on Public Housing will consider Resolution 0730-2025, which calls on the New York State Legislature and the Governor to pass legislation for a thorough study of the RAD/PACT program’s effects on residents, tenant rights, security, and community well‑being. It will also consider Resolution 0731-2025, which urges the Legislature and Governor to enact legislation establishing a more robust resident engagement and voting process for each NYCHA development undergoing RAD/PACT conversion.

housingrad-pacttenant-rightsnychalegislation
✓ Decided: Committee approved resolutions urging state study and reform of RAD/PACT program

The Committee on Public Housing approved Resolution 0730-2025, urging the New York State Legislature and the Governor to pass legislation for a thorough study of the RAD/PACT program's impact on residents. It also approved Resolution 0731-2025, calling for legislation to create a stronger resident engagement and voting process at NYCHA developments affected by RAD/PACT conversions. Both resolutions passed with an 8‑0 vote, with member Julie Won absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0730-2025 — Approved by Committee
8 yea · 1 absent
Chris Banks yea · Alexa Avilés yea · Erik D. Bottcher yea · Justin L. Brannan yea · Darlene Mealy yea · Chi A. Ossé yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Julie Won absent
Res 0731-2025 — Approved by Committee
8 yea · 1 absent
Chris Banks yea · Alexa Avilés yea · Erik D. Bottcher yea · Justin L. Brannan yea · Darlene Mealy yea · Chi A. Ossé yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Julie Won absent
Wed Mar 26, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Committee considers resolution for New York City Arts Space Act

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will meet to discuss two resolutions. One focuses on affordable arts spaces and the other on a cultural appreciation day.

artsculturelegislationaffordable-space
✓ Decided: Committee approves arts space and Greek cultural appreciation resolutions

The Committee on Cultural Affairs, Libraries and International Intergroup Relations approved Resolution 0720-2025, urging the New York State Legislature and Governor to pass the Arts Space Act to promote affordable arts spaces. The committee also approved Resolution 0792-2025, declaring March 25 as Greek Cultural Appreciation and Independence Day each year. Both motions passed by a 7‑2 vote.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0720-2025 — Approved by Committee
7 yea · 2 absent
Carlina Rivera yea · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis absent · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams absent
Res 0792-2025 — Approved by Committee
7 yea · 2 absent
Carlina Rivera yea · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis absent · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams absent
Wed Mar 26, 2025 · 1:30 PM

City Council Stated Meeting

Council to review Atlantic Avenue Mixed-Use Plan applications

The City Council will consider a land‑use review of the Atlantic Avenue Mixed‑Use Plan, directing the City Planning Commission’s actions on applications C 250018 PQK through C 250023 PPK and related filings. The Council will also act on several resolutions, including establishing the East Harlem 125th Street Business Improvement District and setting a public hearing, and approving tax‑exemption requests for properties on Union Street in Brooklyn and Morningside Heights in Manhattan. Additional items include amendments to local laws covering sidewalk shed design and lighting, a sleep‑apnea screening pilot program, and a provision of services for people living with HIV and AIDS.

land-usezoningtax-exemptionsbusiness-improvement-districthealthhousingconstruction
✓ Decided: Council approves multiple land use projects, tax exemptions and a new East Harlem BID

The City Council approved a series of land‑use applications and related tax‑exemption resolutions, including projects in Union Street and Morningside Heights. It also adopted a resolution establishing the East Harlem 125th Street Business Improvement District and approved a local law to enhance services for people living with HIV/AIDS. All actions were recorded as approved by the Council.

Council Chambers - City Hall
🗳️ How they voted — 24 divided votes
Named votes as recorded in the official record.
LU 0254-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0824-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0255-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0825-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0238-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0826-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0251-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0827-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0252-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0828-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0253-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0829-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0256-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0830-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0234-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0831-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0235-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0832-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
LU 0236-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
Res 0833-2025 — Approved, by Council
48 yea · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse nay · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 11 items passed by unanimous or near-unanimous consent.
Wed Mar 26, 2025 · 11:00 AM

Committee on Housing and Buildings

Resolution to block evictions for tenants in buildings with major maintenance violations

The Committee on Housing and Buildings will consider five proposed local laws that amend the city building and administrative codes on sidewalk shed design, penalties, lighting, exterior wall inspections, and façade‑repair deadlines. It will also review three resolutions urging the New York State Legislature and governor to pass legislation on eviction protections, speedy hearings for unlawful evictions, and legal representation in certain mortgage foreclosures. All items are presented as proposals for the committee's consideration.

building-codesidewalk-shedsevictionshousing-maintenancelegislation
✓ Decided: Committee approves five sidewalk‑shed and façade safety bills

The Housing and Buildings Committee approved five local law introductions. The bills amend the building code to study sidewalk shed designs, add penalties for sidewalk sheds, require exterior wall inspections, mandate lighting under sidewalk sheds, and impose penalties for delayed façade repairs. All seven committee members voted in favor. No other actions were taken.

Committee Room - City Hall VOTE*
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
Int 0391-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0393-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0394-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0660-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Int 0661-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0119-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0246-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Res 0524-2024 — Approved by Committee
7 yea
Pierina Ana Sanchez yea · Shaun Abreu yea · Alexa Avilés yea · Eric Dinowitz yea · Oswald J. Feliz yea · Crystal Hudson yea · Lincoln Restler yea
Wed Mar 26, 2025 · 11:00 AM

Committee on Public Safety

Committee on Public Safety to discuss resolutions regarding state legislative changes

The Committee on Public Safety is reviewing three resolutions calling on the New York State Legislature and Governor to act on specific bills. These items focus on parole board membership, jury duty eligibility, and the return of payments following unjust convictions.

public-safetycriminal-justicelegislative-resolutionsparolejury-duty
✓ Decided: Committee approves three resolutions urging state action on parole, jury duty, and restitution

The Committee on Public Safety approved three resolutions. Resolution 0414-2024-A, calling for at least one formerly incarcerated person on the State Board of Parole, passed 9‑2. Resolution 0415-2024-A, urging removal of the lifetime jury‑duty ban for convicted felons and postponement for incarcerated felons, passed 9‑2. Resolution 0417-2024-A, urging timely return of fines, restitution and reparation for unjust convictions, passed 11‑0.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
Res 0414-2024 — Approved by Committee
9 yea · 2 nay
Yusef Salaam yea · Joann Ariola nay · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden nay · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé yea · Carlina Rivera yea · Althea V. Stevens yea
Res 0415-2024 — Approved by Committee
9 yea · 2 nay
Yusef Salaam yea · Joann Ariola nay · Diana I. Ayala yea · Tiffany L. Cabán yea · Carmen N. De La Rosa yea · Robert F. Holden nay · Rita C. Joseph yea · Christopher Marte yea · Chi A. Ossé yea · Carlina Rivera yea · Althea V. Stevens yea
The other 1 item passed by unanimous or near-unanimous consent.
Wed Mar 26, 2025 · 10:30 AM

Committee on Health

Health Committee considers sleep apnea pilot and asthma inhaler cost‑share resolutions

The Committee on Health will consider a local law to start a sleep‑apnea screening pilot program and a public education campaign. It will also consider two resolutions: one urging the New York State Legislature and Governor to pass legislation eliminating cost‑sharing for asthma inhalers, and another urging Congress and the President to reintroduce the Supporting Safety Net Hospitals Act to delay Medicaid DSH payment cuts until FY 2026.

healthsleep-apneaasthmamedicaidlegislation
✓ Decided: Committee approves sleep apnea pilot and two health resolutions

The Committee on Health approved Introduction Int 1047-2024-B to establish a sleep apnea screening pilot program and public education campaign. It also approved Resolution 0721-2025-A urging the New York State Legislature and Governor to pass legislation eliminating cost‑sharing for asthma inhalers. The committee further approved Resolution 0722-2025-A urging Congress and the President to pass the Supporting Safety Net Hospitals Act to delay Medicaid DSHP cuts until FY 2026. All approvals were by roll call with eight members voting affirmative and one absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 1047-2024 — Approved by Committee
8 yea · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato yea · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Res 0721-2025 — Approved by Committee
8 yea · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato yea · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Res 0722-2025 — Approved by Committee
8 yea · 1 absent
Lynn C. Schulman yea · Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro absent · Kristy Marmorato yea · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Wed Mar 26, 2025 · 10:30 AM

Committee on Finance

Council Finance Committee will vote on funding designations and a new East Harlem BID

The Committee on Finance will consider four items. It will hold a public hearing on establishing the East Harlem 125th Street Business Improvement District. It will review two land use proposals for properties in Brooklyn and Manhattan. It will vote on a resolution that changes the designation of certain organizations to receive funding in the expense budget.

budgetzoninghousingdevelopmentcommunity
✓ Decided: Council approves East Harlem 125th St Business Improvement District

The Finance Committee approved Resolution 0813-2025 establishing the East Harlem 125th Street Business Improvement District. It also approved Resolution 0815-2025 changing designations for organizations to receive funding in the expense budget. Two land‑use applications—Union Street Houses in Brooklyn (LU 0254-2025) and Morningside Heights II in Manhattan (LU 0255-2025)—were approved. All items passed with 14 affirmative votes, 2 members absent, and 1 medical abstention.

Committee Room - City Hall VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Res 0813-2025 — P-C Item Approved by Comm
14 yea · 2 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens medical · Nantasha M. Williams absent · Julie Won absent
Res 0815-2025 — P-C Item Approved by Comm
14 yea · 2 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens medical · Nantasha M. Williams absent · Julie Won absent
LU 0254-2025 — P-C Item Approved by Committee with Companion Resolution
14 yea · 2 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens medical · Nantasha M. Williams absent · Julie Won absent
LU 0255-2025 — P-C Item Approved by Committee with Companion Resolution
14 yea · 2 absent · 1 medical
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens medical · Nantasha M. Williams absent · Julie Won absent
Wed Mar 26, 2025 · 10:00 AM

Committee on General Welfare

Council reviews resolution to cap shelter costs for HIV patients at 30% income

The City Council's Committee on General Welfare will consider a proposed local law (Int. 1194‑A) that would amend the city’s administrative code regarding services for people living with HIV and AIDS. The committee will also consider a resolution (Res. 175‑A) urging the New York State Legislature and the Governor to enact legislation that would require local social service departments to link HIV‑positive individuals with benefits and limit shelter costs for those receiving housing assistance to no more than 30% of household income. Both items are scheduled for discussion at the March 26, 2025 meeting.

healthcarehousingsocial-serviceslegislationhiv-aids
✓ Decided: Committee approves HIV/AIDS services law and related resolution

The Committee on General Welfare approved Introduction Int 1194-2025, a local law amending the city code concerning services for people living with HIV and AIDS. The Committee also approved Resolution 0175-2024-A urging the New York State Legislature and Governor to pass S.442/A.3355, which would require social service departments to link HIV‑positive individuals with benefits and cap shelter costs at 30% of income for those receiving housing assistance. Both actions were approved by unanimous roll‑call vote of nine members.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1194-2025 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Res 0175-2024 — Approved by Committee
9 yea
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley yea · Althea V. Stevens yea · Sandra Ung yea
Tue Mar 25, 2025 · 12:00 PM

Committee on Veterans

Committee on Veterans holds budget and oversight hearings

The Committee on Veterans is conducting budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The session includes a review of the Fiscal 2025 Preliminary Mayor’s Management Report.

veteransbudgetoversightcapital-plangovernment-spending
✓ Decided: Committee held oversight hearing on veterans budget, no decisions made

The Committee on Veterans met on March 25, 2025 at City Hall. The meeting consisted of an oversight hearing on the FY 2026 preliminary budget, the FY 2026‑2029 capital plan, and the FY 2025 Mayor’s Management Report. No actions, approvals, denials, or votes were recorded.

Committee Room - City Hall
Tue Mar 25, 2025 · 11:30 AM

Committee on Land Use

City to transfer multiple properties to NYC Health + Hospitals system

The Land Use Committee will consider five applications: a transfer of several City-owned parcels to the New York City Health and Hospitals corporation; a site selection for a new 547‑seat primary school at 1631‑1659 Zerega Avenue in the Bronx; a request for property‑tax exemption for several West 128th‑129th Street sites in Manhattan; approval of an Urban Development Action Area Project for the same Manhattan block cluster; and an amendment to a previously approved disposition of property at 740 Brook Avenue in the Bronx.

housingeducationhealthproperty-transferdevelopment
✓ Decided: Committee approved five land-use applications, each with a 9-1 vote

The Land Use Committee approved five applications: the H+H Operating Agreement transfer, a new 547‑seat primary school on Zerega Avenue, two West 128th‑129th Street cluster projects (Article XI tax‑exemption and UDAAP), and an amendment to the Brook 156 project. All motions passed by roll call with nine affirmative votes and one conflict vote from Councilmember Abreu.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
LU 0238-2025 — Approved by Committee with Modifications
9 yea · 1 conflict
Rafael Salamanca, Jr. yea · Shaun Abreu conflict · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0251-2025 — Approved by Committee with Companion Resolution
9 yea · 1 conflict
Rafael Salamanca, Jr. yea · Shaun Abreu conflict · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0252-2025 — Approved by Committee with Companion Resolution
9 yea · 1 conflict
Rafael Salamanca, Jr. yea · Shaun Abreu conflict · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0253-2025 — Approved by Committee with Companion Resolution
9 yea · 1 conflict
Rafael Salamanca, Jr. yea · Shaun Abreu conflict · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0256-2025 — P-C Item Approved by Committee with Companion Resolution
9 yea · 1 conflict
Rafael Salamanca, Jr. yea · Shaun Abreu conflict · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Tue Mar 25, 2025 · 11:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

City to transfer multiple properties to NYC Health + Hospitals system

The Subcommittee will consider a lease‑based transfer of dozens of city parcels to the NYC Health and Hospitals corporation (LU 0238‑2025). It will also review a site selection for a new 547‑seat primary school on Zerega Avenue in the Bronx (LU 0251‑2025). Additional items include a tax‑exemption request for several Manhattan properties (LU 0252‑2025), approval of an Urban Development Action Area Project for the same Manhattan block (LU 0253‑2025), and an amendment to a project summary for 740 Brook Avenue in the Bronx (T2025‑3290).

landmarkspublic-sittingsdispositionshousingeducationtaxdevelopment
✓ Decided: Subcommittee approved transfer of multiple city properties to H+H

The Subcommittee on Landmarks, Public Sitings and Dispositions approved five land‑use applications. All motions passed unanimously (7‑0). The approvals include a property transfer to Health & Hospitals, a new 547‑seat primary school on Zerega Avenue, a tax‑exemption for the West 128th‑129th Street cluster, an Urban Development Action Area project for the same cluster, and an amendment to the Brook 156 project.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
LU 0238-2025 — Approved by Subcommittee with Modifications
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0251-2025 — Approved by Subcommittee
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0252-2025 — Approved by Subcommittee
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0253-2025 — Approved by Subcommittee
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
LU 0256-2025 — P-C Item Approved by Subcommittee with Companion Resolution
7 yea
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam yea
Tue Mar 25, 2025 · 10:00 AM

Committee on Housing and Buildings

Committee on Housing and Buildings holds budget and oversight hearings

The Committee on Housing and Buildings will conduct budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The session includes reviews of the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversighthousingbuildings
✓ Decided: Committee held oversight hearing on FY2026 budget and capital plan

The Committee on Housing and Buildings met on March 25, 2025 for an oversight hearing. The hearing covered the preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the fiscal 2025 mayor’s management report. No actions, approvals, or votes were recorded.

Council Chambers - City Hall
Tue Mar 25, 2025 · 9:30 AM

Committee on Sanitation and Solid Waste Management

Committee holds budget and oversight hearings for Department of Sanitation

The Committee on Sanitation and Solid Waste Management will conduct budget and oversight hearings. The body will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report.

sanitationbudgetoversightcapital-plan
✓ Decided: Committee held oversight hearing on FY2026 budget and capital plan

The Sanitation and Solid Waste Management Committee held an oversight hearing on the preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the fiscal 2025 Mayor’s Management Report. No votes, approvals, or other formal actions were recorded.

Committee Room - City Hall
Mon Mar 24, 2025 · 1:00 PM

Committee on Contracts

Committee on Contracts to hold budget and oversight hearings

The Committee on Contracts will conduct budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The session includes a review of the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversightcontractscity-management
✓ Decided: Committee on Contracts held an oversight hearing on the FY 2026 budget

The Committee on Contracts met on March 24, 2025, and conducted an oversight hearing on the preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the FY 2025 Mayor’s Management Report. The hearing was recorded, and the related documents were filed by the committee. No substantive decisions, approvals, or votes were recorded in the minutes.

Committee Room - City Hall
Mon Mar 24, 2025 · 10:00 AM

Committee on Health

Council Health Committee reviews FY 2026 budget and 2026‑2029 capital plan

The Committee on Health will hold budget and oversight hearings on the city’s preliminary fiscal year 2026 budget, the preliminary capital plan for fiscal years 2026‑2029, and the fiscal 2025 Mayor’s Management Report. The Department of Health and Mental Hygiene will present at 10:00 a.m. A Medical Examiner briefing is scheduled for 12:30 p.m. The meeting will conclude with a public hearing at 1:30 p.m., held jointly with the Committee on Mental Health, Disabilities and Addiction.

budgetcapital-planhealthpublic-hearingmedical-examiner
✓ Decided: Committee held oversight hearing on FY2026 budget and health reports

The Committee on Health, together with the Committee on Mental Health, Disabilities and Addiction, conducted an oversight hearing covering the preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. Presentations were given by the Department of Health and Mental Hygiene (Mental Hygiene and Public Health divisions) and the Office of the Chief Medical Examiner. No formal decisions, approvals, or votes were recorded during this meeting.

Council Chambers - City Hall Jointly with the Committee on Mental Health, Disabilities and Addiction.
Mon Mar 24, 2025 · 10:00 AM

Committee on Mental Health, Disabilities and Addiction

Council will hold budget and oversight hearings on FY 2026 budget and capital plan

The Committee on Mental Health, Disabilities and Addiction will conduct budget and oversight hearings on the city’s Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings are scheduled with presentations from the Department of Health and Mental Hygiene at 10:00 a.m., the Medical Examiner at 12:30 p.m., and a public session at 1:30 p.m. The meeting will be held jointly with the Committee on Health.

budgetcapital-planhealthmental-healthoversightcity-council
✓ Decided: Committee held oversight hearing; no decisions were made.

The Committee on Mental Health, Disabilities and Addiction met on March 24, 2025. Members present were Lee, Bottcher, Hanif, Louis, Marmorato, Cabán, and Mealy; Abreu was absent. The committee conducted an oversight hearing on the FY 2026 preliminary budget, the FY 2026‑2029 capital plan, and the Fiscal 2025 Mayor’s Management Report, with testimony from the Department of Health and Mental Hygiene and the Office of the Chief Medical Examiner. No formal actions, approvals, or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Health
Fri Mar 21, 2025 · 10:30 AM

Committee on Small Business

Budget and oversight hearing on FY2026 budget and capital plan

The Committee on Small Business will hold a budget and oversight hearing. The hearing will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The Department of Small Business Services will present at 10:30 a.m., followed by a public session at 12:00 p.m.

budgetcapital-planoversightsmall-businesscity-council
✓ Decided: No substantive decisions were made at the Small Business Committee meeting

The committee conducted a roll call and an oversight hearing on the FY 2026 preliminary budget, the FY 2026‑2029 capital plan, and the FY 2025 mayor’s management report. No motions, approvals, or votes were recorded.

Committee Room - City Hall
Fri Mar 21, 2025 · 10:00 AM

Committee on Governmental Operations, State & Federal Legislation

City Council reviews FY 2026 budget and capital plan

The Committee on Governmental Operations will hold oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings are scheduled from 10:00 a.m. to 2:00 p.m., with each agency presenting in turn. No decisions are indicated; the agenda lists discussion and review of these documents.

budgetcapital-planoversightcity-governmentfinance
✓ Decided: Committee held oversight hearing; no decisions were made

The Committee on Governmental Operations, State & Federal Legislation conducted an oversight hearing on the FY 2026 preliminary budget, the FY 2026‑2029 preliminary capital plan, and the FY 2025 preliminary mayor’s management report. No motions were voted on or actions approved. Attendance was recorded with five members present, three present but absent, and one absent.

Council Chambers - City Hall
Thu Mar 20, 2025 · Deferred

Committee on Economic Development

Committee holds budget and oversight hearings for Economic Development Corporation

The Committee on Economic Development is conducting budget and oversight hearings. The body will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report.

budgeteconomic-developmentoversightcapital-plan
Committee Room - City Hall
Thu Mar 20, 2025 · 1:00 PM

Committee on Parks and Recreation

Parks and Recreation Committee holds budget and oversight hearings

The Committee on Parks and Recreation will conduct budget and oversight hearings. The body will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversightparkscapital-plan
✓ Decided: Committee held oversight hearing on FY 2026 budget, no actions taken

The Parks and Recreation Committee met on March 20, 2025, and conducted an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026‑2029, and the Fiscal 2025 Mayor’s Management Report. The hearing included testimony and a transcript from the Department of Parks & Recreation. No motions were voted on or decisions recorded.

Committee Room - City Hall
Thu Mar 20, 2025 · 10:00 AM

Committee on Children and Youth

Youth and community services agencies testify on FY 2026 budget

The Committee on Children and Youth will hold budget oversight hearings for the Fiscal Year 2026 Preliminary Budget, the Fiscal 2025 Preliminary Mayor’s Management Report, and the Preliminary Capital Plan for Fiscal Years 2026-2029. Testimony is scheduled from the Department of Youth and Community Development at 10:00 a.m. and the Administration for Children’s Services at 1:00 p.m.

budgetyouthchildrenoversighttestimonycapital-plan
✓ Decided: Committee held an oversight hearing; no decisions were made

The Committee on Children and Youth met on March 20, 2025, with Chair Althea V. Stevens and members present. The meeting consisted of an oversight hearing on the FY 2026 preliminary budget, the FY 2026‑2029 capital plan, and the FY 2025 Mayor’s Management Report. No actions, approvals, or votes were recorded.

Council Chambers - City Hall
Wed Mar 19, 2025 · Deferred

Committee on Transportation and Infrastructure

Council to consider curbside overnight truck parking zones in industrial areas

The Transportation and Infrastructure Committee will consider two local law proposals. The first would amend the city’s administrative code to create curbside overnight truck parking sections in Industrial Business Zones. The second would amend the code to automatically waive certain additional penalties for parking violations when the vehicle owner responds to a notice between 45 and 90 days after issuance. No other items are listed on the agenda.

transportationparkingzoninglocal-law
250 Broadway - Committee Room, 14th Floor
Wed Mar 19, 2025 · 1:00 PM

Committee on Consumer and Worker Protection

Budget and oversight hearings for Department of Consumer and Worker Protection

The Committee on Consumer and Worker Protection will hold budget and oversight hearings. The body will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversightconsumer-protectionworker-protection
✓ Decided: Committee held oversight hearing on FY2026 budget and management report

The Committee on Consumer and Worker Protection convened an oversight hearing on the preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the fiscal 2025 Mayor’s Management Report. No formal decisions, approvals, or votes were recorded during this meeting.

250 Broadway - Committee Room, 16th Floor
Wed Mar 19, 2025 · 10:15 AM

Committee on Transportation and Infrastructure

Council holds hearings on FY2026 budget, capital plan and mayor's report

The Transportation and Infrastructure Committee will hold budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. Testimony will be heard from MTA/NYC Transit, the Department of Transportation, the Taxi and Limousine Commission, the Department of Design and Construction, and the public.

budgetfinancetransportationinfrastructurecapital-planoversight
✓ Decided: Transportation Committee held oversight hearing, no decisions taken

The Committee on Transportation and Infrastructure met on March 19, 2025 for an oversight hearing on the FY 2026 preliminary budget, capital plan, and mayor’s management report. Members present were Brooks-Powers, Ariola, Banks, Farías, Louis, Narcisse, Rivera, and Won; De La Rosa was absent. No votes or formal actions were recorded.

Council Chambers - City Hall
Tue Mar 18, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council reviews FY 2026 budget, FY 2026‑29 capital plan, and mayor's report

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will hold budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings are scheduled for 10:00 a.m. (Libraries), 12:00 p.m. (Department of Cultural Affairs), and 2:00 p.m. (Public). The committee will discuss these financial documents but no final decisions are indicated in the agenda.

budgetcapital-planmayors-reportlibrariescultural-affairspublic-hearing
✓ Decided: Council committee holds FY2026 preliminary budget oversight hearing

The Committee on Cultural Affairs, Libraries and International Intergroup Relations held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing covered libraries, the Department of Cultural Affairs, and public testimony. The committee filed the oversight, but no substantive decisions were made.

Council Chambers - City Hall
Tue Mar 18, 2025 · 1:15 PM

Committee on Land Use

Committee to review rezoning for 123-12 Sutphin Boulevard

The Committee on Land Use will consider two applications regarding the 123-12 Sutphin Boulevard project in Queens. The body will discuss changes to the Zoning Map and the establishment of a Mandatory Inclusionary Housing area.

zoninghousingqueensland-use
✓ Decided: Committee approves Sutphin Blvd rezoning with modifications

The Committee on Land Use held hearings and approved two applications for the 123-12 Sutphin Boulevard rezoning in Queens, Community District 12. Both applications were approved with modifications and referred to the City Planning Commission (CPC) by unanimous roll call votes of 10-0.

250 Broadway - Committee Room, 14th Floor
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0239-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0240-2025 — Approved by Committee with Modifications and Referred to CPC
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Tue Mar 18, 2025 · Deferred

Committee on Sanitation and Solid Waste Management

Committee will hold budget and oversight hearings on FY 2026 budget

The Sanitation and Solid Waste Management Committee will hold budget and oversight hearings. The agenda includes the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. Hearings are scheduled for 1:00 p.m. with the Department of Sanitation and a public session at 3:00 p.m.

budgetcapital-plansanitationoversightfiscal-report
Committee Room - City Hall
Tue Mar 18, 2025 · 1:00 PM

Subcommittee on Zoning and Franchises

Subcommittee to review rezoning and housing mandates for 123-12 Sutphin Boulevard

The Subcommittee on Zoning and Franchises will discuss two applications regarding 123-12 Sutphin Boulevard in Queens. The body is reviewing a zoning map amendment and the establishment of a Mandatory Inclusionary Housing area.

zoninghousingqueensland-use
✓ Decided: Subcommittee approves Sutphin Boulevard rezoning with modifications

The Subcommittee on Zoning and Franchises held hearings and approved two land use applications for the 123-12 Sutphin Boulevard rezoning in Queens, Community District 12. Both applications were approved with modifications and referred to the City Planning Commission (CPC) by unanimous roll call votes of 7-0.

250 Broadway - Committee Room, 14th Floor
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
LU 0239-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0240-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Tue Mar 18, 2025 · 12:00 PM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee reviews land use and zoning changes for Brownsville NCP

The Subcommittee on Landmarks, Public Sitings and Dispositions will discuss three land use applications submitted by the Department of Housing Preservation and Development (HPD). These items concern property dispositions and zoning amendments in the Brownsville area of Brooklyn.

zoninghousingbrooklynland-usebrownsville
✓ Decided: Brownsville NCP land use applications heard, laid over

The subcommittee held hearings on three Brownsville Neighborhood Construction Plan (NCP) land use applications submitted by HPD, covering property disposition, zoning map changes, and a Mandatory Inclusionary Housing area. All three applications were laid over by the subcommittee without a vote. No final decisions were made at this meeting.

250 Broadway - Committee Room, 16th Floor
Tue Mar 18, 2025 · 10:30 AM

Committee on Environmental Protection, Resiliency and Waterfronts

Council committee will hear the FY 2026 budget and 2026‑2029 capital plan.

The Committee on Environmental Protection, Resiliency and Waterfronts will hold a budget and oversight hearing. The hearing will review the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The session includes a Department of Environmental Protection presentation at 10:30 a.m. and a public portion at 12:00 p.m.

budgetcapital-planenvironmentresiliencywaterfrontsoversight
✓ Decided: Council committee holds DEP budget oversight hearing

The Committee on Environmental Protection, Resiliency and Waterfronts held a budget and oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing included testimony from the Department of Environmental Protection and public testimony. The oversight was filed by the committee.

Committee Room - City Hall
Mon Mar 17, 2025 · Deferred

Committee on Parks and Recreation

Committee reviews FY 2026 budget and capital plan for parks

The Parks and Recreation Committee will hold budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The Department of Parks & Recreation will present at 1:00 p.m., followed by a public hearing at 3:00 p.m.

budgetcapital-planparks-recreationoversightcity-council
Committee Room - City Hall
Mon Mar 17, 2025 · 1:00 PM

Committee on Economic Development

Committee will hold budget and capital plan hearings for FY 2026-2029

The New York City Council Committee on Economic Development will hold oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings are scheduled for 1:00 p.m. with the Economic Development Corporation and a public session at 3:00 p.m. on March 17, 2025.

budgetcapital-planeconomic-developmentcity-counciloversight
✓ Decided: Council holds oversight hearing on NYC economic development budget

The Committee on Economic Development held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearing included testimony from the Economic Development Corporation and public testimony. The committee filed the oversight after the hearing.

Committee Room - City Hall
Mon Mar 17, 2025 · 10:00 AM

Committee on General Welfare

Committee on General Welfare holds budget and oversight hearings

The Committee on General Welfare is conducting budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The session includes a review of the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversightsocial-serviceshomeless-services
✓ Decided: Committee holds preliminary budget oversight hearing for FY2026

The Committee on General Welfare held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing included testimony from the Department of Social Services (Human Resources Administration and Department of Homeless Services) and public testimony. The oversight was filed by the committee; no substantive decisions were made.

Council Chambers - City Hall
Fri Mar 14, 2025 · 1:15 PM

Subcommittee on Landmarks, Public Sitings and Dispositions

Council subcommittee to consider UDAA designation and zoning changes for 581 Grant Avenue

The Subcommittee on Landmarks, Public Sitings and Dispositions will review three applications submitted by the NYC Department of Housing Preservation and Development for 581 Grant Avenue in Brooklyn. One application seeks designation of the site as an Urban Development Action Area and disposition of the property to a developer. The other two applications propose a zoning map amendment from R5 to R6 and an amendment to create a Mandatory Inclusionary Housing Area.

zoningdevelopmenthousingurban-development-action-areabrooklyn
✓ Decided: Subcommittee approves 581 Grant Ave development applications

The Subcommittee on Landmarks, Public Sitings and Dispositions approved three land use applications related to the 581 Grant Avenue Development in Brooklyn, each with modifications, and referred them to the City Planning Commission. All three applications were approved by a roll call vote of 6-0, with Council Member Salaam absent. The applications include an Urban Development Action Area designation and property disposition, a zoning map amendment from R5 to R6, and a zoning resolution amendment to establish a Mandatory Inclusionary Housing Area.

Committee Room - City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0234-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam absent
LU 0235-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam absent
LU 0236-2025 — Approved by Subcommittee with Modifications and Referred to CPC
6 yea · 1 absent
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam absent
Fri Mar 14, 2025 · 10:30 AM

Committee on Oversight and Investigations

Council will hold oversight hearings on the FY 2026 budget and capital plan.

The Committee on Oversight and Investigations will conduct budget and oversight hearings covering the city’s preliminary Fiscal Year 2026 budget, the preliminary capital plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings begin at 10:30 a.m. with the Department of Investigation and will be open to the public at 12:00 p.m. No formal decisions are listed; the agenda is for review and discussion.

budgetcapital-planoversightmayor-reportpublic-hearing
✓ Decided: Council oversight committee holds DOI budget hearing

The Committee on Oversight and Investigations held a hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing included testimony from the Department of Investigation and public testimony. The committee filed the oversight matter after the hearing.

Committee Room - City Hall
Fri Mar 14, 2025 · 10:00 AM

Committee on Fire and Emergency Management

Council to hear preliminary budget for Fiscal Year 2026

The Committee on Fire and Emergency Management will hold a public hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The session is scheduled for 10:00 a.m. and will include testimony from Fire/Emergency Medical Service and NYC Emergency Management.

budgethearingsfireemergency-managementcapital-plan
✓ Decided: Council holds budget oversight hearing on FDNY and emergency management

The Committee on Fire and Emergency Management held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing covered the Fire/Emergency Medical Service, NYC Emergency Management, and public testimony. The committee filed the oversight hearing and its attachments.

Council Chambers - City Hall
Fri Mar 14, 2025 · 1:30 PM

Committee on Land Use

Committee reviews development and zoning changes for 581 Grant Avenue

The Committee on Land Use is reviewing three applications from the Department of Housing Preservation and Development regarding 581 Grant Avenue in Brooklyn. The proposals include designating the site as an Urban Development Action Area and modifying zoning to allow for development.

zoninghousingbrooklynland-use
✓ Decided: Committee approves 581 Grant Ave development package with modifications

The Committee on Land Use held hearings and approved three land use applications related to the 581 Grant Avenue Development in Brooklyn, Community District 5. Each application was approved with modifications and referred to the City Planning Commission (CPC) by roll call vote of 8-0, with one non-voting member and one absent. The applications cover urban development action area designation, zoning map amendment from R5 to R6, and establishment of a Mandatory Inclusionary Housing Area.

Committee Room - City Hall
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0234-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya absent · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0235-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya absent · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
LU 0236-2025 — Approved by Committee with Modifications and Referred to CPC
8 yea · 2 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya absent · Kevin C. Riley yea · Carlina Rivera absent · Pierina Ana Sanchez yea
Thu Mar 13, 2025 · 1:00 PM

Committee on Higher Education

Committee on Higher Education holds budget and oversight hearings

The Committee on Higher Education is conducting budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The session includes a review of the Fiscal 2025 Preliminary Mayor’s Management Report.

higher-educationbudgetoversightcuny
✓ Decided: Council holds CUNY budget oversight hearing, files report

The Committee on Higher Education held a budget and oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report, focusing on the City University of New York (CUNY). The hearing included testimony and a transcript, and the committee filed the oversight. No substantive decisions or votes were recorded.

Committee Room - City Hall
Thu Mar 13, 2025 · 10:00 AM

Committee on Education

Education Committee holds budget and capital plan hearings for FY 2026

The Committee on Education will conduct budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The Department of Education will present expense items at 10:00 a.m., the School Construction Authority will present capital items at 1:00 p.m., and a public hearing will follow at 2:30 p.m.

educationbudgetcapital-planoversightmayor-report
✓ Decided: Education committee holds FY2026 preliminary budget hearing

The Committee on Education held an oversight hearing on the FY2026 preliminary budget, the FY2026-2029 preliminary capital plan, and the FY2025 preliminary Mayor's Management Report. The hearing covered Department of Education expenses and School Construction Authority capital plans. No votes or decisions were taken; the hearing was filed by the committee.

Council Chambers - City Hall
Wed Mar 12, 2025 · 1:30 PM

City Council Stated Meeting

Council will approve several land use resolutions for The Beacon projects.

The City Council will consider and vote on multiple land use resolutions, including several ULURP approvals for The Beacon in Manhattan. It will also adopt a finance resolution designating new organizations for Expense Budget funding and review local laws affecting child services and correctional facilities. All items are listed on the March 12, 2025 agenda.

land-usefinancechild-servicescriminal-justicehousing
✓ Decided: NYC Council approves Queens Future zoning and map changes

The Council approved a series of land use applications, including the Queens Future map change and zoning amendment, and several housing development projects. It also passed multiple local laws related to foster care, criminal justice, and government transparency, along with resolutions on state-level issues. The meeting included a vote to disapprove a sidewalk café at 37 Canal Street.

Council Chambers - City Hall
🗳️ How they voted — 5 divided votes
Named votes as recorded in the official record.
Int 0216-2024 — Approved by Council
39 yea · 7 nay · 3 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro nay · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis absent · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
LU 0249-2025 — Approved, by Council
41 yea · 3 abstain · 3 absent · 2 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis absent · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
Res 0811-2025 — Approved, by Council
41 yea · 3 abstain · 3 absent · 2 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis absent · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
LU 0250-2025 — Approved, by Council
41 yea · 3 abstain · 3 absent · 2 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis absent · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
Res 0812-2025 — Approved, by Council
41 yea · 3 abstain · 3 absent · 2 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán abstain · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis absent · Kristy Marmorato yea · Christopher Marte abstain · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez abstain · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams absent · Julie Won yea · Susan Zhuang yea
The other 27 items passed by unanimous or near-unanimous consent.
Wed Mar 12, 2025 · 11:00 AM

Committee on Finance

Finance Committee will vote on a resolution to redesignate organizations for funding.

The Committee on Finance will consider Res 0791-2025. The resolution would approve a new designation and changes to the designation of certain organizations to receive funding in the Expense Budget. No other items are listed on the agenda.

financebudgetfundingcity-councilexpense-budgetdesignations
✓ Decided: Committee approves resolution on expense budget funding designations

The Committee on Finance voted 15-0 to approve Resolution 0791-2025, which approves new designations and changes to organizations receiving funding in the Expense Budget. Two members were absent. The resolution now moves to the full Council.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0791-2025 — P-C Item Approved by Comm
15 yea · 2 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Wed Mar 12, 2025 · 11:00 AM

Committee on Governmental Operations, State & Federal Legislation

Council committee considers social media archiving and ballot rules

The Committee on Governmental Operations, State & Federal Legislation is meeting to discuss a local law regarding government social media archives. The body will also consider a resolution urging New York State to change rules regarding referendum proposals on local ballots.

social-mediagovernment-archiveselectionsstate-legislationcity-charter
✓ Decided: Committee approves social media archive law and charter ballot resolution

The Committee on Governmental Operations, State & Federal Legislation held a hearing and approved two items by unanimous roll call votes (8-0, with one member absent). It approved Int. 0564-2024-A, which would create an archive of official government social media accounts, and Res. 0740-2025, which calls on the state legislature to pass a bill eliminating a rule that bars other referendum proposals when a city charter commission puts a proposal on the ballot.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0564-2024 — Approved by Committee
8 yea · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino absent · Lynn C. Schulman yea · Inna Vernikov yea
Res 0740-2025 — Approved by Committee
8 yea · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino absent · Lynn C. Schulman yea · Inna Vernikov yea
Wed Mar 12, 2025 · 9:30 AM

Committee on Criminal Justice

Committee will consider five local laws on correctional visitation and reporting

The Criminal Justice Committee will hear five proposed local laws. The bills address child visitation to Department of Correction facilities, probation reporting of technical violations, an online scheduling system for visits, quarterly visitation reporting requirements, and correctional health reporting on court‑ordered forensic psychiatric examinations. The committee will discuss and may vote on each proposal.

criminal-justicecorrectionsprobationchild-visitationhealthreporting
✓ Decided: Committee approves five bills on jail visits, probation reporting

The Committee on Criminal Justice unanimously approved five amended local laws (Intros 420-A, 977-A, 1023-A, 1026-A, 1036-A) by roll call vote of 9-0. The bills cover child visitation programs at correction facilities, probation violation reporting, online visit scheduling, visitation notification recording, and forensic psychiatric exam reporting. All items were amended by the committee before approval.

Committee Room - City Hall VOTE*
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
Int 0420-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Int 0977-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Int 1023-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Int 1026-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Int 1036-2024 — Approved by Committee
9 yea
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Wed Mar 12, 2025 · 10:30 AM

Committee on Immigration

Committee to consider local law on NYC ID card applications and two immigration resolutions

The Committee on Immigration will consider a proposed local law (Int. No. 216-A) that would amend the city’s administrative code to improve the application process for the New York City identity card. It will also discuss two resolutions urging the New York State Legislature and the Governor to enact the New York for All Act (A.3506/S.2235) and the Access to Representation Act (A.270/S.141), which address immigration status disclosure and the right to legal counsel in immigration court.

immigrationidentity-cardlocal-lawlegislationcouncil
✓ Decided: Committee approves ID card application changes and two immigration resolutions

The Committee on Immigration approved Int. 0216-2024-A, amending the NYC identity card application process, by a 7-0 vote. It also approved Res. 0714-2025-A supporting the New York for All Act and Res. 0717-2025 supporting the Access to Representation Act, both by 7-0 votes.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0216-2024 — Approved by Committee
7 yea
Alexa Avilés yea · Erik D. Bottcher yea · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan yea
Res 0714-2025 — Approved by Committee
7 yea
Alexa Avilés yea · Erik D. Bottcher yea · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan yea
Res 0717-2025 — Approved by Committee
7 yea
Alexa Avilés yea · Erik D. Bottcher yea · Gale A. Brewer yea · Carmen N. De La Rosa yea · Shahana K. Hanif yea · Rita C. Joseph yea · Shekar Krishnan yea
Wed Mar 12, 2025 · 10:00 AM

Committee on Children and Youth

Proposed law to expand foster youth surveys to cover gender identity and orientation

The Committee on Children and Youth will consider three proposed local laws. The first would require the administration for children’s services to report annually on the number and placement of foster youth. The second would require an audit and report on foster care placement notices. The third would expand foster youth experience surveys to include questions about gender expression, gender identity, sex characteristics, and sexual orientation.

childrenyouthfoster-carelocal-lawreportingsurveysgender-identity
✓ Decided: Committee approves three foster care transparency bills

The Committee on Children and Youth held hearings, proposed and adopted amendments, and then approved three local laws related to foster care. All three bills were approved unanimously by the six members present. The bills require annual reporting on foster youth numbers and placements, an audit and report on foster care placement notices, and expansion of foster youth experience surveys to include gender expression, identity, sex characteristics, and sexual orientation.

Council Chambers - City Hall VOTE*
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
Int 0056-2024 — Approved by Committee
6 yea
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé yea · Nantasha M. Williams yea
Int 0081-2024 — Approved by Committee
6 yea
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé yea · Nantasha M. Williams yea
Int 1052-2024 — Approved by Committee
6 yea
Althea V. Stevens yea · Rita C. Joseph yea · Linda Lee yea · Julie Menin yea · Chi A. Ossé yea · Nantasha M. Williams yea
Wed Mar 12, 2025 · 9:30 AM

Committee on General Welfare

Council committee urges state to adopt Working Families Tax Credit

The Committee on General Welfare will consider two resolutions. The first urges the New York State Legislature and the Governor to enact the Working Families Tax Credit (S.2082/A.3474). The second calls on the state to create a food‑benefits program for people over 55 who do not qualify for existing assistance. Both resolutions request state action.

tax-creditsfood-assistancestate-legislationwelfarecommittee
✓ Decided: Committee approves resolutions urging NY State to create Working Families Tax Credit and food benefits program

The Committee on General Welfare held hearings and approved two amended resolutions. Res 0041-2024-A, calling on the state to create the Working Families Tax Credit, was approved 8-0. Res 0057-2024-A, urging the state to create a food benefits program for those ineligible for existing benefits, including those over 55, was also approved 8-0. Both resolutions were amended by the committee before approval.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Res 0041-2024 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley absent · Althea V. Stevens yea · Sandra Ung yea
Res 0057-2024 — Approved by Committee
8 yea · 1 absent
Diana I. Ayala yea · Alexa Avilés yea · Chris Banks yea · Tiffany L. Cabán yea · Chi A. Ossé yea · Lincoln Restler yea · Kevin C. Riley absent · Althea V. Stevens yea · Sandra Ung yea
Tue Mar 11, 2025 · 2:00 PM

Committee on Land Use

Land Use Committee will hear FY 2026 budget, capital plan, and mayor's report

The Committee on Land Use will hold budget and oversight hearings on the city's Preliminary Budget for FY 2026, the Preliminary Capital Plan for FY 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings are scheduled with the Department of City Planning at 2 p.m., the Landmarks Preservation Commission at 3 p.m., and a public session at 4 p.m. No decisions are listed on the agenda.

budgetcapital-planmayor-reportplanninglandmarkspublic-hearing
✓ Decided: Land Use Committee holds budget oversight hearing on FY2026 plan

The Committee on Land Use held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. Testimony was heard from the Department of City Planning and the Landmarks Preservation Commission. The hearing was filed by the committee with no substantive decisions made.

Committee Room - City Hall
Tue Mar 11, 2025 · 11:30 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee considers map, zoning and development actions for The Beacon and other sites

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider a series of applications submitted by the New York City Department of Housing Preservation and Development and the Department of Citywide Administrative Services. Items include a City Map amendment to close a portion of East 120th Street between 1st Avenue and Pleasant Avenue and related grade and block adjustments for the Beacon development, zoning map changes converting R7‑2 and R7X districts to R8, and the designation of an Urban Development Action Area and project for property at 413 East 120th Street. Additional proposals cover zoning changes for 581 Grant Avenue in Brooklyn, mandatory inclusionary housing amendments, tax exemption requests for properties on Davidson Avenue and West 128th‑129th Street, a property transfer to Health + Hospitals, and site selection for a new 547‑seat primary school on Zerega Avenue.

zoningurban-development-action-areahousingschoolshealth-hospitalslandmarks
✓ Decided: Subcommittee approves four Beacon land use applications for East Harlem

The Subcommittee on Landmarks, Public Sitings and Dispositions approved four land use applications related to 'The Beacon' development in East Harlem (Manhattan Community District 11, Council District 8), including a city map amendment, zoning map amendment, urban development action area designation, and zoning resolution amendment for mandatory inclusionary housing. All four were approved with six affirmative votes and one conflict (Salaam). The subcommittee also approved two applications for the 2201 Davidson Avenue project in the Bronx and one for 1093-1095 Jerome Avenue, each with the same 6-1 vote. Several other applications were laid over, including the 581 Grant Avenue Development in Brooklyn and the H+H Operating Agreement.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
LU 0225-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0226-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0227-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0228-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0237-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0247-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
LU 0248-2025 — Approved by Subcommittee
6 yea · 1 conflict
Kamillah Hanks yea · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam conflict
Tue Mar 11, 2025 · 1:30 PM

Committee on Land Use

City proposes eliminating part of Flushing Meadows park and closing Grand Central Parkway segment

The Land Use Committee will consider a series of applications affecting streets, zoning, urban development areas, and property transfers across Manhattan, Brooklyn, the Bronx, and Queens. Items include a street closure on East 120th Street, zoning upgrades for The Beacon project, an Urban Development Action Area at 581 Grant Avenue, a property transfer to H+H hospitals, and a map amendment that would remove a portion of Flushing Meadows Corona Park and close a segment of Grand Central Parkway. The committee will vote on these proposals during the March 11 meeting.

zoningstreetsparksdevelopmenthousingurban-development
✓ Decided: Committee approves Beacon housing project in East Harlem

The Committee on Land Use approved four applications related to The Beacon housing development in East Harlem (Manhattan Community District 11), including a city map amendment, zoning map change, urban development action area designation, and mandatory inclusionary housing area. All four applications were approved unanimously (10-0) with companion resolutions. The committee also approved several other housing-related applications and laid over others for further review.

Committee Room - City Hall
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
LU 0225-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0226-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0227-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0228-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0237-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0241-2025 — Disapproved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0247-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0248-2025 — Approved by Committee with Companion Resolution
10 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0249-2025 — Approved by Committee with Companion Resolution
9 yea · 1 abstain
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez abstain
LU 0250-2025 — Approved by Committee with Companion Resolution
9 yea · 1 abstain
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez abstain
Tue Mar 11, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Subcommittee reviews rezoning and map changes for Queens and Manhattan

The Subcommittee on Zoning and Franchises is reviewing several land-use applications. These include rezoning requests in Queens and a sidewalk café application in Manhattan.

zoningqueensmanhattanland-usesidewalk-cafeparkland
✓ Decided: Subcommittee approves Queens Future rezoning and map changes

The Subcommittee on Zoning and Franchises held hearings and laid over two rezoning applications for 123-12 Sutphin Boulevard, disapproved a sidewalk café application for Le Dive at 37 Canal Street, and approved two Queens Future map change applications. All votes were 6-0 with one absence.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
LU 0241-2025 — Disapproved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam absent · Lynn C. Schulman yea
LU 0249-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam absent · Lynn C. Schulman yea
LU 0250-2025 — Approved by Subcommittee
6 yea · 1 absent
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam absent · Lynn C. Schulman yea
Tue Mar 11, 2025 · 9:30 AM

Committee on Public Safety

Public Safety Committee holds budget and oversight hearings

The Committee on Public Safety is conducting budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The body will also review the Fiscal 2025 Preliminary Mayor’s Management Report.

budgetoversightpolicepublic-safetycriminal-justice
✓ Decided: Public Safety Committee holds FY2026 budget oversight hearings

The Committee on Public Safety held oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. Hearings covered the Police Department, Civilian Complaint Review Board, District Attorneys/Special Narcotics Prosecutor, Mayor's Office of Criminal Justice, and public testimony. The hearings were filed by the committee; no substantive decisions were made.

Council Chambers - City Hall
Mon Mar 10, 2025 · 3:00 PM

Committee on Technology

Council Technology Committee will hear the FY 2026 budget and 2026‑2029 capital plan

The Committee on Technology will hold a budget and oversight hearing. The agenda includes review of the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The meeting includes a public portion at 4:00 p.m.

budgetcapital-plantechnologyoversightpublic-hearing
✓ Decided: Council tech committee holds budget hearing on OTI

The Committee on Technology held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report, focusing on the Office of Technology & Innovation. The hearing was held and subsequently filed by the committee. No substantive decisions were made.

Committee Room - City Hall
Mon Mar 10, 2025 · 10:30 AM

Committee on Public Housing

Council reviews FY 2026 budget and capital plan for NYC housing

The Committee on Public Housing will hold budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The hearings begin at 10:30 a.m. with the New York City Housing Authority and continue with a public session at 12:30 p.m.

budgethousingfinanceoversightcapital-plan
✓ Decided: Council committee holds oversight hearing on NYCHA preliminary budget

The Committee on Public Housing held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report, with testimony from the New York City Housing Authority and the public. The hearing was filed by the committee, but no substantive decisions or votes were recorded in the minutes.

Committee Room - City Hall
Mon Mar 10, 2025 · 10:00 AM

Committee on Aging

Committee on Aging to hold budget and oversight hearings

The Committee on Aging will conduct budget and oversight hearings regarding the Preliminary Budget for Fiscal Year 2026 and the Preliminary Capital Plan for Fiscal Years 2026-2029. The meeting includes a review of the Fiscal 2025 Preliminary Mayor’s Management Report and testimony from the Department for the Aging.

agingbudgetoversightgovernment-spending
✓ Decided: Committee on Aging holds budget oversight hearing on FY2026 preliminary budget

The Committee on Aging held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing included testimony from the Department for the Aging and the public. The oversight was filed by the committee.

Council Chambers - City Hall
Fri Mar 7, 2025 · 10:30 AM

Committee on Civil and Human Rights

Council will hold budget and capital plan hearings for FY 2026‑2029

The Committee on Civil and Human Rights will meet on March 7, 2025 to hear the City Council Budget and Oversight Hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. The agenda also lists hearings of the City Commission on Human Rights, the Equal Employment Practice Commission, the Commission on Racial Equity/CORE, and a public hearing. No decisions are indicated; the items are scheduled for discussion and review.

budgetcapital-planmayor-management-reporthuman-rightsemploymentracial-equity
✓ Decided: Council committee holds oversight hearing on FY 2026 preliminary budget

The Committee on Civil and Human Rights held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. The hearing covered the City Commission on Human Rights, the Equal Employment Practice Commission, and the Commission on Racial Equity. The hearing was held and then filed by the committee.

Committee Room - City Hall
Fri Mar 7, 2025 · 10:00 AM

Committee on Criminal Justice

Budget and oversight hearings on FY2026 budget and capital plan

The Committee on Criminal Justice will hold budget and oversight hearings on the city’s preliminary fiscal year 2026 budget, the preliminary capital plan for fiscal years 2026‑2029, and the fiscal 2025 preliminary Mayor’s Management Report. The agenda also includes hearings with the Department of Probation, Department of Correction, the Board of Correction, and a public hearing.

budgetcapital-plancriminal-justiceprobationcorrections
✓ Decided: Committee holds oversight hearing on FY2026 preliminary budget for criminal justice agencies

The Committee on Criminal Justice held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. Testimony was heard from the Department of Probation, Department of Correction, and Board of Correction, followed by public testimony. The hearing was held and the item was filed by the committee; no substantive votes or decisions were recorded.

Council Chambers - City Hall
Thu Mar 6, 2025 · 1:00 PM

Committee on Hospitals

Council will hold budget and capital plan hearings for FY 2026‑2029

The Committee on Hospitals will hold a budget and oversight hearing on the Preliminary Budget for Fiscal Year 2026. The hearing will also review the Preliminary Capital Plan for Fiscal Years 2026‑2029 and the Fiscal 2025 Preliminary Mayor’s Management Report. No other agenda items are listed.

budgetcapital-planhospitalsoversightfinance
✓ Decided: Committee holds budget oversight hearing on NYC Health + Hospitals

The Committee on Hospitals held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026-2029, and the Fiscal 2025 Preliminary Mayor’s Management Report, with testimony from the New York City Health and Hospitals Corporation. The hearing was held and filed by the committee; no substantive decisions were made.

250 Broadway - Committee Room, 14th Floor
Thu Mar 6, 2025 · 10:00 AM

Committee on Immigration

Committee reviews FY 2026 budget, capital plan, and immigration reports

The Committee on Immigration will hold budget and oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for Fiscal Years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. It will also hear from the Office of Immigrant Affairs, the Office of Immigrant Affairs & Office of Asylum Seeker Operations, and conclude with a public hearing.

budgetimmigrationoversightcapital-planmayor-reportpublic-hearing
✓ Decided: Committee holds oversight hearing on FY2026 immigrant affairs budget

The Committee on Immigration held an oversight hearing on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. Testimony was heard from the Mayor's Office of Immigrant Affairs and the Office of Asylum Seeker Operations, followed by public testimony. The hearing was filed by the committee with no formal decisions or votes recorded.

Council Chambers - City Hall
Thu Mar 6, 2025 · 10:00 AM

Subcommittee on Zoning and Franchises

Queens Future proposes major map changes affecting Flushing Meadows park and Grand Central Parkway

The Subcommittee on Zoning and Franchises will consider two applications submitted by Queens Future, LLC. The first (LU 0249‑2025) seeks to amend the Queens zoning map by establishing a C8‑4 district in place of an R3‑2 district in Joint Interest Area 81, covering Community Districts 3, 4, 6, 7, 8, 9 and Council District 21. The second (LU 0250‑2025) proposes a city map amendment that would eliminate part of Flushing Meadows Corona Park, close a segment of Grand Central Parkway, create new parkland, add a westbound ramp, and adjust grades, block dimensions, and property ownership.

zoningparkstransportationland-usemaps
✓ Decided: Zoning subcommittee hears two Queens Future land-use applications, lays both over

The Subcommittee on Zoning and Franchises held hearings on two land-use applications submitted by Queens Future, LLC, both affecting Community Districts 3, 4, 6, 7, 8, and 9 in Queens. The first application (LU 0249-2025) seeks a zoning map amendment to establish a C8-4 district. The second (LU 0250-2025) involves changes to the City Map, including eliminating a portion of Flushing Meadows Corona Park and a portion of Grand Central Parkway. After the hearings, the subcommittee laid over both applications, meaning no final vote was taken.

250 Broadway - Committee Room, 16th Floor
Wed Mar 5, 2025 · 10:30 AM

Committee on Finance

Committee reviews NYC’s FY 2026 preliminary budget and capital plan

The Committee on Finance will hold oversight hearings on the city’s preliminary budget for fiscal year 2026, the preliminary capital plan for fiscal years 2026‑2029, and the Fiscal 2025 Preliminary Mayor’s Management Report. Presentations will be given by the Office of Management and Budget, the Comptroller, the Independent Budget Office, the Department of Finance, followed by a public comment period. The agenda lists discussion and review only; no formal decisions are indicated.

budgetfinancecapital-planoversightmayor-report
✓ Decided: Council Finance Committee holds FY2026 preliminary budget oversight hearings

The Committee on Finance held oversight hearings on the Preliminary Budget for Fiscal Year 2026, the Preliminary Capital Plan for FY2026-2029, and the Fiscal 2025 Preliminary Mayor's Management Report. Hearings were held with the Office of Management and Budget, Comptroller, Independent Budget Office, Department of Finance, and the public. The oversight was filed by the committee.

Council Chambers - City Hall
Fri Feb 28, 2025 · 12:00 PM

Committee on Women and Gender Equity

Council to consider a resolution urging state law to protect gender‑affirming health data.

The Committee on Women and Gender Equity will review several items related to transgender, gender non‑conforming and nonbinary residents. Topics include oversight of support services, public outreach on legal rights, access to gender‑affirming care facilities, and health department plans. The committee will also consider resolutions urging state action on health information protections and adoption of professional standards of care.

gender-equitytransgender-rightshealth-carelegislationoversight
✓ Decided: Committee holds hearings on TGNCNB rights bills, lays over all items

The Committee on Women and Gender Equity held oversight hearings on access to supports for transgender, gender non-conforming, and non-binary (TGNCNB) New Yorkers and on several related bills and resolutions. All five introduced bills (Int 1200, 1201, 1203, 1204) and four resolutions (Res 0771, 0774, 0781, 0793) were laid over by the committee, meaning no final action was taken. The oversight item was filed. No substantive decisions were made.

Council Chambers - City Hall
Fri Feb 28, 2025 · 10:00 AM

Committee on Civil Service and Labor

Committee will examine pending layoffs at the Brooklyn Museum.

The Civil Service and Labor Committee will hold an oversight hearing on pending layoffs at the Brooklyn Museum. Members will review information about the proposed staff reductions. No other agenda items are listed.

laborlayoffsmuseumoversightcivil-service
✓ Decided: Committee holds oversight hearing on Brooklyn Museum layoffs

The Committee on Civil Service and Labor held an oversight hearing on pending layoffs at the Brooklyn Museum. The hearing was held and the item was filed by the committee. No substantive decisions were made.

250 Broadway - Committee Room, 14th Floor
Fri Feb 28, 2025 · 10:00 AM

Committee on Mental Health, Disabilities and Addiction

Council committee to vote on needle distribution near schools

The Committee on Mental Health, Disabilities and Addiction will consider two local laws regarding syringe service programs and a resolution urging New York State to mandate addiction treatment training for medical schools.

mental-healthaddictionsyringe-programseducationpublic-health
✓ Decided: Committee holds hearings on syringe laws, addiction training; all laid over

The Committee on Mental Health, Disabilities and Addiction held hearings on three items but took no final action, laying over all of them. Int 0868-2024 would prohibit mobile syringe service programs from distributing needles within 450 feet of schools and playgrounds. Int 1169-2025 addresses safe collection and disposal of needles and syringes. Res 0317-2024 calls on New York State to mandate addiction treatment training for medical schools receiving state funding. All items were laid over by the committee, meaning no vote was taken.

Committee Room - City Hall
Fri Feb 28, 2025 · 10:00 AM

Committee on Environmental Protection, Resiliency and Waterfronts

Local law to expand air-quality monitoring on heavy-use thoroughfares

The Committee on Environmental Protection, Resiliency and Waterfronts will consider two local law proposals. The first amendment would require air-quality monitoring at designated heavy-use thoroughfares. The second amendment would establish regulations for indirect sources of air pollution. Both items are pending committee action.

air-qualityenvironmentlegislationpollutioncity-council
✓ Decided: Committee holds hearings on air quality bills, lays over both introductions

The Committee on Environmental Protection, Resiliency and Waterfronts held oversight hearings on air quality and last-mile deliveries, and on two proposed local laws (Int 0107-2024 and Int 1130-2024) related to air quality monitoring and regulation of indirect pollution sources. Both introductions were laid over by the committee, meaning no final vote was taken. No substantive decisions were made beyond holding the hearings and filing the oversight report.

250 Broadway - Committee Room, 16th Floor
Thu Feb 27, 2025 · 9:30 AM

Committee on Public Safety

Police department to provide info and training on identity theft

The Committee on Public Safety will consider Local Law Int. 1101‑A, which amends the city’s administrative code to require the NYPD to provide information and officer training on identity theft. The proposal will be discussed at the February 27, 2025 meeting.

public-safetypoliceidentity-theftlocal-lawcity-council
✓ Decided: Committee approves police identity theft training bill

The Committee on Public Safety voted 7-0 to approve Int. 1101-A, a local law requiring the NYPD to provide information and officer training on identity theft. The bill was amended by the committee before approval. Four members were absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1101-2024 — Approved by Committee
7 yea · 4 absent
Yusef Salaam yea · Joann Ariola yea · Diana I. Ayala yea · Tiffany L. Cabán absent · Carmen N. De La Rosa yea · Robert F. Holden yea · Rita C. Joseph absent · Christopher Marte yea · Chi A. Ossé absent · Carlina Rivera absent · Althea V. Stevens yea
Thu Feb 27, 2025 · 4:30 PM

Committee on Standards and Ethics

Committee on Standards and Ethics holds oversight meeting

The Committee on Standards and Ethics is meeting to conduct oversight pursuant to Council Rule 10.80. No other specific items or decisions are listed on the agenda.

oversightethicscity-council
✓ Decided: Ethics committee holds oversight hearing, files transcript

The Committee on Standards and Ethics met on February 27, 2025, with all five members present. The committee held an oversight hearing pursuant to Council Rule 10.80 and subsequently filed the hearing transcript. No substantive decisions were made; the meeting was procedural in nature.

250 Broadway - Committee Room, 16th Floor
Thu Feb 27, 2025 · 1:30 PM

City Council Stated Meeting

Council to vote on Prospect Avenue rezoning in Brooklyn

The New York City Council will consider two resolutions modifying the City Planning Commission's decisions on the 441 & 467 Prospect Avenue rezoning in Brooklyn. It will also review a land‑use call‑up for a Queens Future Map Change and amendment, and consider tax‑exemption resolutions for properties in the Bronx and Brooklyn. Additional items include a local law to create a housing development fund outreach office and various committee reports.

zoningfinancehousingpublic-safetysanitationgovernment-operations
✓ Decided: Council approves Queens Future map change review, housing tax breaks

The City Council approved a land use call-up to review the Queens Future Map Change and Amendment, and passed a consent agenda including housing tax exemptions in the Bronx and Brooklyn, several local laws on elder fraud education, youth board composition, and sanitation, and zoning changes for Prospect Avenue in Brooklyn. Two resolutions on state public health funding and guardianship were adopted by voice vote. Numerous new bills and resolutions were introduced and referred to committees.

Council Chambers - City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
M 0113-2025 — Approved, by Council
38 yea · 9 absent · 1 medical · 1 nay
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu absent · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers absent · Tiffany L. Cabán absent · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks medical · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy nay · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé absent · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera absent · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez absent · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won absent · Susan Zhuang yea
The other 20 items passed by unanimous or near-unanimous consent.
Thu Feb 27, 2025 · 11:00 AM

Committee on Children and Youth

Council will consider two local laws on counsel info and youth board makeup.

The Committee on Children and Youth will consider two proposed local laws. The first, Int. 0009-2024, would amend the city’s administrative code to require providing information about obtaining counsel at the first point of contact during a covered proceeding. The second, Int. 0794-2024, would amend the city charter to change the composition of the youth board. Both items are pending proposals.

legal-aidyouth-boardcharteradministrative-codecouncil-committee
✓ Decided: Committee approves two youth-related bills, including counsel info at first contact

The Committee on Children and Youth approved two local laws. Int. No. 9-B, which requires providing information about obtaining counsel at the first point of contact during covered proceedings, was approved by a roll call vote of 4-0 (with two members absent). Int. No. 794-A, which amends the New York City charter regarding the composition of the youth board, was also approved by a roll call vote of 4-0 (with two members absent). Both bills now proceed to the full Council.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0009-2024 — Approved by Committee
4 yea · 2 absent
Althea V. Stevens yea · Rita C. Joseph absent · Linda Lee yea · Julie Menin yea · Chi A. Ossé absent · Nantasha M. Williams yea
Int 0794-2024 — Approved by Committee
4 yea · 2 absent
Althea V. Stevens yea · Rita C. Joseph absent · Linda Lee yea · Julie Menin yea · Chi A. Ossé absent · Nantasha M. Williams yea
Thu Feb 27, 2025 · 11:00 AM

Committee on Criminal Justice

Committee to consider law on Department of Correction sexual abuse reports

The Committee on Criminal Justice is meeting to discuss Proposed Int. No. 1061-A. This legislation seeks to amend the administrative code regarding reports on sexual abuse from the Department of Correction.

criminal-justicedepartment-of-correctionpublic-safetylegislation
✓ Decided: Committee approves amended jail sexual abuse reporting bill

The Committee on Criminal Justice voted 8-0 (with one member absent) to approve an amended version of Intro 1061-A, which requires the Department of Correction to report on sexual abuse. The bill was amended by the committee before approval. The measure now advances to the full City Council.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 1061-2024 — Approved by Committee
8 yea · 1 absent
Sandy Nurse yea · Shaun Abreu yea · Diana I. Ayala yea · Tiffany L. Cabán absent · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler yea · Althea V. Stevens yea
Thu Feb 27, 2025 · 10:30 AM

Committee on Governmental Operations, State & Federal Legislation

Council to consider charter amendment for domestic‑violence survivors’ voting privacy.

The Committee on Governmental Operations will consider Local Law Int. 565‑A, a proposed amendment to the New York City charter. The amendment would give survivors of domestic violence guidance on keeping their voter registration records confidential and on voting by special ballot. The council will discuss adopting this amendment.

votingdomestic-violencecharter-amendmentelectionsprivacy
✓ Decided: Committee approves domestic violence voter privacy bill

The Committee on Governmental Operations, State & Federal Legislation voted 8-0 (with one parental absence) to approve Int. No. 565-A, a local law amending the NYC charter to provide survivors of domestic violence with guidance on making voter registration records confidential and voting by special ballot. The bill had been heard, amended, and then approved by the committee.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0565-2024 — Approved by Committee
8 yea · 1 absent
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Vickie Paladino yea · Lynn C. Schulman yea · Inna Vernikov yea
Thu Feb 27, 2025 · 9:30 AM

Committee on Sanitation and Solid Waste Management

Council to consider law requiring free waste containers for small residential buildings

The Committee on Sanitation and Solid Waste Management will consider two proposed local laws. Int 0498-2024 would amend the administrative code to require community gardens to apply for organic waste collection by the Department of Sanitation. Int 1126-2024 would require the Department of Sanitation to provide official waste containers at no cost to residential buildings with two or fewer dwelling units, with a provision for repeal after the law expires. The committee will vote on these proposals.

sanitationwaste-managementcommunity-gardensresidentialcontainers
✓ Decided: Committee approves two sanitation bills on organic waste and free bins

The Committee on Sanitation and Solid Waste Management approved two local laws. Int. 0498-2024-A requires community garden applications to request organic waste collection by the Department of Sanitation. Int. 1126-2024-A requires the city to provide official waste containers at no cost to certain residential buildings with 2 or fewer dwelling units, with a sunset provision. Both were approved unanimously (10-0) with one absence.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0498-2024 — Approved by Committee
10 yea · 1 absent
Shaun Abreu yea · Chris Banks yea · David M. Carr yea · James F. Gennaro yea · Julie Menin yea · Sandy Nurse yea · Vickie Paladino yea · Rafael Salamanca, Jr. absent · Sandra Ung yea · Inna Vernikov yea · Susan Zhuang yea
Int 1126-2024 — Approved by Committee
10 yea · 1 absent
Shaun Abreu yea · Chris Banks yea · David M. Carr yea · James F. Gennaro yea · Julie Menin yea · Sandy Nurse yea · Vickie Paladino yea · Rafael Salamanca, Jr. absent · Sandra Ung yea · Inna Vernikov yea · Susan Zhuang yea
Thu Feb 27, 2025 · 10:30 AM

Committee on Aging

Committee on Aging to discuss elder fraud education and public guardianship

The Committee on Aging is meeting to consider a local law regarding education for older adults and a resolution concerning a statewide public guardianship system. The session focuses on financial literacy and protections for vulnerable New Yorkers.

agingelder-fraudfinancial-literacyguardianshippublic-health
✓ Decided: Committee approves elder fraud education bill and guardianship resolution

The Committee on Aging approved Intro 1092-A, a local law to educate older adults about elder fraud, end-of-life preparation, and financial literacy, with amendments. It also approved Resolution 561, calling on the state to create a statewide public guardianship system. Both passed 5-0 with two members absent.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 1092-2024 — Approved by Committee
5 yea · 2 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy absent · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Res 0561-2024 — Approved by Committee
5 yea · 2 absent
Crystal Hudson yea · Chris Banks yea · Linda Lee absent · Darlene Mealy absent · Yusef Salaam yea · Lynn C. Schulman yea · Susan Zhuang yea
Thu Feb 27, 2025 · 10:00 AM

Committee on Finance

Council Finance Committee reviews budget and two land‑use parcels

The Committee on Finance will preconsider the City Council’s operating budget and the schedule for the lump‑sum OTPS unit of appropriation. It will also preconsider two land‑use items: one for parcels in the Bronx (BRC Cluster 3, blocks 2436‑2479) and another for a parcel in Brooklyn (Block 3215, Lot 22).

budgetfinanceland-usezoningbronxbrooklyn
✓ Decided: Council Finance Committee approves Council operating budget and land use items

The Committee on Finance approved the Council's operating budget (M 0111-2025) and the schedule for lump sum OTPS appropriations (M 0112-2025), each with a companion resolution. It also approved two land use applications: BRC Cluster 3 in the Bronx (LU 0242-2025) and B&R in Brooklyn (LU 0243-2025), each with a companion resolution. All items passed by a roll call vote of 13 in favor, 3 absent, and 1 parental leave.

Committee Room - City Hall VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
M 0111-2025 — P-C Item Approved by Committee with Companion Resolution
13 yea · 4 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers absent · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
M 0112-2025 — P-C Item Approved by Committee with Companion Resolution
13 yea · 4 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers absent · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0242-2025 — P-C Item Approved by Committee with Companion Resolution
13 yea · 4 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers absent · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
LU 0243-2025 — P-C Item Approved by Committee with Companion Resolution
13 yea · 4 absent
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers absent · David M. Carr yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens yea · Nantasha M. Williams yea · Julie Won absent
Thu Feb 27, 2025 · 10:00 AM

Committee on Health

Council Health Committee will consider a resolution urging state aid for city public health services.

The Committee on Health will consider Resolution 0782‑2025. The resolution asks the New York State Legislature to pass, and the Governor to sign, bill A.2705/S.4801, which would address the amount of state aid reimbursement for public health services provided by New York City municipalities. The committee will discuss the proposed changes to state aid for core public health services.

healthbudgetstate-aidlegislationpublic-health
✓ Decided: Committee approves resolution urging state aid for NYC public health services

The Committee on Health voted unanimously (9-0) to approve Resolution 0782-2025-A, which calls on the New York State Legislature to pass and the Governor to sign A.2705/S.4801. The resolution concerns the amount of state aid reimbursement for public health services provided by New York City. The committee also amended the resolution before approval.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0782-2025 — P-C Item Approved by Comm
9 yea
Lynn C. Schulman yea · Joann Ariola yea · Carmen N. De La Rosa yea · Oswald J. Feliz yea · James F. Gennaro yea · Kristy Marmorato yea · Julie Menin yea · Mercedes Narcisse yea · Susan Zhuang yea
Wed Feb 26, 2025 · 10:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee reviews property dispositions and tax exemptions in the Bronx and other boroughs

The Subcommittee on Landmarks, Public Sitings and Dispositions will consider applications for property transfers and tax exemptions. These include the designation of an Urban Development Action Area in the Bronx and the transfer of multiple properties to NYC Health + Hospitals.

housingreal-estatetax-exemptionsbronxmanhattanbrooklynpublic-health
✓ Decided: Landmarks subcommittee holds hearings, lays over four land use items

The subcommittee held hearings on four land use applications (LU 0237-2025, LU 0238-2025, LU 0247-2025, LU 0248-2025) but took no final action, laying over all items. No substantive decisions were made; the items remain pending.

250 Broadway - Committee Room, 16th Floor
Wed Feb 26, 2025 · Deferred

Committee on Civil and Human Rights

Resolution to designate July 2 as Thurgood Marshall Day in NYC

The Committee on Civil and Human Rights will consider a resolution (Res 0520-2024) that would recognize July 2 each year as Thurgood Marshall Day, honoring his civil‑rights legacy. The committee will also discuss an oversight item (T2025-3022) marking 70 years since Brown v. Board of Education and ways to advance diversity and equity in NYC public institutions. The education committee will be a co‑sponsor of the Thurgood Marshall Day resolution.

civil-rightseducationdiversity-equityholidayslegislation
Council Chambers - City Hall Jointly with the Committee on Education
Wed Feb 26, 2025 · Deferred

Committee on Education

Committee on Education to hold oversight hearing on diversity and equity

The Committee on Education will conduct an oversight hearing regarding diversity and equity in NYC Public schools 70 years after Brown v. BOE. The committee will also consider a resolution to recognize July 2 annually as Thurgood Marshall Day.

educationcivil-rightsdiversity-and-equitypublic-schools
Council Chambers - City Hall Jointly with the Committee on Civil and Human Rights.
Wed Feb 26, 2025 · 10:00 AM

Committee on Public Housing

Oversight of transparency at NYCHA

The Committee on Public Housing will hold a meeting on February 26, 2025 at 10:00 AM. The agenda includes an oversight item titled “Transparency at NYCHA” (T2025-2989). The committee will discuss transparency issues related to the New York City Housing Authority. No specific decisions or proposals are detailed in the agenda.

housingnychaoversighttransparency
✓ Decided: Committee holds oversight hearing on NYCHA transparency

The Committee on Public Housing held an oversight hearing on transparency at NYCHA (T2025-2989) and subsequently filed a report on the matter. No other substantive decisions were made; the meeting was limited to the hearing and filing.

Committee Room - City Hall
Tue Feb 25, 2025 · 10:00 AM

Committee on Contracts

Council Committee on Contracts to review food quality in city shelters

The Committee on Contracts will hold an oversight hearing regarding food quality in New York City shelters. The committee will also consider a local law requiring standardized feedback surveys from food services contractors.

contractssheltersfood-servicesoversight
✓ Decided: Committee holds hearing on shelter food quality, lays over feedback survey bill

The Committee on Contracts, jointly with the Committee on Economic Development, held an oversight hearing on food quality in New York City shelters and filed the oversight report. The committee also held a hearing on Intro 0905-2024, which would require standardized feedback surveys from food services contractors, but laid the bill over without a vote.

Committee Room - City Hall Jointly with the Committee on Economic Development
Tue Feb 25, 2025 · 10:00 AM

Committee on Fire and Emergency Management

Committee reviews Temporary Certificates of Occupancy process

The Committee on Fire and Emergency Management is holding an oversight hearing. The discussion focuses on the process and inspections of New York City’s Temporary Certificates of Occupancy.

oversightbuilding-inspectionspublic-safetycertificates-of-occupancy
✓ Decided: Committee holds oversight hearing on temporary certificates of occupancy

The Committee on Fire and Emergency Management held an oversight hearing on the process and inspections of New York City's temporary certificates of occupancy. The hearing was held and the oversight was filed by the committee. No substantive decisions were made.

Council Chambers - City Hall
Tue Feb 25, 2025 · 10:00 AM

Committee on Economic Development

Local law to require feedback surveys from shelter food service contractors

The Committee on Economic Development will consider a Local Law amendment to the New York City Administrative Code that would require standardized feedback surveys from food‑service contractors operating in city shelters. The item, listed as Oversight – Food Quality in New York City Shelters (T2025‑3055), will be considered jointly with the Committee on Contracts.

food-qualityshelterscontractsoversightlocal-laweconomic-development
✓ Decided: Council committee holds hearing on food quality in NYC shelters

The Committee on Economic Development, jointly with the Committee on Contracts, held an oversight hearing on food quality in New York City shelters. The committee also heard testimony on Intro 0905-2024, which would require standardized feedback surveys from food services contractors, but laid the bill over without a vote.

Committee Room - City Hall Jointly with the Committee on Contracts.
Tue Feb 25, 2025 · 1:00 PM

Committee on Aging

Committee on Aging to discuss kinship caregiving resources for older adults

The Committee on Aging will hold an oversight hearing regarding resources for older adult kinship caregivers. The committee will also consider a local law to establish a program supporting older adults providing kinship care.

agingkinship-caresocial-servicesolder-adults
✓ Decided: Committee holds hearing on kinship care for older adults, lays over bill

The Committee on Aging held an oversight hearing on older adult kinship caregiving resources and filed the oversight. It also held a hearing on Intro 1184-2025, which would establish a program to support older adults providing kinship care, and laid the bill over without a vote.

Committee Room - City Hall
Mon Feb 24, 2025 · Deferred

Committee on Transportation and Infrastructure

New law would require taxis to display cyclist‑safety decals on doors

The Transportation and Infrastructure Committee will consider several local law proposals affecting taxis and for‑hire vehicles. Items include a decal requirement to warn passengers about cyclists, an extension of vehicle retirement dates set during the COVID‑19 emergency, a study on electric for‑hire vehicles and charging infrastructure, and a limit on liability‑coverage requirements. The committee will also hold an oversight hearing on the status of the yellow‑cab industry.

taxisafetyelectric-vehiclesliabilityoversighttransportation
Committee Room - City Hall
Mon Feb 24, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Council will consider rezoning 123-12 Sutphin Blvd and a new sidewalk café permit.

The Subcommittee on Zoning and Franchises will review two rezoning applications for 123-12 Sutphin Boulevard in Queens, proposing changes to the zoning district and establishing a Mandatory Inclusionary Housing area. It will also consider a revocable consent to operate a sidewalk café at 37 Canal Street in Manhattan. The decisions involve amendments to the Zoning Map, the Zoning Resolution, and approval of the café permit.

zoninghousingdevelopmentrestaurantsqueensmanhattan
✓ Decided: Subcommittee hears and lays over Sutphin Blvd rezoning and sidewalk café applications

The Subcommittee on Zoning and Franchises held hearings on three land use applications but took no final action, laying over all items. The applications include a zoning map amendment and a Mandatory Inclusionary Housing designation for 123-12 Sutphin Boulevard in Queens, and a revocable consent for a sidewalk café at 37 Canal Street in Manhattan. No votes were recorded.

250 Broadway - Committee Room, 16th Floor
Mon Feb 24, 2025 · 10:00 AM

Committee on Public Safety

Committee considers bans on minor DNA collection and criminal group databases

The Committee on Public Safety is reviewing two proposed local laws. These include restrictions on police DNA collection from minors and the abolition of the criminal group database.

public-safetypolicedna-collectioncriminal-databasesminors-rights
✓ Decided: Committee holds hearings on police DNA and gang database bills

The Committee on Public Safety held hearings on two proposed local laws but did not vote on either. Both bills were laid over by the committee, meaning no final action was taken.

Council Chambers - City Hall
Fri Feb 21, 2025 · Deferred

Committee on Mental Health, Disabilities and Addiction

City proposes to ban mobile syringe services within 450 ft of schools and playgrounds

The Committee on Mental Health, Disabilities and Addiction will consider two Local Law proposals: one to prohibit mobile syringe service programs from distributing hypodermic syringes within 450 feet of schools and playgrounds, and another to establish safe collection and disposal of needles and syringes. The committee will also consider a resolution urging New York State to require basic addiction‑treatment training for medical schools that receive state funding. All items are on the agenda for the February 21, 2025 meeting.

mental-healthaddictionpublic-healthsyringesschools
Committee Room - City Hall
Thu Feb 20, 2025 · 1:00 PM

Committee on Children and Youth

Committee to evaluate New York City's foster care system

The Committee on Children and Youth will hold an oversight hearing. The session is focused on evaluating the New York City foster care system.

childrenyouthfoster-careoversight
✓ Decided: Committee holds oversight hearing on NYC foster care system

The Committee on Children and Youth held an oversight hearing to evaluate New York City's foster care system. The hearing was held and the oversight item was filed by the committee. No substantive decisions were made; the meeting was procedural in nature.

250 Broadway - Committee Room, 14th Floor
Thu Feb 20, 2025 · 10:00 AM

Committee on Civil and Human Rights

Committee to review the State of Black New York and racial equity planning

The Committee on Civil and Human Rights will hold an oversight meeting. The discussion focuses on the State of Black New York and the Racial Equity Planning Process.

civil-rightsracial-equityoversight
✓ Decided: Committee holds oversight hearing on State of Black New York

The Committee on Civil and Human Rights held an oversight hearing on the State of Black New York and the racial equity planning process. The hearing was held and subsequently filed by the committee. No substantive decisions were made; the item was an oversight hearing only.

Council Chambers - City Hall
Thu Feb 20, 2025 · 10:00 AM

Committee on Education

Education Committee reviews early child care center closures.

The Committee on Education will hold an oversight session on early child care center closures (Agenda item T2025-3145). No other agenda items are listed.

educationearly-child-careoversightcity-council
✓ Decided: Committee holds oversight hearing on early child care center closures

The Committee on Education held an oversight hearing on early child care center closures and filed the associated report. No substantive decisions were made; the item was a hearing and filing only.

Committee Room - City Hall
Wed Feb 19, 2025 · 1:00 PM

Committee on Veterans

Committee on Veterans to discuss homeless veterans and veteran-related local laws

The Committee on Veterans will hold an oversight hearing on addressing the needs of homeless veterans. The body will also consider four local laws regarding veteran preferences in housing, community board committees, business procurement, and therapy pilot programs.

veteranshomelessnesshousingprocurementhealthcare
✓ Decided: Committee holds hearing on homeless veterans, lays over all bills

The Committee on Veterans held an oversight hearing on addressing the needs of homeless veterans and heard testimony on five local laws. All five introductions were laid over by the committee, meaning no final action was taken. The bills covered veteran preference in Mitchell-Lama housing, community board veterans committees, procurement opportunities for veteran-owned businesses, and a study on reconsolidation of traumatic memories therapy.

250 Broadway - Committee Room, 14th Floor
Wed Feb 19, 2025 · 10:00 AM

Committee on Technology

Committee will review NYPD’s implementation of the POST Act.

The Technology Committee will examine the NYPD’s implementation of the POST Act. It will consider four local‑law amendments: one to expand the Department of Investigation’s oversight of police surveillance technology, one to create a policy and regular audits for facial‑recognition use, one to increase transparency of police surveillance tools, and one to require the 311 customer service center to provide resources for tree‑pruning requests. These items will be considered jointly with the Committee on Public Safety and the Committee on Oversight and Investigations.

police-surveillancefacial-recognitiontransparency311-servicesoversighttechnology
✓ Decided: Tech committee holds hearings, lays over five tech bills

The Committee on Technology, jointly with Public Safety and Oversight and Investigations, held hearings on five proposed technology-related introductions (Int 0168-2024, Int 0233-2024, Int 0480-2024, Int 0978-2024, and T2025-3018, an oversight resolution). All five items were laid over by the committee, meaning no final vote was taken. No substantive decisions were made beyond holding the hearings and laying over the items.

Committee Room - City Hall Jointly with the Committee on Public Safety and the Committee on Oversight and Investigations
Wed Feb 19, 2025 · 10:00 AM

Committee on Public Safety

Committee reviews NYPD's use of surveillance technology under POST Act

The Committee on Public Safety will examine the NYPD’s implementation of the Police Surveillance Technology (POST) Act. Members will consider three local law proposals to amend the city administrative code for police oversight of surveillance technology, establish a facial‑recognition policy with regular audits, and increase transparency of surveillance use. The agenda also includes a proposal requiring the 311 customer service center to provide resources for tree‑pruning requests.

policesurveillancetechnologyoversightlocal-lawenvironment
✓ Decided: NYC Council committee holds hearings on NYPD surveillance tech bills

The Committee on Public Safety, jointly with Technology and Oversight committees, held oversight hearings on the NYPD's implementation of the POST Act and on four proposed local laws related to surveillance technology, facial recognition, and 311 tree pruning resources. All four bills were laid over by the committee, meaning no final vote was taken. The oversight report on the POST Act was filed by the committee.

Committee Room - City Hall Jointly with the Committee on Technology and the Committee on Oversight and Investigations.
Wed Feb 19, 2025 · 10:00 AM

Committee on Health

Resolution urging free over‑the‑counter naloxone nationwide

The City Council Health Committee will consider several resolutions, including a call for the federal government to make over‑the‑counter naloxone free for everyone. Other items include designating March as Blood Clot Awareness Month, urging state legislation for CDPAP fiscal intermediaries, eliminating cost‑sharing for asthma inhalers, and delaying Medicaid disproportionate‑share hospital payment reductions. The committee will also discuss state aid reimbursement for public health services provided by New York City municipalities.

healthnaloxoneasthmamedicaidblood-clotlegislationpublic-health
✓ Decided: Committee holds hearings on public health emergency oversight and resolutions

The Committee on Health held hearings on oversight of public health emergency detection, prevention, and response, and on several resolutions, but took no final votes. All resolutions were laid over by the committee, meaning no substantive decisions were made.

Council Chambers - City Hall Jointly with the Subcommittee on COVID & Infectious Diseases.
Wed Feb 19, 2025 · 10:00 AM

Committee on Oversight and Investigations

Committee examines NYPD POST Act implementation and surveillance laws

The Committee on Oversight and Investigations will examine the NYPD's implementation of the POST Act. The body will also consider four local laws regarding police surveillance technology and 311 tree pruning requests.

policesurveillanceoversightfacial-recognition311trees
✓ Decided: Committee holds hearings on five bills, lays all over

The Committee on Oversight and Investigations, jointly with Public Safety and Technology, held hearings on five proposed laws (Int 0168-2024, Int 0233-2024, Int 0480-2024, Int 0978-2024, and T2025-3020). All five items were laid over by the committee, meaning no final action was taken. No substantive decisions were made.

Committee Room - City Hall Jointly with the Committee on Public Safety and the Committee on Technology
Thu Feb 13, 2025 · 1:30 PM

City Council Stated Meeting

Council approves multiple zoning amendments and Bronx tax exemptions

The New York City Council will adopt minutes from the January 23 meeting, consider resignations of Council Member Joseph C. Borelli, and designate new minority leadership. It will also receive communications and reports, and vote on several land‑use and finance items, including tax‑exemption resolutions for Bronx properties and a series of zoning map changes in Brooklyn, Bronx and Manhattan.

zoningtax-exemptionscouncil-resignationsminority-leader-designationland-usefinance
✓ Decided: Council approves $1.2B revenue appropriation and SPARC Kips Bay project

The City Council approved a $1.2 billion appropriation of new city revenues for Fiscal Year 2025, along with a resolution approving the modification (MN-4). The Council also approved the SPARC Kips Bay project, a major development including zoning changes, a special permit for a laboratory, and the disposition and acquisition of city-owned property at 425 East 25th Street for a forensic pathology center and medical examiner facility. Several other land use applications were approved, including rezoning for 455 First Avenue, 2185 Coyle Street, 438 Concord Avenue, and 122-03 14th Avenue, while a demapping application for 49-39 Van Dam Street was disapproved.

Council Chambers - City Hall
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0732-2025 — Approved, by Council
42 yea · 6 nay · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 56 items passed by unanimous or near-unanimous consent.
Thu Feb 13, 2025 · 10:00 AM

Committee on Education

Committee will consider two local law proposals on afterschool info and student journalism.

The Education Committee will review two proposed local laws that would amend the city’s administrative code. The first proposal would require the city to distribute information about after‑school programs. The second proposal would address student journalism programming in public high schools.

educationafterschoolstudent-journalismlocal-lawcity-council
✓ Decided: Committee approves afterschool info and student journalism bills

The Committee on Education approved two local laws: Int. 0432-2024-A, which requires distributing information about afterschool programs, and Int. 1057-2024-A, which relates to student journalism programming in NYC public high schools. Both were approved by a roll call vote of 11-0, with Council Members Gennaro and Gutiérrez absent (marked as Medical and Parental, respectively).

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0432-2024 — Approved by Committee
11 yea · 1 medical · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro medical · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Int 1057-2024 — Approved by Committee
11 yea · 1 medical · 1 absent
Rita C. Joseph yea · Eric Dinowitz yea · James F. Gennaro medical · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Mercedes Narcisse yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea
Thu Feb 13, 2025 · 11:00 AM

Committee on Consumer and Worker Protection

Local Law to require market‑value disclosures on unsolicited home purchase offers

The Committee on Consumer and Worker Protection will consider two proposed local laws. The first would amend the administrative code to require that unsolicited offers to purchase certain residential properties include a disclosure of market value. The second would amend the city charter to require the city to provide homeownership information to homeowners and their heirs. Both items are listed as proposed legislation (Int. No. 888‑A and Int. No. 901‑A).

housingconsumer-protectionproperty-disclosurehomeownershiplegislation
✓ Decided: Committee approves two housing disclosure bills

The Committee on Consumer and Worker Protection approved two local laws. Int. 0888-2024-A requires unsolicited offers to purchase certain residential properties to include disclosures of market value. Int. 0901-2024-A requires providing certain homeownership information to homeowners and their heirs. Both were approved unanimously by roll call vote of 7-0.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0888-2024 — Approved by Committee
7 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won yea
Int 0901-2024 — Approved by Committee
7 yea
Julie Menin yea · Shaun Abreu yea · Gale A. Brewer yea · Amanda C. Farías yea · Shekar Krishnan yea · Chi A. Ossé yea · Julie Won yea
Thu Feb 13, 2025 · 11:00 AM

Committee on Technology

Council will consider a law to require reporting on next‑gen 911 rollout

The Committee on Technology will consider two proposed local laws. The first would amend the city’s administrative code to require public service announcements in American Sign Language on advertising structures for deaf and hard‑of‑hearing individuals. The second would amend the code to require reporting on the implementation of next‑generation 911 services. Both items are listed as proposed introductions 138‑A and 646‑A.

technologyaccessibilitypublic-safetycommunicationslegislation
✓ Decided: Committee approves ASL public service announcement and next-gen 911 reporting laws

The Committee on Technology held hearings and unanimously approved two local laws. Int. No. 138-A requires public service announcements in American Sign Language on advertising structures for deaf or hard of hearing individuals. Int. No. 646-A mandates reporting on the implementation of next generation 911. Both were approved 5-0.

Committee Room - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0138-2024 — Approved by Committee
5 yea
Jennifer Gutiérrez yea · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Int 0646-2024 — Approved by Committee
5 yea
Jennifer Gutiérrez yea · Erik D. Bottcher yea · Robert F. Holden yea · Vickie Paladino yea · Julie Won yea
Thu Feb 13, 2025 · 9:30 AM

Committee on Finance

Council Finance Committee to consider $1.2 billion FY2025 revenue appropriation

The Committee on Finance will consider a resolution to approve new designations and changes for certain organizations to receive funding in the expense budget. It will also review settlements for the SHF Cluster in Bronx Community Districts 4 and 6 and for the MBD Cluster 3 in Bronx Community District 5. Additionally, the committee will receive a communication from the Office of Management & Budget regarding the appropriation of $1.2 billion in new city revenues for fiscal year 2025.

financebudgetappropriationsrevenuenyc-councilbronx
✓ Decided: Committee approves $1.2B revenue appropriation and housing land use items

The Committee on Finance approved a resolution designating organizations for Expense Budget funding (11-1), two land use applications for housing settlements in the Bronx with companion resolutions (12-0), and a communication from the Office of Management & Budget appropriating $1.2 billion in new city revenues for Fiscal Year 2025 (12-0). All items were approved by roll call vote.

Committee Room - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0732-2025 — P-C Item Approved by Comm
11 yea · 5 absent · 1 nay
Justin L. Brannan yea · Diana I. Ayala absent · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé yea · Keith Powers yea · Yusef Salaam absent · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams yea · Julie Won absent
The other 3 items passed by unanimous or near-unanimous consent.
Thu Feb 13, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Committee will consider two Local Law amendments on resurfacing and markings

The Transportation and Infrastructure Committee will consider two proposed Local Laws that would amend the city’s administrative code. One bill would require coordination of street resurfacing projects. The other would require the installation of pavement markings. Both items are listed as proposed Int. No. 552-A and Int. No. 1160-A.

transportationinfrastructurelocal-lawstreet-maintenancepavement-markings
✓ Decided: Committee approves two street safety bills on resurfacing and pavement markings

The Committee on Transportation and Infrastructure voted unanimously (9-0) to approve two local laws. Int. No. 552-A requires coordination of street resurfacing, and Int. No. 1160-A mandates installation of pavement markings. Both were amended by the committee before approval.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0552-2024 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Int 1160-2025 — Approved by Committee
9 yea
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera yea · Julie Won yea
Thu Feb 13, 2025 · 10:30 AM

Committee on Criminal Justice

Council committee to consider two criminal‑justice reforms on staff safety

The Committee on Criminal Justice will consider two proposed local laws. One would require the Department of Correction to report on sexual assault and harassment of correctional staff and to provide staff access to mental‑health treatment resources. The other would require the Department to use an electronic case‑management system to track investigations of sexual abuse.

criminal-justicecorrectionssexual-assaultmental-healthcase-management
✓ Decided: Committee approves two bills on DOC sexual assault reporting and tracking

The Committee on Criminal Justice approved two local laws requiring the Department of Correction to report on sexual assault and harassment of staff, provide mental health resources, and use an electronic case management system to track sexual abuse investigations. Both bills were approved by roll call vote of 7-0, with one member medically absent and one on parental leave.

Council Chambers - City Hall VOTE*
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
Int 0735-2024 — Approved by Committee
7 yea · 1 medical · 1 absent
Sandy Nurse yea · Shaun Abreu medical · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler absent · Althea V. Stevens yea
Int 0792-2024 — Approved by Committee
7 yea · 1 medical · 1 absent
Sandy Nurse yea · Shaun Abreu medical · Diana I. Ayala yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Christopher Marte yea · Mercedes Narcisse yea · Lincoln Restler absent · Althea V. Stevens yea
Wed Feb 12, 2025 · 10:00 AM

Committee on Health

Committee on Health to discuss HIV/AIDS service provisions

The Committee on Health is meeting to conduct oversight of the HASA Administration. Members will consider a local law regarding services for people living with HIV and AIDS and a resolution urging New York State to limit shelter costs for those receiving housing assistance.

healthhiv-aidshousingsocial-servicesoversight
✓ Decided: Committee holds oversight on HASA, advances HIV services bill

The Committee on Health, jointly with General Welfare, held an oversight hearing on HASA administration and filed the committee report. It also heard and laid over Intro 1194-2025, which would amend the administrative code regarding services for people living with HIV/AIDS, and laid over Resolution 0175-2024, which calls on the state to mandate benefit linkage and cap shelter costs at 30% of income for people with HIV. No final votes were taken on the legislation.

Council Chambers - City Hall Jointly with the Committee on General Welfare
Wed Feb 12, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

Prospect Avenue rezoning and inclusionary housing proposals before subcommittee

The Subcommittee on Zoning and Franchises will consider multiple zoning map amendments and special permits. Items include rezoning 441 & 467 Prospect Avenue from an R5B to an R7-1 district and establishing a Mandatory Inclusionary Housing area there. The agenda also contains rezoning and special permit applications for 455 First Avenue, SPARC Kips Bay, 122-03 14th Avenue, and a demapping request for a portion of Gale Avenue at Van Dam Street.

zoninginclusionary-housingrezoningspecial-permitsmanhattanbrooklynqueens
✓ Decided: Subcommittee approves multiple rezoning and SPARC Kips Bay applications

The Subcommittee on Zoning and Franchises approved all land use applications on the agenda, including rezoning for 441 & 467 Prospect Avenue, 455 First Avenue, SPARC Kips Bay, and 122-03 14th Avenue, as well as a demapping for 49-39 Van Dam Street. Each application was approved with modifications and referred to the City Planning Commission (CPC). All votes were unanimous (7-0).

Committee Room - City Hall
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
LU 0212-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0213-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0214-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0215-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0216-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0217-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0218-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0219-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0220-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0221-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0222-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0223-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0224-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0229-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0230-2025 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0231-2025 — Disapproved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed Feb 12, 2025 · Deferred

Committee on Environmental Protection, Resiliency and Waterfronts

Committee will consider amendments to NYC air-quality code

The Committee on Environmental Protection, Resiliency and Waterfronts will review two proposed local laws that would amend the city’s administrative code. One proposal would require air-quality monitoring on designated heavy-use thoroughfares, and the other would regulate indirect sources of air pollution. Both items are listed as internal items (Int 0107-2024 and Int 1130-2024).

air-qualityenvironmentpollutionregulationcity-council
250 Broadway - Committee Room, 14th Floor
Wed Feb 12, 2025 · 12:00 PM

Committee on Land Use

Land Use Committee to review SPARC Kips Bay forensic pathology center

The Committee on Land Use is reviewing several zoning amendments, landmark designations, and property acquisitions. Key items include the development of a forensic pathology center at 425 East 25th Street and various Mandatory Inclusionary Housing area establishments.

zoninglandmarkshousingmanhattanbrooklynqueens
✓ Decided: Committee approves SPARC Kips Bay and other land use applications

The Committee on Land Use held hearings and approved all land use applications on the agenda, including the designation of the Jacob Day Residence as a historic landmark, the rezoning of 441 & 467 Prospect Avenue, the 455 First Avenue development, the SPARC Kips Bay project, and the 122-03 14th Avenue rezoning. The committee also disapproved the demapping of a portion of Gale Avenue at 49-39 Van Dam Street. All votes were 9-0 with one non-voting member.

Committee Room - City Hall
🗳️ How they voted (17 roll-call votes)
Named votes as recorded in the official record.
LU 0207-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0212-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0213-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0214-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0215-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0216-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0217-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0218-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0219-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0220-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0221-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0222-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0223-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0224-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0229-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0230-2025 — Approved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0231-2025 — Disapproved by Committee with Companion Resolution
9 yea · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks absent · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Wed Feb 12, 2025 · 10:00 AM

Committee on General Welfare

Resolution urging NY State to limit shelter costs for people with HIV to 30% income

The Committee on General Welfare will consider a pre‑considered resolution (Res 0175‑2024) that asks the New York State Legislature and Governor to adopt S.183/A.2418, amending the Social Services Law to link persons living with HIV to benefits and cap their shelter costs at no more than 30% of household income. The committee will also review a local law amendment (Oversight – HASA Administration, T2024‑2887) to the city administrative code concerning services for people living with HIV and AIDS. The resolution is being considered jointly with the Committee on Health.

healthhousingsocial-serviceshiv-aidslegislation
✓ Decided: Committee holds hearing on HIV/AIDS services, lays over bills

The Committee on General Welfare, jointly with the Committee on Health, held an oversight hearing on HASA administration and heard testimony on Intro 1194, a local law regarding services for people living with HIV/AIDS. The committee filed the oversight report and laid over the introduction and a related state resolution without voting on them. No final decisions were made on the proposed legislation.

Council Chambers - City Hall Jointly with the Committee on Health.
Tue Feb 11, 2025 · 1:00 PM

Committee on Consumer and Worker Protection

Council considers limits on credit card minimums and fuel hold disclosures

The Committee on Consumer and Worker Protection will hold an oversight hearing on retail consumer financial experiences. The committee will also consider three local laws regarding credit card transaction minimums, petroleum product preauthorization holds, and flexible benefit cards.

consumer-protectionretailcredit-cardsbankinglocal-law
✓ Decided: Committee holds hearing on credit card minimum purchase bill, lays over all items

The Committee on Consumer and Worker Protection held an oversight hearing on consumer financial experiences in the retail industry and heard testimony on three proposed local laws. All three introductions—prohibiting credit card minimum purchase requirements over $10, requiring disclosure of fuel preauthorization holds, and requiring retail stores to accept flexible benefit cards—were laid over by the committee without a vote. No final decisions were made; all items remain pending.

Council Chambers - City Hall
Tue Feb 11, 2025 · Deferred

Committee on Environmental Protection, Resiliency and Waterfronts

Committee will consider two local laws on air‑quality monitoring and indirect pollution

The Environmental Protection, Resiliency and Waterfronts Committee will discuss two proposed local laws. One would amend the city code to require air‑quality monitoring on designated “heavy use” thoroughfares (Int 0107-2024). The other would amend the code to regulate indirect sources of air pollution (Int 1130-2024). No decisions are recorded in the agenda.

air-qualityenvironmentlegislationmonitoringpollution
Committee Room - City Hall
Tue Feb 11, 2025 · Deferred

Committee on Higher Education

CUNY oversight meeting for immigrant students

The Committee on Higher Education will hold an oversight meeting to discuss serving immigrant students at CUNY. The meeting is scheduled for Tuesday, February 11, 2025, at 10:00 AM in the Committee Room at City Hall.

educationcunyimmigrationoversight
Committee Room - City Hall
Mon Feb 10, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Resolution seeks state surcharge to fund wheelchair‑accessible and electric FHVs

The committee will consider several local laws affecting taxis and for‑hire vehicles, including a decal warning for cyclists, an extension of vehicle retirement dates, a study on electric for‑hire vehicles, and a limit on required liability coverage. It will also hold oversight of the Yellow Cab industry. Additionally, the committee will consider a resolution urging the state legislature and governor to create a surcharge on for‑hire vehicles to fund wheelchair‑accessible and all‑electric vehicles.

transportationtaxisfor-hire-vehicleselectric-vehiclesaccessibilitylegislationcity-council
✓ Decided: Committee holds hearing on yellow cab industry, lays over all bills

The Committee on Transportation and Infrastructure held an oversight hearing on the status of the yellow cab industry and heard testimony on five proposed local laws and one resolution. All items were laid over by the committee, meaning no final action was taken. The proposals included requiring door-opening decals, extending taxi retirement dates, studying electric for-hire vehicles, limiting liability coverage, and a resolution on a surcharge for wheelchair-accessible and electric vehicles.

Council Chambers - City Hall
Wed Feb 5, 2025 · 11:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Jacob Day Residence to be considered for historic landmark designation

The Subcommittee will review several applications, including the designation of the Jacob Day Residence at 50 West 13th Street as a historic landmark (DL-543/LP-2658). It will also consider a map amendment to close a portion of East 120th Street and related grade and block adjustments, zoning changes for The Beacon from R7-2/R7X to R8, and Urban Development Action Area designations for 413 East 120th Street and 581 Grant Avenue, along with associated zoning and inclusionary‑housing amendments.

landmarkszoninghousingdevelopmentinclusionary-housingmanhattanbrooklyn
✓ Decided: Subcommittee approves Jacob Day Residence landmark designation

The Subcommittee on Landmarks, Public Sitings and Dispositions approved the designation of the Jacob Day Residence at 50 West 13th Street as a historic landmark. All other applications, including those for The Beacon and 581 Grant Avenue developments, were heard and laid over without a vote.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0207-2025 — Approved by Subcommittee
5 yea · 2 absent
Kamillah Hanks absent · Justin L. Brannan yea · Amanda C. Farías yea · Oswald J. Feliz yea · Christopher Marte yea · Sandy Nurse yea · Yusef Salaam absent
Tue Feb 4, 2025 · Deferred

Committee on General Welfare

Oversight hearing on HASA Administration with the Health Committee

The Committee on General Welfare will hold an oversight hearing on the HASA Administration. The hearing is conducted jointly with the Committee on Health. No decisions or votes are listed in the agenda.

oversighthealthwelfare
Council Chambers - City Hall Jointly with the Committee on Health.
Tue Feb 4, 2025 · Deferred

Committee on Health

Health Committee will conduct oversight of the HASA Administration

The City Council Committee on Health will hold an oversight meeting on the HASA Administration. The meeting is held jointly with the Committee on General Welfare. No specific actions or proposals are listed in the agenda.

healthoversighthasageneral-welfarecity-council
Council Chambers - City Hall Jointly with the Committee on General Welfare
Thu Jan 30, 2025 · 10:00 AM

Committee on Higher Education

Oversight of the New CUNY School of Medicine

The Committee on Higher Education will hold an oversight session for the New CUNY School of Medicine. This agenda item is listed as T2024-2891. No other matters are listed for discussion.

higher-educationoversightcunyeducation
✓ Decided: Committee holds oversight hearing on new CUNY School of Medicine

The Committee on Higher Education held an oversight hearing regarding the new CUNY School of Medicine (T2024-2891). The hearing was held and subsequently filed by the committee. No substantive decisions were made; the item was limited to discussion and testimony.

Committee Room - City Hall
Thu Jan 30, 2025 · 10:00 AM

Committee on Contracts

Committee to consider returning funds from incarcerated individuals' commissary accounts

The Committee on Contracts is meeting to conduct oversight on contracted jail services. The body will also consider a local law regarding the return of remaining commissary funds to individuals released from custody.

contractsjail-servicescommissary-fundscriminal-justice
✓ Decided: Committee holds hearing on contracted jail services, lays over commissary bill

The Committee on Contracts, jointly with the Committee on Criminal Justice, held an oversight hearing on contracted jail services (T2025-2961) and filed the oversight. The committee also held a hearing on Intro 0825-2024, which would return commissary account funds to incarcerated individuals upon release, and laid the bill over without a vote.

Council Chambers - City Hall Jointly with the Committee on Criminal Justice
Thu Jan 30, 2025 · 1:30 PM

Committee on Small Business

Council considers new law creating a commercial landlord watch list

The Small Business Committee will consider three Local Laws. One would create a commercial landlord watch list. Another would order a study and report on fees and costs to start and maintain a small business. A third would amend the code to provide geographically targeted regulatory compliance services for small businesses.

small-businesslocal-lawregulationeconomic-development
✓ Decided: Committee holds hearing on small business legal challenges, lays over three bills

The Committee on Small Business, jointly with the Committee on Economic Development, held an oversight hearing on legal and regulatory challenges facing small businesses. Three proposed local laws were heard and laid over by the committee: a commercial landlord watch list (Int 0449-2024), a study on business fees and costs (Int 1082-2024), and geographically targeted regulatory compliance services (Int 1132-2024). No final votes were taken on these introductions.

Committee Room - City Hall Jointly with the Committee on Economic Development.
Thu Jan 30, 2025 · 1:30 PM

Committee on Economic Development

Committee to discuss small business regulations and commercial landlord watch list

The Committee on Economic Development will hold an oversight hearing on legal and regulatory challenges facing small businesses. The body will also consider three local laws regarding small business costs and landlord oversight.

small-businesscommercial-landlordsregulatory-complianceeconomic-development
✓ Decided: Committee holds hearing on small business legal challenges, lays over 3 bills

The Committee on Economic Development, jointly with the Committee on Small Business, held an oversight hearing on legal and regulatory challenges facing small businesses. The committee also held hearings on three proposed local laws—a commercial landlord watch list (Int 0449-2024), a study on small business fees and costs (Int 1082-2024), and geographically targeted regulatory compliance services (Int 1132-2024)—but laid over all three without a vote. No final decisions were made.

Committee Room - City Hall Jointly with the Committee on Small Business
Thu Jan 30, 2025 · 1:00 PM

Committee on Education

Committee on Education to oversee DOE special education services

The Committee on Education is holding an oversight meeting regarding the Department of Education’s provision of special education services.

educationspecial-educationdoeoversight
✓ Decided: Committee holds oversight hearing on DOE special education services

The Committee on Education held an oversight hearing on the Department of Education's provision of special education services (T2024-2882). The hearing was held and the oversight was filed by the committee. No substantive decisions were made.

Council Chambers - City Hall
Thu Jan 30, 2025 · 1:00 PM

Committee on Parks and Recreation

Consider amendment to city code to prioritize tree maintenance and reduce park brush fires

The Committee on Parks and Recreation will hold a preconsidered meeting jointly with the Committee on Fire and Emergency Management. It will discuss a local law amendment to the administrative code for tree maintenance prioritization (Int 0800-2024). It will also discuss a local law amendment to the administrative code for a plan to mitigate wildfires in parks (T2025-3015). An oversight item on preventing brush fires in parks (T2025-2950) is also on the agenda.

parksfire-preventionwildfiretree-maintenancecity-codepublic-safety
✓ Decided: Committee holds hearing on preventing brush fires in parks

The Committee on Parks and Recreation, jointly with the Committee on Fire and Emergency Management, held an oversight hearing on preventing brush fires in parks. The oversight was filed by the committee. Two proposed local laws were heard and laid over: one on tree maintenance prioritization (Int 0800-2024) and one on a plan to mitigate wildfires in parks (Int 1185-2025). No final decisions were made on these items.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Fire and Emergency Management.
Thu Jan 30, 2025 · 1:00 PM

Committee on Fire and Emergency Management

Council committee discusses preventing brush fires and wildfires in city parks

The Committee on Fire and Emergency Management is meeting to conduct oversight on preventing brush fires in parks. The body will also consider two local laws regarding tree maintenance prioritization and wildfire mitigation plans for parks under the Department of Parks and Recreation.

fire-safetyparkswildfirestree-maintenancepublic-safety
✓ Decided: Committee holds hearing on preventing brush fires in NYC parks

The Committee on Fire and Emergency Management, jointly with the Committee on Parks and Recreation, held an oversight hearing on preventing brush fires in parks (T2025-2966) and filed the oversight. The committee also held hearings on two proposed local laws: Int. 0800-2024, regarding tree maintenance prioritization, and Int. 1185-2025, regarding a plan to mitigate wildfires in parks. Both introductions were laid over by the committee, meaning no final action was taken.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Parks and Recreation
Thu Jan 30, 2025 · 11:00 AM

Committee on Land Use

No substantive items on the Land Use Committee agenda

The agenda for the New York City Council Committee on Land Use on Jan 30, 2025 lists only the committee members, location, and meeting time. No specific rezoning proposals, contracts, ordinances, fee changes, or public hearings are included. Therefore, the meeting will address only routine or procedural matters.

land-useprocedural
✓ Decided: Committee approves 2185 Coyle St rezoning with modifications

The Committee on Land Use held hearings and voted on four land use applications. It approved with modifications and referred to the City Planning Commission (CPC) the rezoning and Mandatory Inclusionary Housing designation for 2185 Coyle Street in Brooklyn, and the rezoning and Mandatory Inclusionary Housing designation for 438 Concord Avenue in the Bronx. A motion to approve the 2185 Coyle Street zoning map amendment failed by roll call, but the companion text amendment was approved.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
LU 0208-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 medical · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu medical · Joseph C. Borelli absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0209-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 medical · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu medical · Joseph C. Borelli absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0210-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 medical · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu medical · Joseph C. Borelli absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
LU 0211-2025 — Approved by Committee with Modifications and Referred to CPC
9 yea · 1 medical · 1 absent
Rafael Salamanca, Jr. yea · Shaun Abreu medical · Joseph C. Borelli absent · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Thu Jan 30, 2025 · 10:00 AM

Committee on Criminal Justice

Committee to review city jail contracts and commissary fund returns

The Committee on Criminal Justice will hold an oversight meeting to review contracted jail services and consider a local law regarding the return of commissary funds to incarcerated individuals upon release.

criminal-justicejailsoversightcommissarycontracts
✓ Decided: Council committee holds hearing on jail services, lays over commissary bill

The Committee on Criminal Justice, jointly with the Committee on Contracts, held an oversight hearing on contracted jail services (T2024-2890) and filed the oversight. The committee also held a hearing on Intro 0825-2024, which would return commissary account funds to incarcerated individuals upon release, and laid the bill over without a vote.

Council Chambers - City Hall Jointly with the Committee on Contracts.
Wed Jan 29, 2025 · Deferred

Committee on Education

Committee on Education to oversee DOE special education services

The Committee on Education will hold an oversight hearing regarding the Department of Education’s provision of special education services.

educationspecial-educationdoeoversight
Council Chambers - City Hall
Wed Jan 29, 2025 · Deferred

Committee on Parks and Recreation

Committee to discuss brush fire prevention and tree maintenance laws

The Committee on Parks and Recreation will hold an oversight hearing on preventing brush fires in parks. The committee will also consider a local law regarding the prioritization of tree maintenance.

parksfire-safetytree-maintenancepublic-safety
Council Chambers - City Hall Jointly with the Committee on Fire and Emergency Management.
Wed Jan 29, 2025 · Deferred

Committee on Fire and Emergency Management

Local law amendment to prioritize tree maintenance for brush fire prevention

The Committee on Fire and Emergency Management will consider a local law amendment (T2025-2966) to the New York City administrative code concerning tree maintenance prioritization. The proposal is aimed at preventing brush fires in city parks. The item is being reviewed jointly with the Committee on Parks and Recreation as part of the committee's oversight duties.

fire-safetyparkstree-maintenancelocal-lawenvironment
Council Chambers - City Hall Jointly with the Committee on Parks and Recreation
Wed Jan 29, 2025 · 1:00 PM

Committee on Fire and Emergency Management

Council committee to discuss flash flood emergency response and shelter pilot

The Committee on Fire and Emergency Management will hold an oversight hearing on flash flood preparation and response. The committee will also consider Int 0807-2024, which proposes a pilot program for shelter locations during flash flooding events.

emergency-managementfloodingpublic-safetyshelter
✓ Decided: Committee holds hearing on flash flood response, lays over shelter pilot bill

The Committee on Fire and Emergency Management held an oversight hearing on preparation and response to flash flood emergencies. The committee also held a hearing on Intro 0807-2024, a local law to create a pilot program providing shelter locations during flash flooding events, and laid the bill over without a vote. No final decisions were made on the legislation.

Council Chambers - City Hall
Wed Jan 29, 2025 · 11:30 AM

Subcommittee on Zoning and Franchises

Brooklyn's 2185 Coyle St rezoning proposes multiple district changes

The Subcommittee on Zoning and Franchises will consider several zoning map amendment applications. The agenda includes a rezoning of 2185 Coyle Street in Brooklyn that would replace an R4 district with R6A, R7A, and R7X districts, eliminate a C1‑2 district, and establish C2‑4 districts, as well as a Mandatory Inclusionary Housing designation for the same site. Additional items are rezoning applications for 438 Concord Avenue in the Bronx, 122‑03 14th Avenue in Queens, and a demapping of 49‑39 Van Dam Street in Queens.

zoninginclusionary-housingrezoningmap-amendmentbrooklynbronxqueens
✓ Decided: Subcommittee approves four Brooklyn and Bronx rezoning applications

The Subcommittee on Zoning and Franchises approved four land use applications with modifications and referred them to the City Planning Commission (CPC). These include rezoning and Mandatory Inclusionary Housing designations for 2185 Coyle Street in Brooklyn and 438 Concord Avenue in the Bronx. Three other applications were laid over without a decision.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
LU 0208-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0209-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0210-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
LU 0211-2025 — Approved by Subcommittee with Modifications and Referred to CPC
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed Jan 29, 2025 · 10:00 AM

Committee on Oversight and Investigations

Council considers charter amendment to change oversight of NYPD investigations

The Committee on Oversight and Investigations will review a local law (T2024-2845) that proposes amending the New York City charter to replace the individual responsible for implementing certain duties of the commissioner of investigation for the NYPD and to modify reporting on police investigations. The committee will also consider a resolution (Int 1020-2024) directing the Department of Investigation to determine what mayoral administrations knew about environmental toxins from the September 11, 2001 World Trade Center attacks and to submit a report to the Council. Both items are scheduled for discussion at the January 29, 2025 meeting.

charterpoliceoversightenvironmentinvestigationcity-council
✓ Decided: Committee holds oversight hearing on NYPD inspector general, lays over bills

The Committee on Oversight and Investigations held an oversight hearing on the Department of Investigation's Office of the Inspector General for the NYPD. The committee also held hearings on and laid over two items: a local law to replace the individual responsible for implementing certain duties of the commissioner of investigation relating to the police department, and a resolution directing the DOI to investigate mayoral administrations' knowledge of environmental toxins from the 9/11 attacks. No final votes were taken on these items.

Council Chambers - City Hall
Wed Jan 29, 2025 · Deferred

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee on Landmarks, Public Sitings and Dispositions meeting scheduled

The Subcommittee on Landmarks, Public Sitings and Dispositions is scheduled to meet on January 29, 2025. The provided agenda contains only procedural boilerplate and does not list specific items for decision or discussion.

landmarkspublic-sitingsdispositions
250 Broadway - Committee Room, 16th Floor
Wed Jan 29, 2025 · Deferred

Committee on Hospitals

Committee to examine New York City Opioid Settlement Fund investments

The Committee on Hospitals is holding an oversight hearing jointly with the Committee on Mental Health, Disabilities and Addiction. The body will examine investments from the New York City Opioid Settlement Fund.

healthcareopioidspublic-healthoversight
Council Chambers - City Hall Jointly with the Committee on Mental Health, Disabilities and Addiction
Wed Jan 29, 2025 · Deferred

Committee on Mental Health, Disabilities and Addiction

Committee will review NYC Opioid Settlement Fund investments

The Committee on Mental Health, Disabilities and Addiction will hold an oversight meeting to examine how the New York City Opioid Settlement Fund is being invested. The discussion will be conducted jointly with the Committee on Hospitals.

opioid-settlementmental-healthdisabilitiesaddictionoversightbudget
Council Chambers - City Hall Jointly with the Committee on Hospitals.
Tue Jan 28, 2025 · 1:00 PM

Committee on Hospitals

Committee reviews NYC Opioid Settlement Fund investments

The City Council Committee on Hospitals will meet on Jan 28, 2025 at 1 PM in the Committee Room at City Hall. The committee, together with the Committee on Mental Health, Disabilities and Addiction, will conduct oversight by examining investments of the New York City Opioid Settlement Fund. No other agenda items are listed.

opioid-settlementhospitalsmental-healthoversightfinance
✓ Decided: Council committee holds oversight hearing on opioid settlement fund investments

The Committee on Hospitals, jointly with the Committee on Mental Health, Disabilities and Addiction, held an oversight hearing to examine New York City's opioid settlement fund investments. The hearing was held and the related oversight item was filed by the committee. No substantive decisions were made; the meeting was procedural in nature.

Committee Room - City Hall Jointly with the Committee on Mental Health, Disabilities and Addiction
Tue Jan 28, 2025 · 1:00 PM

Committee on Children and Youth

Council committee to review police reporting on missing persons

The Committee on Children and Youth is meeting to conduct oversight on support for young victims of human trafficking. The committee will also consider a local law regarding New York City Police Department reporting on missing persons.

human-traffickingpolice-reportingmissing-personsyouth-services
✓ Decided: Council holds hearing on support for young trafficking victims

The Committee on Children and Youth, jointly with Public Safety and Women and Gender Equity committees, held an oversight hearing on support for young victims of human trafficking. The oversight was filed by the committee. A local law requiring the police department to report on missing persons (Int 0831-2024) had a hearing and was laid over by the committee, meaning no final action was taken.

Council Chambers - City Hall Jointly with the Committee on Public Safety and the Committee on Women and Gender Equity.
Tue Jan 28, 2025 · 1:00 PM

Committee on Public Safety

Local law requires NYPD to report on missing persons

The Committee on Public Safety will consider a Local Law to amend the New York City Administrative Code, requiring the police department to report on missing persons. The measure is part of oversight support for young victims of human trafficking and is coordinated with the Committee on Children and Youth and the Committee on Women and Gender Equity. The council will vote on this amendment during the January 28, 2025 meeting.

public-safetypolicemissing-personshuman-traffickinglegislation
✓ Decided: Council committee holds hearing on missing persons reporting bill

The Committee on Public Safety, jointly with the Committees on Children and Youth and Women and Gender Equity, held an oversight hearing on support for young victims of human trafficking. The committee also held a hearing on Intro 0831-2024, which would require the police department to report on missing persons, and then laid the bill over without a vote. No final decisions were made on the legislation.

Council Chambers - City Hall Jointly with the Committee on Children and Youth and the Committee on Women and Gender Equity
Tue Jan 28, 2025 · 1:00 PM

Committee on Women and Gender Equity

Local law to require NYPD reporting on missing persons

The Committee on Women and Gender Equity will consider a local law (Int 0831-2024) that amends the city administrative code to require the police department to report on missing persons. The meeting also includes oversight support for young victims of human trafficking (T2025-3000).

policemissing-personshuman-traffickingwomen-gender-equitycity-council
✓ Decided: Committee holds hearing on support for young trafficking victims, lays over police missing-persons bill

The Committee on Women and Gender Equity, jointly with the Committees on Children and Youth and Public Safety, held an oversight hearing on support for young victims of human trafficking (T2025-3000) and filed the oversight report. The committee also held a hearing on Intro 0831-2024, which would require the police department to report on missing persons, and laid the bill over without a vote.

Council Chambers - City Hall Jointly with the Committee on Children and Youth and the Committee on Public Safety
Tue Jan 28, 2025 · 1:00 PM

Committee on Public Housing

Committee to review older adult centers at NYCHA facilities

The Committee on Public Housing and the Committee on Aging are holding a joint oversight meeting. The discussion will focus on older adult centers located within NYCHA facilities.

public-housingsenior-servicesnychaoversight
✓ Decided: Council holds oversight hearing on older adult centers at NYCHA facilities

The Committee on Public Housing, jointly with the Committee on Aging, held an oversight hearing on older adult centers at NYCHA facilities (T2025-3002). The hearing was held and the oversight was filed by the committee. No substantive decisions or votes were recorded.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Aging
Tue Jan 28, 2025 · 1:00 PM

Committee on Mental Health, Disabilities and Addiction

Committee will examine investments of the NYC Opioid Settlement Fund

The Committee on Mental Health, Disabilities and Addiction will hold an oversight session to review the investment portfolio of the New York City Opioid Settlement Fund. The review will be conducted jointly with the Committee on Hospitals. The meeting is scheduled for January 28, 2025 at 1:00 PM in the Committee Room at City Hall.

mental-healthdisabilitiesaddictionopioid-settlementoversighthospitals
✓ Decided: Council holds oversight hearing on opioid settlement fund investments

The Committee on Mental Health, Disabilities and Addiction, jointly with the Committee on Hospitals, held an oversight hearing on January 28, 2025, to examine New York City's opioid settlement fund investments. The hearing was held and the oversight item was filed by the committee. No substantive decisions or votes were recorded.

Committee Room - City Hall Jointly with the Committee on Hospitals.
Tue Jan 28, 2025 · 1:00 PM

Committee on Aging

Committee on Aging will oversee older adult centers at NYCHA facilities

The Committee on Aging will hold an oversight session on older adult centers located in New York City Housing Authority (NYCHA) facilities. The session will be conducted jointly with the Committee on Public Housing. The committee will review operations and services for senior residents at these centers.

aginghousingnychapublic-housingoversight
✓ Decided: Committee holds oversight hearing on older adult centers at NYCHA facilities

The Committee on Aging, jointly with the Committee on Public Housing, held an oversight hearing on Older Adult Centers at NYCHA facilities (T2025-3001). The hearing was held and the oversight was filed by the committee. No substantive decisions were made; the meeting was procedural in nature.

250 Broadway - Committee Room, 16th Floor Jointly with the Committee on Public Housing.
Tue Jan 28, 2025 · Deferred

Committee on Environmental Protection, Resiliency and Waterfronts

Committee reviews air quality monitoring and pollution regulations

The Committee on Environmental Protection, Resiliency and Waterfronts is holding an oversight hearing on air quality and last mile deliveries. The body will also consider two local laws regarding air pollution monitoring and regulation.

air-qualitypollutionenvironmenttransportationoversight
Committee Room - City Hall
Mon Jan 27, 2025 · 10:00 AM

Committee on General Welfare

Oversight of CityFHEPS administration (T2024-2886)

The Committee on General Welfare will conduct oversight of the administration of the CityFHEPS program, identified as T2024-2886. The meeting is scheduled for Monday, January 27, 2025 at 10:00 AM in the Council Chambers at City Hall. No other agenda items are listed.

welfareoversightcityfheps
✓ Decided: Committee holds oversight hearing on CityFHEPS administration

The Committee on General Welfare held an oversight hearing on the administration of CityFHEPS (T2024-2886). The hearing was held and the oversight was filed by the committee. No substantive decisions were made; the meeting was procedural in nature.

Council Chambers - City Hall
Mon Jan 27, 2025 · 10:00 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Committee holds oversight hearing on arts and cultural workforce pathways

The Committee on Cultural Affairs, Libraries and International Intergroup Relations is meeting to conduct oversight. The session focuses on pathways into the arts and cultural workforce for New Yorkers.

artscultureworkforceoversight
✓ Decided: Committee holds oversight hearing on arts workforce pathways

The Committee on Cultural Affairs, Libraries and International Intergroup Relations held an oversight hearing on pathways into the arts and cultural workforce for New Yorkers. The hearing was held and subsequently filed by the committee. No substantive decisions were made; the item was an oversight hearing only.

Committee Room - City Hall
Mon Jan 27, 2025 · 1:00 PM

Committee on Civil Service and Labor

Committee to discuss civil service retention and exam fee waivers

The Committee on Civil Service and Labor will hold an oversight hearing on workforce retention. Members will also consider a local law regarding civil service examination fee waivers and two resolutions concerning minimum wage and laundry contracts.

civil-servicelaborminimum-wageemploymentgovernment-oversight
✓ Decided: Committee holds hearings on civil service retention, exam fees, wage resolutions

The Committee on Civil Service and Labor held oversight hearings on improving workforce retention in the civil service and on four legislative items, but took no final votes. All items—including a local law on civil service exam fee waivers and resolutions on subminimum wage and industrial laundry standards—were laid over by the committee, meaning no decisions were made.

250 Broadway - Committee Room, 16th Floor
Thu Jan 23, 2025 · 1:30 PM

City Council Stated Meeting

City Council receives preliminary FY2026 budget and financial plans

The City Council is reviewing the Mayor's preliminary expense, revenue, and capital budgets for Fiscal Year 2026. The body is also considering several local laws regarding student mental health, 311 survey requirements, and waste characterization studies.

budgetzoningmental-healthsanitationtransportationfinance
✓ Decided: Council approves 8 local laws, including 311 surveys and mental health programs

The City Council approved eight local laws, including requiring 311 customer satisfaction surveys, creating mental health pilot programs in schools, and requiring waste characterization studies. It also approved a resolution designating January 31 as Cecilia Gentili Day and recognized Auschwitz Remembrance Day. Several land use applications were approved, including a zoning map amendment for a funeral home commercial overlay in Queens.

Council Chambers - City Hall
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
Res 0712-2025 — Approved, by Council
39 yea · 8 nay · 2 absent · 1 abstain
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Joseph C. Borelli nay · Erik D. Bottcher absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden nay · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang abstain
Int 0077-2024 — Approved by Council
39 yea · 9 nay · 2 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola nay · Alexa Avilés yea · Chris Banks yea · Joseph C. Borelli nay · Erik D. Bottcher absent · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr nay · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks nay · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato nay · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino nay · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley nay · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. nay · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov nay · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
The other 11 items passed by unanimous or near-unanimous consent.
Thu Jan 23, 2025 · 11:30 AM

Committee on Governmental Operations, State & Federal Legislation

Council will consider a charter amendment on post‑employment rules for former officials

The Committee on Governmental Operations, State & Federal Legislation will consider two proposed local laws. The first would amend the city charter to regulate post‑employment activities of certain former public servants. The second would amend the administrative code to require the 311 customer service center to conduct satisfaction surveys after each request is closed and to publish the request and survey data monthly. No other items are listed on the agenda.

charterpost-employment311surveystransparency
✓ Decided: Committee approves post-employment restrictions for former NYC public servants

The Committee on Governmental Operations, State & Federal Legislation approved two local laws. Int. No. 77-A, amending the city charter to restrict post-employment activities of certain former public servants, passed 6-3. Int. No. 587-A, requiring the 311 customer service center to conduct satisfaction surveys and publish monthly data, was approved unanimously 9-0.

Committee Room - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Int 0077-2024 — Approved by Committee
6 yea · 3 nay
Lincoln Restler yea · Gale A. Brewer yea · David M. Carr nay · James F. Gennaro yea · Jennifer Gutiérrez yea · Shahana K. Hanif yea · Vickie Paladino nay · Lynn C. Schulman yea · Inna Vernikov nay
The other 1 item passed by unanimous or near-unanimous consent.
Thu Jan 23, 2025 · 10:30 AM

Committee on Sanitation and Solid Waste Management

Committee to consider waste characterization study requirements

The Committee on Sanitation and Solid Waste Management will meet to discuss a proposed local law. The legislation relates to requiring the Department of Sanitation to conduct waste characterization studies.

sanitationwaste-managementdepartment-of-sanitation
✓ Decided: Committee approves waste characterization study bill

The Committee on Sanitation and Solid Waste Management voted unanimously (11-0) to approve Int. No. 697-A, a local law requiring the Department of Sanitation to conduct waste characterization studies. The bill was amended by the committee before approval.

Council Chambers - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0697-2024 — Approved by Committee
11 yea
Shaun Abreu yea · Chris Banks yea · David M. Carr yea · James F. Gennaro yea · Julie Menin yea · Sandy Nurse yea · Vickie Paladino yea · Rafael Salamanca, Jr. yea · Sandra Ung yea · Inna Vernikov yea · Susan Zhuang yea
Thu Jan 23, 2025 · 10:30 AM

Committee on Cultural Affairs, Libraries and International Intergroup Relations

Council will adopt a resolution designating Jan 27 2025 as Auschwitz Remembrance Day

The Committee on Cultural Affairs, Libraries and International Intergroup Relations will consider Resolution 0713-2025. The resolution seeks to recognize January 27 2025 as the 80th anniversary of the liberation of the Auschwitz concentration camp and to establish an annual Auschwitz Remembrance Day in New York City. No other items are listed on the agenda.

cultural-affairshistorycommemorationholocaust-education
✓ Decided: Council committee approves resolution marking Auschwitz liberation anniversary

The Committee on Cultural Affairs, Libraries and International Intergroup Relations approved Resolution 0713-2025, which recognizes January 27, 2025, as the 80th anniversary of the liberation of the Auschwitz concentration camp and commemorates January 27 annually as Auschwitz Remembrance Day in New York City. The vote was 8-0 with one member absent.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Res 0713-2025 — P-C Item Approved by Comm
8 yea · 1 absent
Carlina Rivera yea · David M. Carr yea · Shahana K. Hanif yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Chi A. Ossé yea · Sandra Ung yea · Nantasha M. Williams absent
Thu Jan 23, 2025 · 10:00 AM

Committee on Finance

Committee to vote on resolution redesignating organizations for expense-budget funding

The Finance Committee will consider Resolution 0712-2025, which proposes a new designation and changes to the designation of certain organizations to receive funding from the city’s expense budget. The resolution, if approved, would alter which entities are eligible for expense-budget allocations.

financebudgetfundingcity-councilexpense-budget
✓ Decided: Finance Committee approves funding designation resolution 12-1

The Committee on Finance voted 12-1 to approve Resolution 0712-2025, which approves new designations and changes in designations of certain organizations to receive funding in the Expense Budget. Councilmember Carr voted against the resolution. Four members were absent.

Committee Room - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0712-2025 — P-C Item Approved by Comm
12 yea · 4 absent · 1 nay
Justin L. Brannan yea · Diana I. Ayala yea · Gale A. Brewer absent · Selvena N. Brooks-Powers yea · David M. Carr nay · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Farah N. Louis yea · Francisco P. Moya yea · Chi A. Ossé absent · Keith Powers yea · Yusef Salaam yea · Pierina Ana Sanchez yea · Althea V. Stevens absent · Nantasha M. Williams absent · Julie Won yea
Thu Jan 23, 2025 · 10:00 AM

Committee on Women and Gender Equity

Council to name Jan 31 Cecilia Gentili Day in NYC

The Committee on Women and Gender Equity will consider Resolution 0678‑2024. The resolution would designate January 31 each year as Cecilia Gentili Day in New York City to recognize her contributions to undocumented immigrants, sex workers, and LGBTQIA+ individuals.

womengender-equityhonorsculturecity-council
✓ Decided: Committee approves resolution designating Jan 31 as Cecilia Gentili Day

The Committee on Women and Gender Equity held a hearing and voted to approve Resolution 0678-2024, which designates January 31 annually as Cecilia Gentili Day in New York City to honor her advocacy for undocumented immigrants, sex workers, and LGBTQIA+ individuals. The resolution was approved by a roll call vote of 3-1, with Council Member Vernikov voting no and Council Member Gutiérrez absent.

Council Chambers - City Hall VOTE*
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Res 0678-2024 — Approved by Committee
3 yea · 1 absent · 1 nay
Farah N. Louis yea · Tiffany L. Cabán yea · Jennifer Gutiérrez absent · Kevin C. Riley yea · Inna Vernikov nay
Thu Jan 23, 2025 · 9:30 AM

Committee on Transportation and Infrastructure

Committee to consider suspending alternate side parking for Losar

The Committee on Transportation and Infrastructure will meet to discuss Int 0100-2024. This proposed local law would amend the city administrative code regarding alternate side parking regulations during Losar.

parkingtransportationadministrative-code
✓ Decided: Committee approves suspending alternate side parking on Losar

The Committee on Transportation and Infrastructure held a hearing and voted to approve Intro 0100-2024, a local law to suspend alternate side parking regulations on Losar. The vote was 8 in favor, with one member absent. The measure now moves to the full Council for consideration.

Committee Room - City Hall VOTE*
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Int 0100-2024 — Approved by Committee
8 yea · 1 absent
Selvena N. Brooks-Powers yea · Joann Ariola yea · Chris Banks yea · Carmen N. De La Rosa yea · Amanda C. Farías yea · Farah N. Louis yea · Mercedes Narcisse yea · Carlina Rivera absent · Julie Won yea
Wed Jan 22, 2025 · 1:00 PM

Committee on Veterans

Committee on Veterans to hold oversight hearing on Veterans Advisory Board

The Committee on Veterans will meet to conduct oversight regarding the New York City Veterans Advisory Board.

veteransoversightcity-board
✓ Decided: Committee holds oversight hearing on NYC Veterans Advisory Board

The Committee on Veterans held an oversight hearing regarding the New York City Veterans Advisory Board (T2025-2914). The hearing was held and subsequently filed by the committee. No substantive decisions or votes were recorded.

250 Broadway - Committee Room, 14th Floor
Wed Jan 22, 2025 · 10:00 AM

Committee on Sanitation and Solid Waste Management

Committee reviews DSNY snow plans and potential sidewalk penalty increases

The Committee on Sanitation and Solid Waste Management is conducting oversight of DSNY’s 2025 winter snow preparedness. Members will also consider legislation regarding DSNY emergency and resiliency plans and penalties for chain businesses that fail to clear sidewalks.

dsnysnow-removalpublic-safetysanitationcity-ordinances
✓ Decided: NYC sanitation committee holds snow preparedness hearing, lays over two bills

The Committee on Sanitation and Solid Waste Management held an oversight hearing on DSNY's snow preparedness plans for the 2025 winter season and filed the oversight. The committee also held hearings on two local laws—one on DSNY emergency and resiliency plans (Int 0355-2024) and another increasing penalties for chain businesses failing to remove snow, ice, and dirt from sidewalks (Int 0534-2024)—but laid over both introductions without voting. No final decisions were made on the bills.

250 Broadway - Committee Room, 14th Floor
Wed Jan 22, 2025 · 2:30 PM

Committee on Mental Health, Disabilities and Addiction

Committee will consider four proposed mental‑health related Local Laws for schools

The Committee on Mental Health, Disabilities and Addiction will review four proposed Local Laws that would amend the city’s administrative code. The bills address a pilot program placing mental‑health professional candidates in student wellness clubs, the creation of wellness‑club toolkits, peer‑based mental‑health literacy training for students, and community outreach on mental‑health resources after violent or traumatic incidents. All items are listed as proposed items (Int. No. 986‑A, 989‑A, 996‑A, 1103‑A).

mental-healthschoolswellnesslegislationcommunity-outreach
✓ Decided: Committee approves four mental health bills for student wellness and trauma outreach

The Committee on Mental Health, Disabilities and Addiction approved four local laws, all by unanimous 8-0 roll call votes. The bills cover a pilot program for mental health professional candidates in student wellness clubs, student wellness club toolkits, peer-based mental health literacy trainings, and community outreach on mental health resources after violent or traumatic incidents. Each was amended by the committee before approval.

250 Broadway - Committee Room, 16th Floor VOTE*
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
Int 0986-2024 — Approved by Committee
8 yea
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Kristy Marmorato yea · Darlene Mealy yea
Int 0989-2024 — Approved by Committee
8 yea
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Kristy Marmorato yea · Darlene Mealy yea
Int 0996-2024 — Approved by Committee
8 yea
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Kristy Marmorato yea · Darlene Mealy yea
Int 1103-2024 — Approved by Committee
8 yea
Linda Lee yea · Shaun Abreu yea · Erik D. Bottcher yea · Tiffany L. Cabán yea · Shahana K. Hanif yea · Farah N. Louis yea · Kristy Marmorato yea · Darlene Mealy yea
Tue Jan 21, 2025 · 10:00 AM

Committee on Transportation and Infrastructure

Cap on streetlight color temperature set in new local law

The Transportation and Infrastructure Committee will consider six local law proposals. These include a cap on the correlated color temperature of new and replacement streetlights, a timeline for street resurfacing, a pilot project for cool pavement, tracking progress toward the streets master plan, creation of an online capital project tracker, and repainting of pavement marking lines.

transportationinfrastructurestreetlightspavementstreets-master-plancapital-planningcool-pavement
✓ Decided: NYC Council committee holds hearings on street repair bills, lays over all

The Committee on Transportation and Infrastructure held oversight hearings on DOT capital planning and street repairs, and on six proposed local laws related to streetlights, resurfacing, cool pavement, streets master plan tracking, a capital project tracker, and pavement markings. All six introductions were laid over by the committee, meaning no final votes were taken. The oversight item was filed by the committee.

Council Chambers - City Hall
Tue Jan 21, 2025 · 1:00 PM

Committee on Consumer and Worker Protection

Committee will consider two local law amendments on worker‑time rules and complaints

The Committee on Consumer and Worker Protection will consider Local Law Int 0780‑2024, which would amend the city’s administrative code to align the Earned Safe and Sick Time Act with the Temporary Schedule Change Act. It will also consider Local Law Int 1081‑2024, which would require the Department of Consumer and Worker Protection to confirm receipt of fair‑work‑practice complaints and to notify the subject of an investigation. Both items are presented as amendments to the administrative code.

laborworker-protectionlocal-lawsick-timecomplaints
✓ Decided: Committee holds hearings on two worker protection bills, lays both over

The Committee on Consumer and Worker Protection held hearings on two proposed local laws but took no final action, laying both introductions over for future consideration. Int. 0780-2024 would align the Earned Safe and Sick Time Act with the Temporary Schedule Change Act, and Int. 1081-2024 would require the Department of Consumer and Worker Protection to confirm receipt of fair work practice complaints. No votes were taken on either measure.

Committee Room - City Hall
Fri Jan 17, 2025 · Deferred

Committee on General Welfare

Oversight of HASA Administration with the Health Committee

The Committee on General Welfare will hold a joint meeting with the Committee on Health to conduct oversight of the HASA Administration. The agenda item is identified as T2024-2887. No additional items or decisions are listed.

oversighthealthwelfare
Council Chambers - City Hall Jointly with the Committee on Health.
Fri Jan 17, 2025 · Deferred

Committee on Health

Health Committee will conduct oversight of the HASA Administration

The New York City Council Committee on Health will hold an oversight hearing on the HASA Administration. The meeting is set for Friday, January 17, 2025 at 10:00 AM in the Council Chambers. The hearing is conducted jointly with the Committee on General Welfare. No specific legislation, contracts, or fee changes are listed on the agenda.

healthoversightgovernmentcommittee
Council Chambers - City Hall Jointly with the Committee on General Welfare
Thu Jan 16, 2025 · 12:30 PM

Committee on Land Use

Proposal to create a C2-2 commercial district within an R2A zone in Queens

The Committee on Land Use will consider Application C 240363 ZMQ to amend the City Zoning Map. The amendment would establish a C2-2 commercial district inside an existing R2A district in Queens Community District 7, Council District 19. The request is submitted by Martin A. Gleason Funeral Home, LLC under Sections 197‑c and 201 of the New York City Charter.

zoningland-usequeenscommercial-overlayzoning-map
✓ Decided: Committee approves Gleason Funeral Home commercial overlay

The Committee on Land Use held a hearing and approved Land Use Application LU 0206-2024, which includes a commercial overlay for Gleason Funeral Home, with a companion resolution. The vote was unanimous, 11-0. The application had been previously heard at the December 19, 2024 stated meeting.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0206-2024 — Approved by Committee with Companion Resolution
11 yea
Rafael Salamanca, Jr. yea · Shaun Abreu yea · Joseph C. Borelli yea · Selvena N. Brooks-Powers yea · Amanda C. Farías yea · Kamillah Hanks yea · Crystal Hudson yea · Francisco P. Moya yea · Kevin C. Riley yea · Carlina Rivera yea · Pierina Ana Sanchez yea
Thu Jan 16, 2025 · 10:00 AM

Committee on Immigration

Committee considers resolutions on immigrant status privacy and court counsel

The Committee on Immigration will discuss two pre‑considered resolutions. The first urges the New York State Legislature and Governor to reintroduce and pass the New York for All Act, which would prohibit discovery and disclosure of immigration status by state and local government entities. The second urges passage of A.270/S.141, the Access to Representation Act, which would establish the right to legal counsel in immigration court proceedings and provide for its administration. Both items are for consideration, not final votes.

immigrationlegislationprivacylegal-counselstate-policy
✓ Decided: Committee holds hearing on immigrant protections, lays over two resolutions

The Committee on Immigration held an oversight hearing on protecting immigrant communities and heard testimony on two resolutions. Both resolutions—calling for the New York for All Act and the Access to Representation Act—were laid over by the committee without a vote. No final decisions were made on the resolutions.

Council Chambers - City Hall
Wed Jan 15, 2025 · Deferred

Committee on Higher Education

Committee will review oversight of the new CUNY School of Medicine

The New York City Council Committee on Higher Education will hold an oversight session on the new CUNY School of Medicine. The meeting is scheduled for Wednesday, January 15, 2025 at 10:00 AM in the Council Chambers at City Hall. No additional agenda items are listed.

higher-educationoversightcunymedicinecity-council
Council Chambers - City Hall
Wed Jan 15, 2025 · 11:30 AM

Subcommittee on Zoning and Franchises

Subcommittee to consider zoning map amendment creating C2-2 district in Queens

The Subcommittee on Zoning and Franchises will review Application C 240363 ZMQ submitted by Martin A. Gleason Funeral Home, LLC. The proposal seeks to amend the Zoning Map (Section No. 7d) by establishing a C2-2 district within an existing R2A district in Queens, Community District 7, Council District 19. The decision will determine whether the commercial overlay is approved under the city charter provisions.

zoningcommercialmap-amendmentqueensc2-2
✓ Decided: Subcommittee approves Gleason Funeral Home commercial overlay in Queens

The Subcommittee on Zoning and Franchises approved application C 240363 ZMQ, which would establish a C2-2 commercial overlay within an existing R2A residential district in Queens Community District 7. The vote was unanimous, 7-0. The application now moves to the full Land Use Committee for further consideration.

250 Broadway - Committee Room, 16th Floor
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
LU 0206-2024 — Approved by Subcommittee
7 yea
Kevin C. Riley yea · Shaun Abreu yea · David M. Carr yea · Kamillah Hanks yea · Francisco P. Moya yea · Yusef Salaam yea · Lynn C. Schulman yea
Wed Jan 15, 2025 · 11:00 AM

Subcommittee on Landmarks, Public Sitings and Dispositions

Subcommittee to consider historic landmark designation for Jacob Day Residence

The Subcommittee on Landmarks, Public Sitings and Dispositions will review Application N 250101 HIM submitted by the Landmarks Preservation Commission. The application seeks designation of the Jacob Day Residence at 50 West 13th Street (Block 576, Lot 15) in Manhattan as a historic landmark (DL‑543/LP‑2658) under City Charter §3020 and Administrative Code §25‑303.

landmarkshistoric-preservationmanhattancity-councilpublic-sitings
✓ Decided: Subcommittee holds hearing on Jacob Day Residence landmark designation

The Subcommittee on Landmarks, Public Sitings and Dispositions held a hearing on the proposed designation of the Jacob Day Residence at 50 West 13th Street as a historic landmark. The application was laid over by the subcommittee, meaning no final decision was made. The item remains pending for further consideration.

250 Broadway - Committee Room, 16th Floor
Tue Jan 14, 2025 · 10:00 AM

Committee on Finance

Council finance committee to consider property tax laws

The Committee on Finance will review four local laws and one resolution concerning property tax administration, including outreach to owners and the public recording of tax liens. The committee will also vote on a resolution urging the state legislature to allow retroactive tax exemptions.

financetaxpropertylegislationcouncilgovernment
✓ Decided: Committee holds hearings on four property tax lien bills, lays all over

The Committee on Finance held hearings on four proposed local laws and one resolution related to property taxes and real estate recording, but took no final action. All items were laid over by the committee, meaning they were not voted on and remain pending. The bills would require preemptive outreach to property owners subject to municipal property taxes, public recording of tax liens, and notification to council members and interested parties of certain real estate recordings. A resolution calling on the state to allow retroactive tax exemptions was also heard and laid over.

Committee Room - City Hall
Tue Jan 14, 2025 · Deferred

Committee on Fire and Emergency Management

Council committee considers pilot law for flash-flood shelter locations

The Committee on Fire and Emergency Management will review a Local Law that creates a pilot program to designate shelter locations for flash‑flood emergencies. The proposal is identified as T2024‑2839 and introduced as Int 0807‑2024, addressing preparation and response to flash‑flood events. Council members will consider the bill during the meeting.

flash-floodemergency-managementshelterlegislationfire-committee
Council Chambers - City Hall
Fri Jan 10, 2025 · 1:00 PM

Committee on Hospitals

Oversight of Health and Hospitals Doctors Council work stoppage

The Committee on Hospitals will meet on Jan. 10, 2025 at 1:00 p.m. to discuss oversight of a work stoppage by the Health and Hospitals Doctors Council. The item (T2025-2911) is scheduled jointly with the Committee on Health and the Committee on Civil Service and Labor. No decisions or votes are noted in the agenda.

healthhospitalslaboroversight
✓ Decided: Committee holds oversight hearing on doctors council work stoppage

The Committee on Hospitals, jointly with the Committees on Health and Civil Service and Labor, held an oversight hearing on the Health and Hospitals Doctors Council work stoppage. The hearing was held and the oversight item was filed by the committee. No substantive decisions or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Health and the Committee on Civil Service and Labor.
Fri Jan 10, 2025 · 1:00 PM

Committee on Civil Service and Labor

Oversight hearing on Health + Hospitals doctors work stoppage

The Civil Service and Labor Committee will hold an oversight session on the Health and Hospitals Doctors Council work stoppage. The hearing is scheduled for January 10, 2025 at 1:00 PM in the Council Chambers. It will be conducted jointly with the Committee on Hospitals and the Committee on Health.

laborhealthoversightgovernment
✓ Decided: Council committee holds oversight hearing on doctors work stoppage

The Committee on Civil Service and Labor, jointly with the Committees on Hospitals and Health, held an oversight hearing on the Health and Hospitals Doctors Council work stoppage. The hearing was held and the oversight item was filed by the committee. No substantive decisions or votes were recorded.

Council Chambers - City Hall Jointly with the Committee on Hospitals and the Committee on Health
Fri Jan 10, 2025 · 1:00 PM

Committee on Health

Committee on Health to hold oversight hearing on Doctors Council work stoppage

The Committee on Health is meeting jointly with the Committee on Hospitals and the Committee on Civil Service and Labor. The body will conduct oversight regarding the Health and Hospitals Doctors Council work stoppage.

healthlaborhospitalsoversight
✓ Decided: Committee holds oversight hearing on doctors' work stoppage

The Committee on Health, jointly with the Committees on Hospitals and Civil Service and Labor, held an oversight hearing on the Health and Hospitals Doctors Council work stoppage. The hearing was held and the oversight was filed by the committee. No substantive decisions were made.

Council Chambers - City Hall Jointly with the Committee on Hospitals and the Committee on Civil Service and Labor
Thu Jan 9, 2025 · Deferred

Committee on Civil Service and Labor

Committee will oversee the Health and Hospitals Doctors Council work stoppage.

The Civil Service and Labor Committee will hold an oversight hearing on the Health and Hospitals Doctors Council work stoppage. The hearing is scheduled for January 9, 2025 at 1:00 PM in the Committee Room at City Hall. The item is conducted jointly with the Committee on Hospitals and the Committee on Health.

oversighthealthlaborhospitalswork-stoppage
Committee Room - City Hall Jointly with the Committee on Hospitals and the Committee on Health
Thu Jan 9, 2025 · Deferred

Committee on Hospitals

Council reviews Health and Hospitals Doctors Council work stoppage

The Committee on Hospitals will hold an oversight hearing on the Health and Hospitals Doctors Council work stoppage. The hearing is conducted jointly with the Committee on Health and the Committee on Civil Service and Labor. No decisions are listed; the agenda focuses on discussion of the work stoppage.

healthhospitalslaboroversight
Committee Room - City Hall Jointly with the Committee on Health and the Committee on Civil Service and Labor.
Thu Jan 9, 2025 · Deferred

Committee on Health

Health Committee will oversee the Health & Hospitals Doctors Council work stoppage

The Committee on Health will hold an oversight hearing on a work stoppage by the Health and Hospitals Doctors Council. The hearing is scheduled for January 9, 2025 at 1:00 PM in the Committee Room at City Hall. The session is being conducted jointly with the Committee on Hospitals and the Committee on Civil Service and Labor.

healthoversightlaborhospitalswork-stoppage
Committee Room - City Hall Jointly with the Committee on Hospitals and the Committee on Civil Service and Labor
Thu Jan 9, 2025 · 11:00 AM

Subcommittee on Zoning and Franchises

SPARC Kips Bay site slated for forensic pathology center and lab

The Subcommittee on Zoning and Franchises will consider a slate of applications that amend zoning districts and create Mandatory Inclusionary Housing areas across Queens, Brooklyn, the Bronx, and Manhattan. Several proposals involve rezoning and special permits for commercial and mixed‑use developments, including the SPARC Kips Bay project that seeks property acquisition, disposition, and a forensic pathology facility. The body will vote on these map changes, permits, and housing designations at the January 9 meeting.

zoninginclusionary-housingdevelopmentmanhattanbrooklynbronxqueens
✓ Decided: Subcommittee holds hearings, lays over all zoning applications

The Subcommittee on Zoning and Franchises held hearings on multiple land use applications, including rezoning proposals in Queens, Brooklyn, the Bronx, and Manhattan, as well as the SPARC Kips Bay project. All applications were laid over by the subcommittee without a vote, meaning no final decisions were made at this meeting. The next steps will involve further review and potential action at future meetings.

Council Chambers - City Hall
Wed Jan 8, 2025 · 12:00 PM

City Council Stated Meeting

Council to proclaim special election for District 44 on March 25, 2025

The City Council will adopt minutes, receive messages from the Mayor, and note the resignation of Council Member Kalman Yeger effective Dec 31 2024. It will proclaim a special election for Council District 44 to be held on March 25 2025. The meeting also includes land‑use call‑ups for 455 First Avenue and SPARC Kips Bay, and the introduction of several local laws and resolutions.

special-electionzoningland-uselegislationcouncilhousingenvironment
✓ Decided: Council approves land use reviews for 455 First Ave and SPARC Kips Bay

The City Council held its Charter Meeting on January 8, 2025, with 49 members present. It approved two land use call-ups to review City Planning Commission actions on major projects: 455 First Avenue and SPARC Kips Bay. The Council also received the Mayor's proclamation for a special election in the 44th Council District on March 25, 2025, and accepted the resignation of Council Member Kalman Yeger. Several new bills and resolutions were introduced and referred to committees.

Council Chambers - City Hall CHARTER MEETING
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
M 0089-2025 — Approved, by Council
49 yea · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Joseph C. Borelli yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea
M 0090-2025 — Approved, by Council
49 yea · 1 absent
Adrienne E. Adams yea · Diana I. Ayala yea · Shaun Abreu yea · Joann Ariola yea · Alexa Avilés yea · Chris Banks yea · Joseph C. Borelli yea · Erik D. Bottcher yea · Justin L. Brannan yea · Gale A. Brewer yea · Selvena N. Brooks-Powers yea · Tiffany L. Cabán yea · David M. Carr yea · Carmen N. De La Rosa yea · Eric Dinowitz yea · Amanda C. Farías yea · Oswald J. Feliz yea · James F. Gennaro yea · Jennifer Gutiérrez absent · Shahana K. Hanif yea · Kamillah Hanks yea · Robert F. Holden yea · Crystal Hudson yea · Rita C. Joseph yea · Shekar Krishnan yea · Linda Lee yea · Farah N. Louis yea · Kristy Marmorato yea · Christopher Marte yea · Darlene Mealy yea · Julie Menin yea · Francisco P. Moya yea · Mercedes Narcisse yea · Sandy Nurse yea · Chi A. Ossé yea · Vickie Paladino yea · Keith Powers yea · Lincoln Restler yea · Kevin C. Riley yea · Carlina Rivera yea · Yusef Salaam yea · Rafael Salamanca, Jr. yea · Pierina Ana Sanchez yea · Lynn C. Schulman yea · Althea V. Stevens yea · Sandra Ung yea · Inna Vernikov yea · Nantasha M. Williams yea · Julie Won yea · Susan Zhuang yea