The Boring PartsFederalLocal · USLocal · Canada
Los Angeles, CA

Los Angeles public meetings in 2025

389 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Fri Dec 12, 2025 · 09:00 AM

Personnel and Hiring Committee

Personnel and Hiring Committee to discuss Workday contract and city staffing

The committee will review a proposed contract amendment with Workday, Inc. and discuss staffing authorities for the 2025-26 Budget. Other agenda items include reports on citywide layoff management and staffing for the Bureau of Homelessness Oversight.

contractsstaffingbudgethomelessnesslayoffsit-implementation
Room 401
Notable items
Fri Dec 12, 2025 · 10:00 AM

City Council Meeting

Council holds routine roll call, minutes approval, and public comment

The Los Angeles City Council will conduct its regular procedural business, including roll call, approval of the previous meeting's minutes, and consideration of commendatory resolutions and introductions. Council members will also allow multiple agenda item comments and public testimony on non‑agenda items within the council's jurisdiction. No specific policy decisions, contracts, or rezoning actions are listed on this agenda.

procedurespublic-commentcity-councilgovernance
✓ Decided: Council adopts 2025 California Building Code update and approves waste hauling contracts

The Los Angeles City Council unanimously adopted an ordinance incorporating the 2025 California Building Standards Code into the LAMC, with a technical clean-up amendment to follow. It also approved a five-year waste hauling contract with CR&R Inc. and Ecology Auto Parts, Inc. for up to 11 years, and accepted a $2.4 million state grant for juvenile re-entry services.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (URGENCY CLAUSE - 12 VOTES REQUIRED ON SECOND READING) Adopted Item Forthwith
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted (Public Works Committee waived consideration of the above matter) Adopted Item Forthwith
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea
that the above recommendation complies with the City’s Financial Policies in that special funds will be used to fund applicable expenditures, financial obligations are limited to appropriated and…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea
that the recommendations in the report are in compliance with the City’s Financial Policies in that all grant funds will be utilized for grant- eligible activities. Community Impact Statement: None…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea
Wed Dec 10, 2025 · 02:30 PM

Public Safety Committee

Board of Police Commissioners to consider $308,196 donation for LAPD training equipment

The Public Safety Committee will review several reports and motions, including a mayoral appointment to the Police Permit Review Panel and a motion to study private access to helicopter pads. It will consider multiple donations from the Los Angeles Police Foundation for police equipment, such as ALPR cameras, iron sighting systems, and crime‑light kits. The committee will also discuss a motion to develop fire‑safe landscaping rules and a traffic‑control strategy for inclement weather.

public-safetypolicedonationshelicopter-padsfire-safetytraffic-control
Notable items
Wed Dec 10, 2025 · 08:30 AM

Transportation Committee

Committee reviews contract to install 10 AC bus chargers with BYD Motors

The Transportation Committee will consider a City Administrative Officer report on a First Amendment to Contract C-142704 with BYD Motors, LLC for installing ten AC bus chargers. It will also discuss budget recommendations for parking fines in EV charging bays, revenue programs for the Department of Transportation, and several DOT reports on funding and programs. Several resolutions and reports, including oversize vehicle parking restrictions and private ambulance service rates, will be presented for comment.

transportationcontractsbudgetparkingpublic-safety
Notable items
Wed Dec 10, 2025 · 02:30 PM

Public Works Committee

Public Works Committee to discuss capital planning and street closures

The Public Works Committee will meet to review the City's Capital Improvement Plan and consider temporary street closures and signage projects. The meeting is scheduled for 2:30 PM on December 10, 2025, in Room 401 at City Hall.

public-workscapital-planningstreet-closuressignagecity-hallwilmingtonmelrose
Notable items
Wed Dec 10, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for December 10, 2025

The provided agenda contains only procedural boilerplate and general meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
✓ Decided: Council adopts lighting district ordinance and denies protest

The City Council adopted an ordinance that levies assessments and orders maintenance for the Thatcher Avenue and Washington Boulevard Street Lighting District and denied the related protest, with a unanimous vote. The Council also confirmed nuisance‑abatement liens for multiple properties, each adopted unanimously or with the noted vote count. All actions were recorded as adopted items, some to continue consideration on Jan. 14, 2026.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Adopted Item Forthwith
123 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the recommendations in this report comply with the City’s Financial Policies. Community Impact Statement: None submitted Adopted Motion (Yaroslavsky – Blumenfield) and Budget and Finance…
9 yea · 2 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Nazarian nay · Rodriguez nay
that the recommendations in the report comply with the City's Financial Policies as they support the City's goal to achieve and maintain a structurally balanced budget in which future costs are…
13 yea · 4 nay · 1 absent
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield nay · Wednesday - December nay · Rodriguez yea · Soto-Mart​ ínez nay · Economic Development absent · Harris- Dawson nay
The other 51 items passed by unanimous or near-unanimous consent.
Tue Dec 9, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Update on 2028 Olympic Cultural Program by Dept. of Cultural Affairs

The committee will hear a Department of Cultural Affairs report on the planning and approval of the 2028 Cultural Program for the Olympic and Paralympic Games framework. No fiscal impact statement is provided for this item. The report is referred to the Ad Hoc Committee on the 2028 Olympic and Paralympic Games and the Arts, Parks, Libraries and Community Enrichment Committee.

cultural-programolympicsdisabilityneighborhood-councilanimal-servicesrecreation
✓ Decided: Committee approves sex‑offender disclosure study, non‑resident fee plan, and other actions

The Arts, Parks, Libraries, and Community Enrichment Committee approved two feasibility studies—one on requiring sex‑offender status disclosure for election candidates and another on charging non‑resident fees for Recreation and Parks programs. It also approved a senior‑center needs assessment for Council District 14, a $38,093 fund transfer for animal‑gate improvements, and a CEQA exemption for a community‑garden agreement. Additional actions included approving the FY 2025/26 Arts Development Fee plan, continuing a fentanyl detection pilot, and filing a report on the 2028 Olympic cultural program.

Notable items
Tue Dec 9, 2025 · 02:00 PM

Planning and Land Use Management Committee

Decision on 65‑foot height expansion of cold‑storage facility on North Coil Ave.

The committee will consider a Negative Declaration and related CEQA findings for a project that expands an existing cold‑storage facility at 1420 and 1500 North Coil Avenue and at 1532, 1540, and 1542 North Alameda Street. The proposal seeks to replace a one‑story, 42‑foot building with a two‑story, 65‑foot structure, adding 44,174 square feet of floor area and 114 parking spaces. The agenda also includes a motion to direct a 60‑day report on Tentative, Qualified, and Development Limitation classifications, a CEQA categorical exemption for a condominium conversion at 1451 South Hi Point Street, and a motion to revoke a coastal exemption for a project at 4311 South Lincoln Boulevard.

zoningenvironmenthousingcoastalhelicopter-padsdevelopment-limitations
Notable items
Tue Dec 9, 2025 · 03:00 PM

Budget and Finance Committee

City proposes issuance of Proposition HHH General Obligation Bonds Series 2026-A

The Budget and Finance Committee will consider a City Attorney report and draft ordinance to issue and sell Proposition HHH General Obligation Bonds, Series 2026‑A (taxable social bonds), and to add Section 5.82.34 to the Administrative Code for related special funds. The committee will also review reports on the city’s FY 2025‑26 financial status, third construction projects, and a homelessness emergency account status report. Motions include directing the City Administrative Officer to study new financial policies for contract spending that exceeds council‑authorized amounts, and authorizing subsidiary agreements with U.S. Bank for fuel and fleet commercial card services and a third amendment to that agreement. Additionally, the committee will consider a draft ordinance to update shared‑mobility device trip fees paid to LADOT and related fee methodology.

budgetfinancebondscontractsmobilityfeeslegal
✓ Decided: Approved issuance of Proposition HHH General Obligation Bonds (Series 2026‑A)

The Budget and Finance Committee approved several reports and authorizations, most notably the City Attorney report and ordinance to issue and sell Proposition HHH General Obligation Bonds (Series 2026‑A). It also approved a motion to study a new financial policy for contract spending that exceeds council‑authorized amounts and authorized execution of subsidiary agreements with U.S. Bank for fuel and fleet commercial card services. The committee recessed to closed session on multiple pending lawsuits.

Notable items
Tue Dec 9, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Committee to consider motion directing a report on port air‑quality framework

The Trade, Travel and Tourism Committee will hear public comment and consider a motion directing the Chief Legislative Analyst, in consultation with the Port of Los Angeles, to prepare a framework for supporting air‑quality and environmental legislation at the port. It will also consider a motion directing the Los Angeles Fire Department, with the Emergency Management Department and other agencies, to report on the November 21, 2025 fire aboard the One Henry Hudson. Several Board of Airport Commissioners reports will be reviewed, covering lease amendments with United Air Lines and American Airlines, a contract with Siemens Industry for LAX building‑automation systems, and related CEQA exemptions.

air-qualityportfire-safetyairport-leaseceqacontractsaviation
Notable items
Tue Dec 9, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meets to discuss agenda items and public comment.

The Los Angeles City Council will convene at 10:00 AM in the John Ferraro Council Chamber to consider agenda items, approve minutes, and hear public testimony. The meeting will be broadcast live on Cable Channel 35 and online.

city-councilpublic-meetingagendapublic-commentlos-angeles
✓ Decided: Council confirmed multiple nuisance abatement liens for city properties

The Los Angeles City Council voted unanimously to confirm or file nuisance abatement liens for fifteen properties. Most motions passed with a 15‑0 vote; one item was postponed to a January 14, 2026 hearing. The lien amounts range from $690.00 to $3,856.44.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
[context] Adopted Item Forthwith
110 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Motion (Lee – Hutt) to move the Public Safety Committee Report Forthwith
12 yea · 4 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay · Soto-Mart​ínez yea · Soto-Mart​ ínez nay
[context] Community Impact Statement: None submitted Adopted Motion (Yaroslavsky – Blumenfield) to Refer the entire matter, including Substitute Motion (Park – Lee) to the Budget and Finance…
9 yea · 5 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Padilla yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hutt nay · Lee nay · Nazarian nay · Park nay · Price Jr. nay
[context] Tuesday - December 9, 2025 - PAGE 51 (Transportation Committee has waived consideration of the above matter.) Adopted Item Forthwith
12 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay
The other 43 items passed by unanimous or near-unanimous consent.
Mon Dec 8, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission will discuss creating an honorary President Emeritus position

The Los Angeles City Health Commission will consider establishing an honorary President Emeritus role and may take action on it. The meeting also includes presentations on neighborhood council roles, low‑income housing impacts, and a review of the 2025 Annual Report. Public comment will be limited to in‑person speakers.

healthgovernancehousingcommunity-engagementreports
340
Mon Dec 8, 2025 · 10:00 AM

Ad Hoc Committee on the 2028 Olympic and Paralympic Games

Committee discusses LA28 planning and local contracting

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games will receive updates on the Enhanced City Resources Master Agreement. Members will also consider motions requesting reports from LA28 representatives regarding a federal taskforce and local procurement statistics.

la28olympicscontractingcity-planning
Notable items
Fri Dec 5, 2025 · 08:30 AM

Government Efficiency, Innovation, and Audits Committee

Committee to discuss consolidating four city departments

The Government Efficiency, Innovation, and Audits Committee will review reports on the proposed consolidation of the Departments of Aging, Community Investment for Families, Economic and Workforce Development, and Youth Development. The body will also discuss the feasibility of creating a standalone Economic Development Department.

government-efficiencydepartment-consolidationeconomic-developmentcity-administration
✓ Decided: Committee approved consolidation recommendations as amended

The Government Efficiency, Innovation, and Audits Committee considered agenda item 25-0600-S43, a joint report on consolidating the Departments of Aging, Community Investment for Families, Economic and Workforce Development, and Youth Development, and on the feasibility of a standalone Economic Development Department. The committee approved the recommendations as amended with a vote of Yes 2, No 1. No other substantive actions were taken.

Fri Dec 5, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee considers approval of MIPPA grant funds and related agreements

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will review two items requesting approval of California Department of Aging grant funds under the MIPPA program and authority to negotiate related agreements. It will also receive reports on a historic preservation contract, a contract amendment with the YMCA and other agencies, and acceptance of state safety program funds. Fiscal impact statements are attached to each item.

agingdisabilitybudgetgrantshealthhistoric-preservationpublic-safety
Notable items
Fri Dec 5, 2025 · 10:00 AM

City Council Meeting

Council meeting focuses on procedural rules and public comment guidelines

The Los Angeles City Council will conduct roll call, approve the minutes, and address procedural rules for public comment, live broadcast, and item handling. No specific policy items, contracts, or ordinances are listed on the agenda.

councilprocedurepublic-commentbroadcastmeeting-rules
✓ Decided: Council approves $8 M transfer and $5 M AECOM payment for storm recovery

The Los Angeles City Council adopted a series of reports and instructed the City Administrative Officer to study various feasibility issues. It also approved an $8 million fund transfer to the Bureau of Engineering and authorized up to $5 million for AECOM to provide storm‑recovery services. All actions were approved unanimously (12‑0) with three members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) Friday - December 5, 2025 - PAGE 10 (Visit www.lacoundilfile.com for background documents.)…
10 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Rodriguez nay
The other 15 items passed by unanimous or near-unanimous consent.
Fri Dec 5, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee to discuss 2026 municipal election dates and consolidation

The Rules, Elections and Intergovernmental Relations Committee will consider calling a Primary Nominating Election on June 2, 2026, and a General Municipal Election on November 3, 2026. The body will also discuss city positions on offshore drilling, autonomous vehicle regulations, and homelessness funding advocacy.

electionsenvironmentgovernment-ethicsautonomous-vehicleshomelessness
340
Wed Dec 3, 2025 · 02:00 PM

Housing and Homelessness Committee

Committee to discuss bridge housing and homelessness service contracts

The Housing and Homelessness Committee will review reports on Project Roomkey and the Homelessness Emergency Account. Members will consider contracts for home repairs and interim inspector general services, as well as the appointment of a new commission member.

homelessnessaffordable-housingcontractsbridge-housingpublic-services
✓ Decided: Housing Committee approves several reports, contracts and fund transfers

The Housing and Homelessness Committee approved a series of City Administrative Officer and Housing Department reports, contract amendments, and fund‑transfer motions. All approvals recorded a vote of four members in favor and one absent (Councilmember Raman). No new public comment was taken and no items were denied.

Notable items
Wed Dec 3, 2025 · 03:30 PM

Housing and Homelessness Committee - SPECIAL

Committee considers $20 million loan for Proposition HHH projects

The Housing and Homelessness Committee will discuss a temporary loan from the Housing Impact Trust Fund and a lease for a city-owned lot. The meeting focuses on funding for homeless housing and the use of vacant city land.

homelessnesshousingbudgetland-use
✓ Decided: Committee approved up to $20 million temporary loan from Housing Impact Trust Fund

The committee approved the Municipal Facilities Committee report on a lease agreement with Hamburger Home, Inc. dba Aviva Family and Children’s Services for the city‑owned lot at 1901‑1905 North Highland Avenue. It also approved a motion to authorize a temporary loan of up to $20 million from the Housing Impact Trust Fund for Proposition HHH projects. Both actions passed with four votes in favor and one member absent (Councilmember Raman).

Notable items
Wed Dec 3, 2025 · 10:00 AM

City Council Meeting

Council meeting focuses on procedural rules and public comment

The Los Angeles City Council will conduct its regular session, covering roll call, approval of minutes, commendatory resolutions, and multiple agenda item comments. Residents may submit written comments online and speak briefly on agenda and non‑agenda items. No specific policy decisions or contracts are listed on the agenda.

councilprocedurepublic-commentminutesresolutions
✓ Decided: Council adopts new zoning rules for medical marijuana dispensaries

The Los Angeles City Council unanimously adopted an ordinance amending LAMC Section 105.03 to change location and zoning restrictions for existing medical marijuana dispensaries, finding the project categorically exempt under CEQA. The Council also approved a categorical exemption and dedication of an emergency‑access easement at 7001 West La Tuna Canyon Road and directed multiple bureaus to report on public right‑of‑way standards within 60 days. Additional unanimous actions included amending cannabis regulation sections 104.03/104.06 and supporting several state bills related to animal welfare, recovery housing, disaster‑related tenant protections, and community‑college housing.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item Forthwith
10 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
[context] Called Item to Question
10 yea · 3 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Yaroslavsky yea · Blumenfield nay · Price Jr nay · Soto-Mart​ínez nay
The other 40 items passed by unanimous or near-unanimous consent.
Wed Dec 3, 2025 · 08:30 AM

Personnel and Hiring Committee

City Attorney proposes ordinance to repeal non‑Kaiser HMO option in LA Administrative Code

The Personnel and Hiring Committee will review several mayoral exemption reports for LAPD and other departments, a City Attorney report and ordinance to amend LA Administrative Code Section 4.307 by repealing the “Non‑Kaiser Full‑Network HMO Option,” a Personnel Department report to extend term lengths for the Board of Deferred Compensation Administration, and a staffing plan report for the Housing Department’s Bureau of Homelessness Oversight. Most items have no fiscal impact, except the term‑length change which does. Public comment will be accepted in person only.

personnelhiringexemptionsordinancehousinghomelessnesshealth-insurancedumping
✓ Decided: Council approved exemptions for five Los Angeles Police Department positions

The Personnel and Hiring Committee voted unanimously to approve eight agenda items. Approvals included exemptions from civil service for several Los Angeles Police Department positions, a fire department manager, a housing department manager, an ordinance repeal, a term‑length increase for a compensation board, and a motion to allow council aides to issue dumping citations. All approvals recorded a Yes vote from all three members.

Room 401
Notable items
Tue Dec 2, 2025 · 02:00 PM

Budget and Finance Committee

Budget and Finance Committee to review grants and homelessness funding

The Committee will discuss various grant acceptances for animal services, public safety, and youth programs. The body is also reviewing homelessness funding reports and potential tax exemptions for properties destroyed in the Palisades Fire.

budgetgrantshomelessnesspublic-safetyanimal-servicestax-exemption
✓ Decided: Committee approved numerous grant programs and a city attorney report on outside counsel

The Budget and Finance Committee concurred with prior committee actions on 15 grant and funding reports, voting unanimously to approve each. It also approved the City Attorney report on outside‑counsel contracts and two related motions, again with a 5‑yes, 0‑no vote. All approvals were recorded as unanimous.

Notable items
Tue Dec 2, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers indoor temperature limits for rental housing

The Energy and Environment Committee will discuss an ordinance to set maximum indoor temperature thresholds for rental units. The body will also review several water and power agreements and recycling program changes.

rental-housingrecyclingwater-managementenergyinfrastructure
Notable items
Tue Dec 2, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee will consider a motion to require physical coupons for digital‑only grocery discounts

The Economic Development and Jobs Committee will discuss several reports and motions, including a CRA/LA bond allocation, a motion to reallocate excess bond proceeds for bikeway funding, and a motion directing a study on grocery‑store discount practices. The key item is a motion to have the City Attorney draft an ordinance requiring grocery stores that offer digital‑only discounts to also provide identical physical coupons. The committee will also hear reports on a cashless‑retail ban framework, wage‑theft enforcement changes, and a definition of “ghost kitchens.”

budgethousingtransportationretaillaborplanning
Notable items
Tue Dec 2, 2025 · 10:00 AM

City Council Meeting

Council will approve minutes and hear public comments

The Los Angeles City Council will conduct a roll call, approve the minutes from the previous meeting, and consider commendatory resolutions, introductions, and presentations. The meeting also includes a Multiple Agenda Item Comment period and public testimony on non‑agenda items within the Council's jurisdiction.

councilprocedureminutespublic-commentresolutions
✓ Decided: Council approves LAFD special services fee adjustments for FY 2024‑25

The City Council approved the Los Angeles Fire Department’s FY 2024‑25 Annual Cost of Special Services Fee Adjustments as recommended by the Board of Fire Commissioners. The Council found the Warner Center 2035 mixed‑use project at 6464 North Canoga Avenue to be within the scope of the program’s Environmental Impact Report, adopting the finding unanimously. Ordinance No. 187603, renewing the police equipment reporting requirement, was adopted after reconsideration. The fee‑waiver amendment for wildfire‑damaged rebuilding was referred to the Budget and Finance Committee.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
that the Project is within the scope of the Warner Center 2035 Program EIR No. ENV-2008- 3471-EIR; SCH No. 1990011055 (Program EIR) pursuant to California Environmental Quality Act (CEQA) Guidelines…
14 yea · 1 nay · 1 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Soto­ Martinez nay · the Housing absent
Ordinance No. 187603 pursuant to Government Code Section 7071 (e). Fiscal lmP-act Statement: Not applicable CommunitY. lmP-act Statement: None submitted Amending Motion 24A (Soto-Martinez -…
7 nay · 6 yea · 2 absent
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Soto-Martinez yea · Blumenfield nay · Lee nay · Nazarian nay · Padilla nay · Park nay · Price Jr . nay · Raman absent · Rodriguez absent · Price Jr yea · Price Jr. nay
The other 2 items passed by unanimous or near-unanimous consent.
Tue Dec 2, 2025 · 08:30 AM

Government Operations Committee

Committee to discuss Brown Act compliance and city property sales

The Government Operations Committee will review the appointment of a Cannabis Regulation Commission member and a construction projects report. The body will also discuss a non-profit lease, the sale of city property, and required changes to city procedures to comply with Senate Bill 707.

cannabis-regulationcity-propertyleasingconstructiongovernment-proceduresbrown-act
✓ Decided: Committee approved five items, including a lease and property sale

The Government Operations Committee approved the appointment of Adam Bierman to the Cannabis Regulation Commission for a term ending June 30, 2026. It approved the City Administrative Officer’s FY 2025‑26 third construction projects report. The committee approved, as amended, a non‑profit lease with the Foundation for Early Childhood Education, Inc. for the city‑owned property at 1010 Douglas Street. It also approved the sale of the city’s interest in the property north of Nordyke Street at the end of Avenue 56 (APN 5480‑031‑901) and adopted a motion on Senate Bill 707’s impact on city procedures and Brown Act compliance.

Room 401
Notable items
Mon Nov 24, 2025 · 01:00 PM

Budget and Finance Advisory Committee

BFAC will elect a new Chair and Vice‑Chair at this meeting.

The Budget and Finance Advisory Committee will meet on November 24, 2025. Members will hear a city budget overview, discuss the committee’s work plan and focus areas, and vote to elect a Chair and Vice‑Chair. The agenda also includes welcome remarks, public comment procedures, and planning for future meetings.

budgetfinancegovernancecommitteeelectionspublic-comment
✓ Decided: BFAC elects Ron S. Galperin as Chair and Jessica Lall as Vice‑Chair

The Budget and Finance Advisory Committee voted unanimously to elect Ron S. Galperin as Chair and Jessica Lall as Vice‑Chair. The Committee also agreed to meet monthly and set the next meetings for Jan 12 2026 and Feb 6 2025. No other formal actions were taken.

Edward R. Roybal Board of Public Works Session Room
Mon Nov 17, 2025 · 10:00 AM

Ad Hoc Committee for LA Recovery

Committee reviews disaster recovery funding and tax exemptions

The Ad Hoc Committee for LA Recovery will discuss funding for engineering services following the January 2025 storms. The body will also review fire warning protocols and the feasibility of tax exemptions for residents affected by the Palisades Fire.

disaster-recoverytax-exemptionpublic-safetyengineeringpalisades-fire
✓ Decided: Committee approved two reports and a motion on recovery funding

The Ad Hoc Committee for LA Recovery approved the City Administrative Officer report on the AECOM engineering contract (3 Yes, 2 Absent: Nazarian, McOsker). It also approved a motion directing the City Attorney to study the mayor’s request to give the Finance Director authority to grant a one‑time Measure ULA tax exemption to Pacific Palisades fire victims (3 Yes, 2 Absent: Nazarian, McOsker). The Emergency Management Department report on Red Flag Warning Declarations was continued to a later date with no decision made.

Notable items
Mon Nov 17, 2025 · 10:00 AM

Planning and Land Use Management Committee

City extends Rincon Consultants contract 36 months, up to $2.4 M

The Planning and Land Use Management Committee will consider a 36‑month extension of its contract with Rincon Consultants, Inc. for environmental consulting services, capped at $2,396,610. It will also review several categorical exemptions from CEQA for historic‑cultural monuments, a motion to amend the coastal development permit ordinance for ministerial ADU review, and a motion to explore a self‑certification program for outdoor‑dining permits. Additional items include a report on a comprehensive fee update and draft ordinances for an affordable‑housing streamlining program.

contractshousingfeesenvironmenthistoric-preservationcoastalzoning
Notable items
Fri Nov 14, 2025 · 10:00 AM

City Council Meeting

Council will handle routine procedural matters and public comments

The Los Angeles City Council will conduct roll call, approve the previous meeting's minutes, and consider commendatory resolutions. It will also feature introductions and presentations, a multiple agenda item comment period, and public testimony on non‑agenda items within the Council's jurisdiction. No specific policy decisions or contracts are listed on the agenda.

proceduralpublic-commentcouncilmeetings
✓ Decided: Council approved $73.8M Destination Crenshaw agreement and related authorizations

The council continued the hearing on a $1,276.56 lien for 6080 West Alcott Street. It instructed city departments to report on menopause accommodations, public‑right‑of‑way permitting for events, and street‑light sensor integration. The mayor’s appointment of Jamie Moore as fire chief was approved. The Destination Crenshaw agreement was authorized, increasing project funding to $73,814,876 and extending its contract date.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) (Continued from Council meeting of August 13, 2025) Adopted Item to Continue to December 2, 2025
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item Forthwith
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item Forthwith
33 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please Visit www.lacouncilfile.com for background documents.) Community Impact Statement…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Wed Nov 12, 2025 · 02:00 PM

Housing and Homelessness Committee

Lease agreements for A Bridge Home sites at 310 N. Main St. and 826‑828 Eubank Ave

The Housing and Homelessness Committee will receive reports on staffing plans, the RV-to-Home program model, Handy Worker Program contracts, and the Homelessness Emergency Account status. It will consider lease agreements for A Bridge Home sites at 310 North Main Street in District 14 and 826‑828 Eubank Avenue in District 15. The committee will also consider motions requesting reports on cost recovery programs and rent‑adjustment guidelines.

housinghomelessnessleasesbudgetprograms
✓ Decided: Committee approved lease agreements for A Bridge Home sites in Districts 14 and 15

The Housing and Homelessness Committee approved several reports and motions. It noted and filed the LAHD staffing plan report and approved reports on the RV-to-Home program, Handy Worker Program, and Homelessness Emergency Account. It also approved lease agreements for A Bridge Home sites at 310 North Main Street (District 14) and 826‑828 Eubank Avenue (District 15), and approved motions requesting reports on cost‑recovery program administration and on rent‑adjustment guidelines. All approvals recorded a vote of four Yes and one absent (Councilmember McOsker).

Notable items
Wed Nov 12, 2025 · 03:30 PM

Public Works Committee

Committee will consider naming North Spring & West Ann intersection "Bruce Saito Square"

The Public Works Committee will hear a series of motions and reports, including a designation of an intersection as Bruce Saito Square, updates on the city’s capital planning, and several transportation and environmental impact items. Items include a tree replacement strategy, a collaboration with ShadeLA, and motions on street vacations and greenway expansion. The committee will also receive a verbal update from the Mayor’s Office on the Capital Improvement Plan.

zoningtreesgreenwaystreet-vacationcapital-planning
Notable items
Wed Nov 12, 2025 · 02:30 PM

Public Safety Committee

Public Safety Committee to consider appointment of LAFD Fire Chief

The Public Safety Committee will review the appointment of Jaime Moore as Fire Chief. The body will also discuss grants for law enforcement and emergency management, as well as motions regarding police equipment and RV removal.

public-safetylapdlafdgrantszoningpolice-equipment
Wed Nov 12, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for November 12, 2025

The provided agenda consists of procedural boilerplate and meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
✓ Decided: Council approved a $5 million amendment to the LAX airport contract

The council granted a public‑convenience determination and issued a liquor license for Island Pacific Supermarket in Granada Hills. It approved the City Attorney’s preparation of Ordinance No. 187,106 to reinstate a sidewalk‑repair provision and confirmed the mayor’s appointment of Fabian Renee Wesson to the Library Commission. The council also adopted a $5 million amendment to Los Angeles World Airports’ contract with Swinerton Builders for the LAX Landside Access Modernization project and approved a Harbor Department permit that raises the fixed annual rent by $17,151.75.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item Forthwith
66 yea · 1 nay
Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Lee yea · Hutt yea · Jurado yea · Hernandez yea · Harris-Dawson yea · Blumenfield yea · Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Lee yea · Hutt yea · Jurado yea · Hernandez yea · Harris-Dawson yea · Blumenfield yea · Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Lee yea · Hutt yea · Jurado yea · Hernandez yea · Harris-Dawson yea · Blumenfield yea · Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hutt yea · Jurado yea · Hernandez yea · Harris-Dawson yea · Blumenfield yea · Raman nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea
[context] 16
11 yea · 2 nay
Yaroslavsky yea · Soto-Mart​ínez yea · Rodriguez yea · Raman yea · Park yea · Padilla yea · Nazarian yea · Hutt yea · Jurado yea · Hernandez yea · Harris-Dawson yea · Lee nay · Blumenfield nay
[context] (Rules, Elections and Intergovernmental Relations Committee waived consideration of the above matter) Adopted Item Forthwith
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Lee nay
The other 57 items passed by unanimous or near-unanimous consent.
Wed Nov 12, 2025 · 08:45 AM

Transportation Committee

Transportation Committee to discuss transit pilots, vehicle restrictions, and funding

The Transportation Committee will review reports on transit services, pedestrian improvements, and vehicle weight restrictions. The body is also considering new curb management programs and updates to the Residential Speed Hump Program.

transitparkingroad-safetybudgetpublic-transportationordinances
✓ Decided: Committee approved ordinance limiting heavy vehicles on Del Amo Blvd and other measures

The Transportation Committee approved an ordinance restricting vehicles over 6,000 pounds on Del Amo Boulevard. It also approved a Smart Loading Zone program, a traffic‑control and storm‑prep motion, and a speed‑hump installation plan. Several reports and a grant‑fund request were approved, and a motion to raise the abandoned‑RV removal threshold was submitted without recommendation.

Notable items
Mon Nov 10, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission will hear presentations on emergency planning, maternal health, and housing

The Los Angeles City Health Commission will consider three presentations: emergency planning and community partnerships by Eric A. Morgan of the Emergency Management Department; African American infant and maternal mortality prevention initiatives by Adjoa Jones of the County Public Health Department; and the impact of Measure ULA on low‑income housing by Joseph Donlin of United to House Los Angeles. The agenda also includes items for future discussion and a public comment period.

healthemergency-managementmaternal-healthhousingpublic-commentcity-health-commission
340
Fri Nov 7, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging and Disability /Joint Economic Development and Jobs Committee

Committee to discuss consolidating four city departments

The committee will review a proposal to consolidate the Department of Aging, Community Investment for Families Department, Economic and Workforce Development Department, and Youth Development Department. Other items include funding for RepresentLA and local infrastructure projects.

government-efficiencybudgetinfrastructurecommunity-investmentpublic-works
Notable items
Fri Nov 7, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for November 7, 2025

The provided agenda consists of procedural boilerplate and meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
✓ Decided: Council approved amendment to LAWA reimbursement agreement extending term and $480K annual fees

The council concurred with the Board of Airport Commissioners' CEQA exemption determination and approved BOAC Resolution No. 28140, authorizing a second amendment to Reimbursement Agreement No. DA-4914 between LAWA and Signature Flight Support. The amendment extends the agreement term to 15 years and maintains $480,000 in annual fees. The council also authorized the LAWA CEO to execute the amendment and requested a report on immigration‑enforcement protections.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] Adopted Item
20 yea
Blumenfield yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
10 yea
Blumenfield yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Friday - November 7, 2025 -…
10 yea
Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ ínez yea · Yaroslavsky yea
[context] TIME LIMIT FILE - NOVEMBER 8, 2025 (LAST DAY FOR COUNCIL ACTION - NOVEMBER 7, 2025) Adopted Item as Amended by Motion 5A (Padilla - Park) - SEE ATTACHED
10 yea · 4 absent
Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ ínez yea · Yaroslavsky yea · Blumenfield absent · Harris-Dawson absent · Hernandez absent · Soto-Mart​ínez absent
Fri Nov 7, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee to set city positions on state bills regarding cannabis, housing, and disabilities

The Rules, Elections and Intergovernmental Relations Committee will meet to establish the City's official stance on several state legislative proposals, including cannabis tax delays, landlord-tenant disaster rules, and housing regulations. The body will also consider a motion to update the Los Angeles Municipal Code for web and mobile accessibility.

cannabishousinglandlord-tenantdisabilitiesstate-legislationpublic-healthanimal-rights
340
Notable items
Fri Nov 7, 2025 · 08:30 AM

Government Operations Committee

Committee to consider ordinance changing zoning rules for medical marijuana dispensaries

The Government Operations Committee will hear City Attorney reports and consider two ordinances. The first proposes amending Los Angeles Municipal Code Section 105.03 to set location and zoning restrictions for existing medical marijuana dispensaries. The second proposes amending Sections 104.03 and 104.06 to regulate commercial cannabis activity. Neither item has a fiscal impact; a community impact statement was submitted for the first item, and the Studio City Neighborhood Council opposes it.

zoningcannabismedical-marijuanacommercial-cannabisordinancecommunity-impact
Room 401
Notable items
Wed Nov 5, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee to review citywide layoff management and employee accommodations

The Personnel and Hiring Committee will discuss reports on citywide layoff management and the implementation of Workday. The body will also consider motions regarding accommodations for employees experiencing menopause and hiring for the Los Angeles Convention Center project.

personnelhiringlayoffsemployee-benefitscity-management
Room 401
Wed Nov 5, 2025 · 02:00 PM

Housing and Homelessness Committee

City to consider $1.58 million bond for Southside Senior Housing project

The Housing and Homelessness Committee will take public comment and consider a series of administrative reports, motions, and agreements. Items include reappointing a citizen oversight member, legal representation contracts, consultant services, and several homelessness funding reports. The committee will also adopt a tax‑equity resolution and issue a supplemental tax‑exempt bond of up to $1,579,936 for the Southside Senior Housing Supportive Housing Project at 1623 West Manchester Avenue. Additional items cover loan extensions, rent‑stabilization code amendments, a Tiny Home Village lease revision, and ownership changes for the Manitou Vistas properties.

housinghomelessnessbondsrent-stabilizationsenior-housingloan-agreements
✓ Decided: Approved up to $1.58M bond for senior supportive housing project

The committee approved a supplemental tax‑exempt multifamily conduit revenue bond of up to $1,579,936 for the Southside Senior Housing Supportive Housing Project. It also approved the reappointment of Erich Minoru to the Proposition HHH Citizen Oversight Committee and several City Administrative Officer reports covering legal services, accessibility consulting, and homelessness funding. Additional approvals included extending the loan for El Dorado Family Apartments and authorizing motions on homeless‑housing program analysis and Manitou Vistas loan agreements.

Notable items
Wed Nov 5, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for November 5, 2025

The provided agenda consists of procedural boilerplate and meeting rules. No specific legislative items, contracts, or policy decisions are listed for this session.

procedural
✓ Decided: Council approved moving LA28 Closing Ceremonies to the Los Angeles Memorial Coliseum

The Council denied the protest on the Thatcher Avenue and Washington Boulevard lighting district and adopted the ordinance that levies the assessments and orders maintenance. It approved relocating both the Olympic and Paralympic Closing Ceremonies to the Los Angeles Memorial Coliseum. The body also reappointed three members to the Native American Indian Commission, authorized a $350,000 amendment to an animal‑services contract, and approved a $400,000 appropriation from Recreation and Parks to the ITA. Finally, it granted a categorical exemption for a Head Start preschool at Valley Plaza Park and directed Animal Services to report on access rules for elected officials.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
84 yea · 2 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Motion (Park – Hutt) - SEE ATTACHED
33 yea · 9 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay
The other 22 items passed by unanimous or near-unanimous consent.
Tue Nov 4, 2025 · 03:30 PM

Energy and Environment Committee

DWP reports on Scattergood Generating Station hydrogen-ready modernization

The Energy and Environment Committee will hear a Department of Water and Power report on the Scattergood Generating Station Units 1 and 2 green hydrogen‑ready modernization project. It will also consider a Department of Transportation report on a local air‑quality program that involves the Los Feliz, North Westwood, and Wilmington Neighborhood Councils. Finally, the City Attorney will report on S&W Atlas Iron & Metal Co., Inc.’s legal requirement to upgrade its stormwater treatment system. No fiscal impacts are noted for any of the items.

energyenvironmentwater-and-powerair-qualitystormwaterpublic-comment
Notable items
Tue Nov 4, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meets Tuesday, November 4, 2025

The Los Angeles City Council will hold its regular meeting on Tuesday, November 4, 2025, at 10:00 AM in the John Ferraro Council Chamber. The agenda includes the approval of minutes, commendatory resolutions, and a period for multiple agenda item comments and public testimony.

los-angelescity-councilmeetingpublic-testimonyagendaminutesresolutions
✓ Decided: Council approved $2.1M Opioid Settlement Fund allocation for remediation program

The council approved a liquor license for DR G. at 11302 West Santa Monica Boulevard and adopted resolutions accepting and rejecting portions of a future street easement on West Santa Monica Boulevard. It also approved amendments to the DWP Open Access Transmission Tariff and directed agencies to study solar and storage options for LAPD properties. Finally, the council allocated $2,100,000 from Opioid Settlement Funds for a citywide opioid remediation program.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
111 yea · 1 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - November nay
Ordinance No. 188307 (Council file No. 24-0777). 2. AUTHORIZE the Controller and City Administrative Officer (CAO) to correct any clerical or technical errors in the above Ordinance. Fiscal Impact…
11 yea · 3 absent · 1 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield absent · Park absent · Price Jr absent · Yaroslavsky yea · Tuesday - November nay
The other 27 items passed by unanimous or near-unanimous consent.
Tue Nov 4, 2025 · 08:30 AM

Government Operations Committee

Committee to consider declaring 8507 South Broadway exempt surplus land

The Government Operations Committee will discuss five agenda items, including a motion to declare the City‑owned property at 8507 South Broadway as “Exempt Surplus Land” under the California Surplus Land Act. Other items include revising the lease with El Nido Family Centers at 11243 Glenoaks Boulevard, a security‑infrastructure motion for City facilities, a City Attorney report on cease‑and‑desist letters to tobacco retailers selling mislabeled hemp products, and a proposed nonprofit lease for nursery use at 401 North Avenue 19, south of the Lincoln Heights Jail. The committee will also take limited in‑person public comment on these items.

land-usesurplus-landleasespublic-safetytobacco
Room 401
Notable items
Tue Nov 4, 2025 · 02:00 PM

Budget and Finance Committee

Budget Committee to review FY 2025-26 financial status and construction reports

The Budget and Finance Committee will discuss the first financial status report for Fiscal Year 2025-26 and the second construction projects report. The body is also considering a cannabis business tax relief program and various grant applications.

budgetcannabisgrantscontractspoliceconstruction
✓ Decided: Committee approves three‑year fiduciary service contracts with law firms

The Budget and Finance Committee approved the City Administrative Officer’s First Financial Status Report for FY 2025‑26. It concurred with Transportation, Government Operations, and Civil Rights committees on related reports. It approved a motion allowing city departments to sell goods they produce and a Cannabis Business Tax Relief Program. It also approved three‑year fiduciary service contracts with Groom Law Group, Kutak Rock LLP, and Nossaman LLP.

Notable items
Fri Oct 31, 2025 · 10:00 AM

City Council Meeting

City Council will consider Ordinance 25-0391 on second review

The Los Angeles City Council meeting on Oct 31, 2025 will open with roll call, approve the minutes, and consider commendatory resolutions. Council members will hear multiple agenda item comments and public testimony on non‑agenda items. The agenda includes a second‑consideration of Ordinance 25‑0391.

councilordinancepublic-commentproceduralmeetings
✓ Decided: City Council approves lease with North Valley Caring Services for food pantry

The council adopted the Government Operations Committee report to authorize the Economic and Workforce Development Department to negotiate and execute a new lease with North Valley Caring Services for food pantry and social services at 10801 and 10807 San Fernando Road and 13269 Van Nuys Boulevard. The agreement is a no‑cost lease; NVCS will handle tenant improvements, maintenance, utilities, security and custodial expenses. The motion passed with 11 votes in favor, no votes against, and four members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] (Continued from Council meeting of October 28, 2025) Adopted Item as Amended by Motion SA (Rodriguez - Hutt) - SEE ATTACHED
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Raman yea · Rodriguez yea · Soto-Martinez yea
Wed Oct 29, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meets to discuss agenda items

The Los Angeles City Council will hold its regular meeting on Wednesday, October 29, 2025, at 10:00 AM in the John Ferraro Council Chamber. The agenda includes the approval of minutes, commendatory resolutions, and a period for public comment on non-agenda items.

city-councilmeetingpublic-commentagendalos-angeles
✓ Decided: Council considered settlement of Cesar Chavez lawsuit, authorizing $173,348.96 payment

The council reviewed a motion to settle the case Cesar Chavez 888, LLC v. City of Los Angeles. The motion would authorize the City Attorney to spend up to $173,348.96, pay $170,260.50 in attorney fees and $3,088.46 in costs, and draw the funds from the Liability Claims Fund. The Budget and Finance Committee had recommended approval. The minutes do not record a council vote outcome.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
Wed Oct 29, 2025 · 08:30 AM

Ad Hoc Committee on the 2028 Olympic and Paralympic Games

Committee to discuss LA28 Closing Ceremony location

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games will receive verbal updates on economic opportunities and the organizing committee's annual report. The committee will also discuss a motion to relocate the Closing Ceremony to the Los Angeles Memorial Coliseum.

olympicsla28closing-ceremonymemorial-coliseumbudgetpublic-hearing
✓ Decided: Committee approved moving LA28 Closing Ceremony to the Coliseum

The committee heard discussion updates and a joint report but took no action on those items. It approved a motion to relocate the LA28 Closing Ceremony to the Los Angeles Memorial Coliseum. The motion passed with six votes in favor and one member absent.

Notable items
Tue Oct 28, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Committee to review airport contracts and harbor drainage permit

The Trade, Travel and Tourism Committee will discuss several reports from the Board of Airport Commissioners and the Board of Harbor Commissioners. The meeting includes reviews of contract amendments and a permit for storm drain maintenance.

airportsharborcontractsinfrastructuretourism
Notable items
Tue Oct 28, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to consider approval of a 125‑room hotel at West Pico and South Arapahoe

The Planning and Land Use Management Committee will review a series of agenda items, including categorical exemptions for historic‑cultural monuments, draft ordinances for zoning changes, and updates to city codes. Key projects include a mixed‑income 17‑unit apartment redevelopment, a five‑unit small‑lot subdivision, and a large hotel development with 125 guest rooms. The committee will also discuss ordinance amendments related to homeless shelters and building‑code references.

zoninghousingdevelopmenthistoric-culturalhomeless-shelterbuilding-code
Notable items
Tue Oct 28, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for October 28, 2025

The provided agenda consists of procedural boilerplate and meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Oct 28, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Appointment of Fabian Renee Wesson to Library Commissioners board

The Arts, Parks, Libraries, and Community Enrichment Committee will hear a verbal presentation from FilmLA and several mayoral communications about reappointments to the Los Angeles City/County Native American Indian Commission. The committee will consider the appointment of Fabian Renee Wesson to the Board of Library Commissioners for a term ending June 30, 2027. It will also review reports and grant acceptances affecting animal services, parks programs, and the Los Angeles Zoo Vision Plan.

libraryanimal-servicesparksgrantszoocommunity
✓ Decided: Committee approves numerous grants and appointments, notably Dodgers Dreamteam grant

The Arts, Parks, Libraries, and Community Enrichment Committee approved a series of reports, grants, and appointments. All items received two affirmative votes with Councilmember Nazarin absent. No action was taken on the FilmLA presentation.

Notable items
Fri Oct 24, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for October 24, 2025

The provided agenda consists of procedural boilerplate and general meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
✓ Decided: Council approved $11.77 M of fund transfers/appropriations and an e‑bike voucher program

The Los Angeles City Council adopted three committee reports that file various agency reports. It approved a series of transfers and appropriations totaling $11.77 million and combined two Metro projects into a single e‑bike voucher program for about 900 low‑income participants. The council also continued consideration of a $750,000 legal‑services contract with Munger, Tolles & Olson. All actions passed 10‑0 with five members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Friday - October 24, 2025 - PAGE 1 Community Impact Statement: None submitted Adopted Item Forthwith
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item Forthwith
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Friday - October 24, 2025 - PAGE 2 Community Impact Statement: None submitted Adopted Item Forthwith
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea
that the recommendations stated in this report comply with the City Financial Policies in that appropriations for funds are limited to available cash balances needed to fund ongoing maintenance…
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea
[context] Pursuant to Council Rule 53, if the City Council has not lost jurisdiction over an item voted upon at the meeting, or caused it to be continued beyond the next regular meeting or placed in…
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea
Fri Oct 24, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee to consider LACERS GM appointment and personnel matters

The Personnel and Hiring Committee will review the appointment of a permanent General Manager for the Los Angeles Employees’ Retirement System and discuss personnel matters including a job classification and a citywide layoff management report.

personnelhiringretirementlayoffscity-hallbudgetlabor
✓ Decided: Council appoints Todd A. Bouey as permanent LACERS General Manager

The Personnel and Hiring Committee approved the appointment of Todd A. Bouey as permanent General Manager of the Los Angeles City Employees' Retirement System. It also approved an exemption for a Deputy City Engineer position, restored the Marketing Specialist classification, amended the Port Pilots MOU, noted the LAwell Benefits Trust Fund report, and approved a hiring‑status motion for the Convention Center project.

Room 401
Wed Oct 22, 2025 · 10:00 AM

City Council Meeting

Council will conduct roll call, approve minutes, and hear public comments

The Los Angeles City Council meeting will begin with a roll call of members. Councilmembers will vote to approve the minutes from the previous meeting. The agenda includes commendatory resolutions, introductions and presentations, and a multiple agenda item comment period for the public. The council will also hear public testimony of non‑agenda items within its jurisdiction.

city-councilprocedurepublic-commentminutesresolutions
✓ Decided: City Council approved $930,202 increase to DWP software contract

Council members unanimously approved a $930,202 increase to the Department of Water and Power’s software maintenance agreement, raising the total to $11,186,147. They also directed the Bureau of Sanitation and Engineering to deliver a water and sewer infrastructure report for the Roscoe‑I‑405 area within 180 days. The council denied two appeals: one for a development at 201 West Sotello Street and another challenging the Prologis warehouse project, sustaining prior approvals. Finally, the council approved the designation of the Pabian Residence at 21735 West Ybarra Road as a Historic‑Cultural Monument.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] (The pending litigation involves the above listed complaint regarding the City’s alleged liability regarding damage relating to the Palisades Fire, which began on January 7, 2025.)]…
10 yea · 2 absent · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Padilla absent · Price Jr absent
The other 25 items passed by unanimous or near-unanimous consent.
Wed Oct 22, 2025 · 03:30 PM

Public Works Committee

Council may recess to closed session over Mark Willits ADA sidewalk repair litigation

The Public Works Committee will hear a presentation on the Sidewalk Repair program and consider several motions, including a possible closed‑session recess to discuss litigation risk from the Mark Willits ADA case. Items also include a CEQA report for the Sidewalk Repair program, a grant‑program motion for vertical content creators, and various local‑square designations and street‑easement actions. Public comment will be taken in‑person only.

sidewalk-repairlitigationceqagrantspublic-nuisanceeasementstreetsmotions
Notable items
Wed Oct 22, 2025 · 08:30 AM

Transportation Committee and Special Joint Meeting with Public Works Committee

LA Transportation and Public Works Committees to meet on infrastructure and parking

The Transportation Committee and Public Works Committee are meeting to discuss city infrastructure, transit technology, and parking restrictions. The body will review reports on air quality, bike paths, and the maintenance of public right-of-way infrastructure.

transportationparkinginfrastructuretransitpublic-worksbike-paths
Tue Oct 21, 2025 · 08:30 AM

Government Operations Committee

Committee to discuss cannabis tax relief and city infrastructure reports

The Government Operations Committee will review reports on city construction projects, the My311 system, and AI translation services. The body will also consider motions regarding a cannabis business tax relief program and public right-of-way infrastructure analysis.

cannabistax-reliefinfrastructurereal-estateinformation-technology
✓ Decided: Committee approved lease for 16800 Victory Blvd property

The Government Operations Committee approved multiple items, including a franchise renewal for PS Southern California One, LLC, a lease agreement for the 16800 Victory Boulevard property, and motions on cannabis tax relief, right‑of‑way standards, and property acquisitions. Most approvals were unanimous; three items passed with a 2‑1 vote due to one member absent. No proposals were denied.

Room 401
Notable items
Tue Oct 21, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee will consider authorizing city departments to sell goods they produce

The Rules, Elections and Intergovernmental Relations Committee will review several items, including a City Ethics Commission report on lobbying ordinance updates, a mayoral appointment to the Ethics Commission, and a motion to let city departments sell goods they produce. The most significant action is a motion (Hutt–Soto‑Martínez) to authorize city departments and bureaus to sell goods they produce, which was previously approved by the Public Works Committee. The committee will also discuss motions affecting committee jurisdictions and the city’s positions on various state and federal bills.

ethicscity‑departmentslegislationcommittee‑jurisdictionpublic‑works
Tue Oct 21, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee to study minimum wage for residential construction

The Economic Development and Jobs Committee will consider a motion to commission a study on the effects of a Residential Construction Minimum Wage for mid-size residential construction projects in the city. The meeting will be held in Room 401 at City Hall.

economic-developmentjobswagesconstructionpublic-commentcity-hall
Notable items
Tue Oct 21, 2025 · 10:00 AM

City Council Meeting

City Council meeting follows standard procedural agenda

The Los Angeles City Council will conduct its regular meeting, covering roll call, approval of minutes, commendatory resolutions, introductions, multiple agenda item comments, and public testimony of non‑agenda items. No specific policy items, contracts, or ordinances are listed in the agenda.

procedurespublic-commentcity-council
✓ Decided: Council adopts $9.235 billion FY 2025‑26 budget limit and key ordinances

The council approved a $9,235,505,368 appropriations limit for fiscal year 2025‑26. It also adopted ordinances adjusting the extra‑capacity refuse collection fee and creating a metal‑and‑wire theft reward program. The council extended the interim control ordinance for the Cornfield Arroyo Seco area, authorized a revocable permit for ICON Panorama construction, and approved several fund transfers for street and community projects. It amended the public‑safety committee meeting schedule and allocated $117,000 to local organizations.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
ORDINANCE SECOND CONSIDERATION relative to adjusting the Extra Capacity Refuse Collection Fee for the Bureau of Sanitation Solid Resources Program. Recommendation for Council action, SUBJECT TO THE…
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
ORDINANCE SECOND CONSIDERATION relative to adding to the Los Angeles Administrative Code (LAAC) the creation of the Metal and Wire Theft Reward Program. Recommendation for Council action, SUBJECT TO…
10 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
The other 15 items passed by unanimous or near-unanimous consent.
Tue Oct 21, 2025 · 02:00 PM

Budget and Finance Committee

Budget and Finance Committee to review housing grants and city liability cases

The Committee will discuss a range of financial matters, including housing department grants and delinquent accounts. The meeting also includes numerous closed sessions to confer with legal counsel regarding city lawsuits and liability claims.

budgethousinggrantslegal-liabilityinfrastructurepublic-safety
✓ Decided: Approved transfer of LAFD funds to State Health Care Services for Medi‑Cal program

The Budget and Finance Committee approved several reports and motions, including the Collections Board of Review report and a motion to transfer Los Angeles Fire Department funds to the State Department of Health Care Services for the Medi‑Cal program. The committee also approved the City Administrative Officer’s 2025‑26 First Transportation‑Related Construction Projects report and its addendum. It concurred with Energy and Environment Committee actions on multiple environmental and infrastructure reports, and with Housing and Homelessness Committee actions on landlord‑notice and housing grant reports.

Notable items
Tue Oct 21, 2025 · 03:30 PM

Energy and Environment Committee

Committee discusses DWP tariffs, brownfield grants, and city shade initiatives

The Energy and Environment Committee will review a proposed ordinance for the Department of Water and Power Open Access Transmission Tariff. The body will also discuss applying for EPA Brownfields Cleanup Grants for Council District 8 and collaborations with the ShadeLA campaign.

energyenvironmentzoningpublic-healthutilities
Notable items
Fri Oct 17, 2025 · 08:30 AM

Government Efficiency, Innovation, and Audits Committee

City staff will report Innovation Fund funding for 3D‑printing street‑lighting project

The committee will hear a City Administrative Officer report on funding from the Innovation Fund for the Bureau of Street Lighting’s 3‑D printing public right‑of‑way project. The agenda item includes a fiscal impact statement and a financial policies statement. Public comment will be limited to one minute per item, with a total of two minutes allowed for multiple items.

innovationfundingstreet-lightingpublic-commentbudget
✓ Decided: Committee approved Innovation Fund recommendations for street‑lighting 3D‑printing project

The committee noted and filed the City Administrative Officer report dated April 8 2025 on funding from the Innovation Fund for the Bureau of Street Lighting 3D‑printing public right‑of‑way project. It approved the recommendations from CD 7 with three votes in favor and none against. No other actions were taken.

Notable items
Fri Oct 17, 2025 · 10:00 AM

City Council Meeting

City Council to consider nuisance abatement lien protest

The Los Angeles City Council will meet to conduct general business and a public hearing. The primary item for consideration is a protest, appeal, or objection regarding a Department of Building and Safety report and lien for nuisance abatement costs in Council District 1.

nuisance-abatementpublic-hearingbuilding-and-safety
✓ Decided: Council approved $2.25 M REAP 2.0 grant and MOU with SCAG

The council confirmed a $3,840.47 lien on 1351 South Albany Street (12‑0 vote). It adopted the Workplace Violence and Protection Plans report and instructed the Personnel Department to report back in 180 days (11‑0 vote). The council continued the eviction‑defense contract with Legal Aid Foundation (11‑0 vote). Finally, it approved the REAP 2.0 grant of up to $2.25 M and authorized a memorandum of understanding with SCAG (12‑0 vote).

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $3,840.47) (Continued from Council meeting of August 13, 2025) Adopted Item to confirm the lien
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea
[context] Adopted Item
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Rodriguez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Rodriguez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Lee yea · Nazarian yea · Padilla yea · Friday - October yea · Raman yea · Rodriguez yea · Yaroslavsky yea
Fri Oct 17, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee will consider adding $1 million to RepresentLA funding for two neighborhood councils.

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will review several funding and policy items. Items include a $1 million increase for RepresentLA serving Reseda and North Westwood Neighborhood Councils, a police report on waiving vehicle impound for immigration detainees, and a proposal for a land acknowledgment statement and Native American commission MOU. The committee will also consider grant acceptances for SNAP‑Ed/CalFresh healthy‑living programs and aging services, and a motion to transfer funds for improvements to the Pacoima Little League Facility.

fundingpoliceimmigrationagingdisabilitynative-americanparks
Notable items
Wed Oct 15, 2025 · 10:00 AM

City Council Meeting

Council continues hearing on Building Safety report and nuisance abatement lien

The Los Angeles City Council will hold roll call, approve the previous meeting minutes, and consider commendatory resolutions. Council members will open a multiple‑agenda item comment period for public input. A public testimony segment will allow non‑agenda items to be presented. The council will continue consideration of hearing protest, appeals or objections to the Department of Building and Safety report and confirm a lien for nuisance abatement cost (Item 25‑0160‑S93 CD 10).

city-councilpublic-hearingbuilding-safetynuisance-abatementprocedures
✓ Decided: Council approved $1.4 million transfer from arrest fund to General Fund

The City Council approved a $1,398,997.48 transfer of unclaimed arrest‑related monies to the General Fund and a $247,082.37 refund claim for a building permit. It also approved the Department of Aging’s 2025‑26 regional plan, directed the Bureau of Sanitation to use trash trucks for a “Know Your Rights” campaign, and asked the Civil Rights Department to study an online intake system for immigration‑enforcement testimony. The Council authorized a contract up to $55,000 with Agency M Media for the campaign and requested a report on amending the municipal code to ban youth‑targeted cannabis marketing.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (23 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) (Continued from Council meeting of August 13, 2025) Adopted Item to Continue to November 14, 2025
11 yea
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Wednesday - October 15, 2025 - PAGE 2 Adopted Item
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item
48 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Fiscal Impact Statement: The DOA reports that there is no additional impact to the City’s General Fund Community Impact Statement: None submitted Adopted Item
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Reseda Neighborhood Council Adopted Item
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the recommendations in the report comply with the City’s Financial Policies in that grant funds will be used for grant-eligible activities Community Impact Statement: None submitted Wednesday -…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
to amend the LAMC to prohibit and penalize youth-targeted cannabis marketing not currently addressed by State or local law. Fiscal Impact Statement: Neither the City Administrative Officer nor the…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] City Tourism Department report dated November 30, 2023 Fiscal Impact Statement: Not applicable Community Impact Statement: Yes For, if Amended: Downtown Los Angeles Neighborhood Council…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item as Amended by Motion (Nazarian – Yaroslavsky) - SEE ATTACHED
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the Mayor’s reappointment of Charlie Cea to the ULA COC for the term ending June 30, 2030, is APPROVED and CONFIRMED. Appointee currently resides in Council District 13. (Current Composition: M…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 11645 West Riverside Drive (Case No. 863870), Assessor I.D. No. 2354-010-038, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 6729 North Lemp Avenue (Case No. 823394), Assessor I.D. No. 2320-014-026, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 19962 West Roscoe Boulevard (Case No. 869051), Assessor I.D. No. 2106-001-025, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 614 East 21st Street (Case No. 835511), Assessor I.D. No. 5127-006-006, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 1467 East 109th Street (Case No. 846208), Assessor I.D. No. 6070-003-036, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 635 East 29th Street (Case No. 667230), Assessor I.D. No. 5128-013-021, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 4755 West Maplewood Avenue (Case No. 485672), Assessor I.D. No. 5521-014-023, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
RESOLUTION removing the property at 16519 South Ainsworth Street (Case No. 814571), Assessor I.D. No. 6121-007-015, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident on August 29, 2022, on the sidewalk in front of 1932 Hillhurst Street, in the City of Los Angeles.) (The Budget and Finance Committee…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Wed Oct 15, 2025 · 02:00 PM

Housing and Homelessness Committee

Committee to dissolve Affordable Housing Commission and fund homeless housing

The Housing and Homelessness Committee will consider dissolving the Affordable Housing Commission and transferring its functions to the Rent Adjustment Commission. The body will also vote on awarding $17.5 million in Fast Track Loan Program funding and accepting a regional grant for early action planning.

housinghomelessnessbudgetcommissionrentgrantsloanscd5
✓ Decided: City approved $17.55 M for eight fast‑track housing projects

The Housing and Homelessness Committee approved several reports and funding actions, including a $17,551,219 award to eight fast‑track housing projects, a lease for an interim housing site at 7253 Melrose Avenue, and a grant for the REAP 2.0 program. It also approved a second amendment to Contract C‑38260 with the Legal Aid Foundation for eviction‑defense services and a draft ordinance dissolving the Affordable Housing Commission. Additional mayor reports and a fund transfer to the LAPD were approved.

Notable items
Wed Oct 15, 2025 · 02:30 PM

Public Safety Committee

Mayor's communication on Jeffrey Skobin's appointment to Police Commission

The Public Safety Committee will consider a communication from the Mayor regarding the appointment of Jeffrey Skobin to the Board of Police Commissioners. The agenda notes that a Financial Disclosure Statement for the appointment has been filed and a background review is pending. No Community Impact Statement was submitted. The item must be acted on by the City Council by October 24, 2025.

public-safetypolice-commissionappointmentmayorcity-council
Tue Oct 14, 2025 · 10:00 AM

City Council Meeting

Council meeting focuses on procedural rules and public comment

The Los Angeles City Council will conduct roll call, approve minutes, consider commendatory resolutions, and provide time for multiple agenda item comments and public testimony on non‑agenda items. No specific policy proposals, contracts, or ordinances are listed in the agenda.

procedurespublic-commentminutesresolutionscity-council
✓ Decided: Council authorizes up to $50 M in bonds for school facilities

The Council approved a motion authorizing the California Enterprise Development Authority to issue bonds up to $50 million to finance construction and improvement of several school facilities in District 12. It also confirmed liens of $1,276.56 for a property on North Cantaloupe Avenue and $4,547.58 for a property on West Florence Avenue. Additionally, the Council adopted hearing schedules for multiple street‑lighting district improvement projects. All actions passed unanimously with a 13‑0 vote, with two members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
Ordinance dated September 22, 2025 relative to the Extra Capacity Refuse Collection Fee held over to October 21, 2025 for second consideration
10 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Rodriguez nay
[context] Community Impact Statement: None submitted Adopted Motion (Lee – Harris-Dawson) - SEE ATTACHED
7 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Raman yea · Rodriguez yea · Hernandez nay · Soto-Mart​ínez nay
Ordinance held over to October 21, 2025 for second consideration - SEE ATTACHED
7 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Raman yea · Rodriguez yea · Hernandez nay · Soto-Mart​ínez nay
[context] (This matter arises from a trip and fall incident on November 14, 2022, in front of 1655 West Washington Boulevard, in the City of Los Angeles.) (The Budget and Finance Committee considered…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - October nay
The other 20 items passed by unanimous or near-unanimous consent.
Tue Oct 14, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to consider hotel development and General Plan amendment in South LA

The Planning and Land Use Management Committee will review a series of motions, including investigations of reported nuisances at two properties, an amendment to the Historic Preservation Overlay Zone in the Jefferson Park neighborhood, several CEQA categorical exemptions for historic‑cultural monuments, a report on extending a warehousing control ordinance, an ordinance to protect wildlife areas in Ken Malloy Harbor Regional Park, a jurisdiction transfer request, and a General Plan amendment for a hotel project in South Los Angeles. The hotel proposal involves two six‑story buildings with 125 guest rooms and 77,828 square feet of floor area at 2250‑2270 West Pico Boulevard and 1309‑1315 South Arapahoe Street. Fiscal impact statements are provided for each item, with the hotel development indicating a fiscal impact. No community impact statements were submitted for any of the items.

zoninghistoric-preservationenvironmentalhousingdevelopmentparksnuisance
✓ Decided: Committee approves transfer of planning jurisdiction to City Council

The Planning and Land Use Management Committee adopted three motions to investigate nuisance activities at 2512 South Robertson Boulevard and 2215 Virginia Road and to amend the Historic Preservation Overlay Zone in Jefferson Park. It approved Cultural Heritage Commission reports adding the Pabian Residence, Wong Residence, and Greater Page Temple Church of God in Christ to the list of Historic‑Cultural Monuments. The committee also approved the transfer of jurisdiction from the City Planning Commission to the City Council and denied an appeal that had been withdrawn.

Notable items
Tue Oct 14, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Committee will consider waiving the DineLA restaurant participation fee

The Trade, Travel and Tourism Committee will hear reports from the Airport and Harbor Commissioners on several lease agreements and CEQA exemptions, including leases at 6550 Odessa Avenue and 16755 Roscoe Boulevard. A motion will be considered to waive the fee charged by the Los Angeles Tourism and Convention Board for restaurants participating in DineLA. The committee will take in‑person public comment on these items.

tourismfee-waiverairportharborleasesceqapublic-comment
Notable items
Tue Oct 7, 2025 · 08:30 AM

Government Operations Committee

City Council considers jurisdiction over a commercial cannabis license at 8122 N. Sepulveda Blvd.

The Government Operations Committee will review ten items, including motions on cannabis regulation, medical marijuana dispensary grandfathering, a fentanyl detection pilot, youth‑targeted cannabis marketing restrictions, and the sale of city land north of Nordyke Street. Several items involve lease agreements for housing and office space, and one concerns capital infrastructure planning. Public comment will be taken in person only.

cannabispublic-healthland-usehousingbudget
✓ Decided: Committee vetoed the Cannabis Regulation Commission’s Sept 4, 2025 action

The Government Operations Committee voted to veto the Cannabis Regulation Commission’s September 4, 2025 action. It also approved several motions and lease agreements as amended, including extending the grandfathering period for medical marijuana dispensaries and prohibiting youth‑targeted cannabis marketing. Additional approvals covered a fentanyl detection pilot, a property sale, and multiple non‑profit lease arrangements.

Room 401
Notable items
Tue Oct 7, 2025 · 10:00 AM

City Council Meeting

Council to hear protest and appeals on a nuisance abatement lien at 1626 East 114th St

The Los Angeles City Council will consider item 24-0160‑S108, which involves a hearing on protests, appeals, or objections to a Department of Building and Safety report and a lien related to nuisance abatement and code‑violation inspection costs for the property at 1626 East 114th Street. Council members will discuss the matter and may vote on any recommended action. The agenda also includes routine items such as roll call, approval of minutes, commendatory resolutions, and public comment periods.

buildingcode-enforcementpublic-hearingnuisance-abatementcity-council
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 5 divided votes
Named votes as recorded in the official record.
[context] Ordinances Held Over to October 14, 2025 for Second Reading
11 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Rodriguez nay
[context] Community Impact Statement: None submitted Adopted Item Forthwith
63 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Raman nay · Yaroslavsky nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Tuesday - October 7, 2025 - PAGE 22 Community Impact Statement: None submitted (City Attorney report adopted at the Council meeting of September 30, 2025) Adopted Item Forthwith
9 yea · 4 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Soto-Mart​ínez yea · Blumenfield nay · Raman nay · Rodriguez nay · Yaroslavsky nay
[context] Community Impact Statement: Yes For: Venice Neighborhood Council Adopted Housing and Homelessness Committee Report as Amended by Motion (Raman – Park) Forthwith - SEE ATTACHED
10 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
[context] Adopted Item Forthwith
160 yea · 11 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - October nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay · Yaroslavsky nay · Harris- Dawson nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay
The other 34 items passed by unanimous or near-unanimous consent.
Tue Oct 7, 2025 · 02:00 PM

Budget and Finance Committee

Budget committee to review wildfire recovery and public bank study

The Budget and Finance Committee will discuss funding for wildfire recovery projects, including fee waivers for rebuilding, and consider a study on a public bank. The meeting will also include reports on grant awards and a closed session on legal matters.

budgetwildfiresrecoveryfeesgrantspublic-banklegalparks
Notable items
Tue Oct 7, 2025 · 03:30 PM

Energy and Environment Committee

EPA Brownfields Grant report and multiple water infrastructure updates

The Energy and Environment Committee will receive several reports, including an EPA Brownfields Community‑Wide Assessment Grant report, a Los Angeles Fire Department analysis of the Wilmington oil spill, and updates on the MacArthur Lake stormwater capture project and drinking‑water infrastructure resilience program. The committee will also consider a software maintenance and support amendment with CGI Technologies. Public comment will be taken in person for these items.

environmentwaterinfrastructuregrantssoftwarepublic-comment
Notable items
Fri Oct 3, 2025 · 08:30 AM

Personnel and Hiring Committee

Personnel and Hiring Committee to discuss citywide layoffs and LAPD hiring

The Committee will review reports on citywide layoff management and sworn hiring for the Los Angeles Police Department. Other discussions include workplace violence protection plans and electric vehicle fire mitigation.

employmentlapdpublic-safetycity-managementworkplace-safety
✓ Decided: Approved workplace violence plan and EV fire equipment report

The Personnel and Hiring Committee approved the creation of Workplace Violence and Protection Plans under Senate Bill 553, with a vote of two yes and one absent. The committee also approved, as amended, the Los Angeles Fire Department’s report on equipment and training needed to mitigate electric‑vehicle fires, with the same vote tally. No other agenda items received a vote.

Room 401
Fri Oct 3, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meets to discuss agenda items

The Los Angeles City Council is scheduled to meet on Friday, October 3, 2025, at 10:00 AM in the John Ferraro Council Chamber. The agenda includes the approval of minutes, commendatory resolutions, and multiple agenda items, with opportunities for public comment.

los-angelescity-councilmeetingpublic-commentagenda
✓ Decided: Council moved to adjourn and considered commendatory resolutions

The council moved a motion to adjourn the meeting, with McOsker moving and council members seconding. A separate motion to consider commendatory resolutions was moved by Jurado and seconded by other members. The minutes do not record vote tallies or final adoption of these items. No other substantive decisions were recorded.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Oct 1, 2025 · 10:00 AM

City Council Meeting

City Council meeting focuses on procedural rules and public comment

The Los Angeles City Council will conduct its regular meeting, covering roll call, approval of minutes, commendatory resolutions, and multiple agenda item comments. The agenda includes public testimony on non‑agenda items and outlines time limits and voting procedures for council actions. No specific policy items, contracts, or ordinances are listed.

procedurespublic-commentgovernancemeeting-rules
✓ Decided: Council approved $15 M lightning protection contract and extended Adopt‑A‑Lot program

The City Council extended the Master License Agreement with Kounkuey Design Initiative for the Adopt‑A‑Lot pilot, authorized a up‑to‑$15 M personal services contract with Lyncole for lightning and overvoltage protection, and approved a no‑cost rooftop license for LAPD security equipment. It also approved a lease amendment with Kajima, instructed a feasibility study for temporary skating improvements, affirmed the Cannabis Regulation Commission's denial of a cannabis license, directed a report on legal action against illegal cannabis sales in tobacco shops, and adopted an amendment to a hiring‑hall memorandum.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
[context] Adopted Motion (Padilla – Harris-Dawson) and Municipal Facilities Committee Report - SEE ATTACHED
9 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
that the recommendations stated in the report comply with the City’s Financial Policies in that, to the extent possible, one-time grant funding will be utilized for one-time program expenditures…
10 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
that the recommendation provided in said report complies with the City’s Financial Policies in that, to the extent possible, one-time funding would be utilized for one-time program expenditures…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - October nay
ordinance should also require special event permittees to include information on available public transit options for event attendees as a part of promotional material or arrival instructions related…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Raman nay
The other 38 items passed by unanimous or near-unanimous consent.
Wed Oct 1, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee will consider demolition of 9019 Monte Mar Drive and rent‑stabilization methodology amendment

The Housing and Homelessness Committee will hear a mayoral report on Charlie Cea's reappointment, discuss an economic study and a proposed amendment to the Rent Stabilization Ordinance methodology, and consider several motions including a temperature limit for rental units, simplified landlord notices, and demolition/rebuilding at 9019 Monte Mar Drive.

housinghomelessnessrent-stabilizationdemolitionaffordable-housinglandlord-noticestemperature-thresholdeconomic-study
✓ Decided: Committee approves mayor report and several housing policy motions

The Housing and Homelessness Committee approved the mayor's report on the reappointment of Charlie Cea. It also approved four motions related to housing policy, including landlord notice templates, a temperature‑threshold ordinance for rentals, demolition permits for a mold‑affected property, and an affordable‑housing project on LADOT parking lots. All approvals recorded a unanimous 5‑yes vote.

Notable items
Wed Oct 1, 2025 · 03:30 PM

Public Safety Committee

Police Foundation donates $1.17 M for LAPD emergency vehicles

The Public Safety Committee will hear a presentation on copper wire theft impacts, a draft ordinance to create a metal and wire theft reward program, and a report on the FY24 Edward Byrne Memorial Justice Assistance Grant. It will also consider two non‑monetary donations from the Los Angeles Police Foundation: $50,000 for equipment lockers and $1,173,368.69 for command post vehicles, trailers and equipment for the LAPD Emergency Services Division. The items are for discussion and reporting; no specific actions are indicated.

policedonationsordinancepublic-safetygrantequipment
Tue Sep 30, 2025 · 10:00 AM

City Council Meeting

City Council to hold public hearing on sanitation fee adjustments

The Los Angeles City Council will hold a public hearing to discuss proposed rate adjustments for the Bureau of Sanitation's Solid Resources Fee (SRF) and Multi-Family Bulky Item Fee (MBIF).

sanitationfeespublic-hearing
✓ Decided: City Council approved VNEM ordinance changes and eight other actions

The Los Angeles City Council adopted a series of measures, including changes to the Virtual Net Energy Metering pilot program. It also granted a liquor license for United Pacific, extended grant deadlines for the Los Angeles Boys and Girls Club projects, and authorized a right‑of‑entry agreement for animal services. Additional actions included a $400,000 fund transfer for litigation, a contract with Aeon Nexus for the criminal case management system, and a refund to LRRB, LLC.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
that the recommendations in the report comply with the City’s Financial Policies. Community Impact Statement: None submitted Adopted Item
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
[context] Community Impact Statement: None submitted Adopted Item as Amended by Motion 28A (Park – Rodriguez) - SEE ATTACHED
13 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - September nay
[context] Ordinances held over to October 7, 2025 for second consideration
9 yea · 4 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea · Blumenfield nay · Raman nay · Rodriguez nay · Yaroslavsky nay
The other 39 items passed by unanimous or near-unanimous consent.
Tue Sep 30, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to vote on demolition and rebuilding permit for 9019 Monte Mar Drive

The Planning and Land Use Management Committee will consider a motion to authorize permits for demolishing a single‑family residence and accessory dwelling unit at 9019 Monte Mar Drive and rebuilding a new residence with a junior ADU. It will also review a certified Housing Element Environmental Impact Report and proposed Affordable Housing Streamlining Ordinance amendments. Additional items include a recommendation on an Olympic/Paralympic zoning exemption and a CEQA exemption with an interim control ordinance for recreational vehicle parks.

housingdevelopmentzoningenvironmentpermitsolympics
✓ Decided: Approved demolition and rebuilding permits for 9019 Monte Mar Drive

The Planning and Land Use Management Committee adopted a motion authorizing permits to demolish a single‑family residence and accessory dwelling unit at 9019 Monte Mar Drive and to rebuild with an attached junior ADU. The committee also approved a revised City Planning report and asked the City Attorney to draft an ordinance for affordable‑housing streamlining. It approved City Planning reports and recommendations for an Olympic/Paralympic zoning exemption and for a citywide interim control ordinance for recreational‑vehicle parks.

Notable items
Tue Sep 30, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to discuss park needs and childcare facility operations

The Arts, Parks, Libraries, and Community Enrichment Committee will receive a verbal report on the status of the Park Needs Assessment and discuss the operation of Recreation and Park's childcare facilities. The committee is also scheduled to adopt a budget recommendation.

parksrecreationbudgetchildcareschool-district
✓ Decided: Committee adopts budget recommendation for park childcare facilities

The Arts, Parks, Libraries, and Community Enrichment Committee adopted the budget recommendation related to the Request for Proposal for operating Recreation and Parks childcare facilities. The verbal report on the Park Needs Assessment and related matters was continued to a later date. No vote tally was recorded for either item.

Notable items
Fri Sep 26, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for September 26, 2025

The provided agenda consists of procedural boilerplate, meeting rules, and accessibility information. No specific legislative items or decisions are detailed in the text.

procedural
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Thu Sep 25, 2025 · 12:00 PM

Housing and Homelessness Committee

Committee to review Alliance Settlement Agreement bed plan

The Housing and Homelessness Committee will meet to discuss reports from the City Administrative Officer. The discussion focuses on the bed plan and strategy related to the Alliance Settlement Agreement.

homelessnesshousingsettlement-agreement
✓ Decided: Housing & Homelessness Committee approved CAO report

The committee approved the City Administrative Officer report for agenda item 23-1022‑S18, dated September 16 2025, and noted the amended report dated September 24 2025. The Fiscal Impact Statement and Financial Policies Statement were both marked as “Yes,” and no Community Impact Statement was submitted.

Notable items
Fri Sep 19, 2025 · 10:00 AM

City Council Meeting

Council will consider a report on a neighborhood park at 2541 South Genesee Ave.

The City Council meeting on September 19, 2025 includes routine items such as roll call, approval of minutes, commendatory resolutions, and public comment. The primary agenda item is a report from the Arts, Parks, Libraries, and Community Enrichment Committee regarding the development of a neighborhood park at the Park and Ride site on 2541 South Genesee Avenue. Council members will discuss the proposal and may take action on the park project.

parkscommunity-enrichmentcity-councilpublic-commentneighborhood-development
✓ Decided: Council approved $2.18 M grant for Victim Assistance Program

The City Council accepted a $2,178,585 County grant to fund the Victim Assistance Program and created the necessary fund accounts and transfers. It also directed reviews of department structures, approved a new conflict‑of‑interest code, and ordered feasibility studies for two neighborhood parks. Resolutions were adopted to support increasing the U‑visa cap and to back Senate Bill 749 protecting mobile‑home parks. The Council instructed a report on reforming the City’s legal‑service delivery model.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] – Nazarian) and Motion (McOsker – Harris-Dawson) - SEE ATTACHED
10 yea · 2 nay · 1 absent
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea · Raman nay · Yaroslavsky nay · Blumenfield absent
The other 9 items passed by unanimous or near-unanimous consent.
Fri Sep 19, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee to approve contract with Agency M Media for Know Your Rights campaign

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will consider several mayoral appointment reports, a Department of Aging plan update, and multiple motions. Items include reports on appointments to the Commission on Disability and the Board of Human Relations Commissioners, a motion to use the sanitation truck fleet for a public awareness campaign, and a contract execution with Agency M Media for the Know Your Rights campaign. The committee will also discuss a motion directing the Housing Department to develop an immigration know‑your‑rights information sheet and related funding analysis.

appointmentsrights-campaigncontractsimmigrationhousing
Wed Sep 17, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meeting scheduled for September 17, 2025

The provided agenda consists of procedural boilerplate and general meeting rules. No specific legislative items, contracts, or policy decisions are listed for this meeting.

procedural
✓ Decided: Council approved $9,030.35 reimbursement for HACLA child‑care project

The Los Angeles City Council unanimously approved reimbursement of labor and material costs for the Mar Vista Gardens Child Care Project and up to $9,030.35 for unpaid wages, and authorized an amendment to the Proposition K grant. The council also continued a hearing on a $2,774.69 lien for 572 East M Street and directed the Recreation Department to develop a Sepulveda Basin website plan for the 2028 Olympics. Additional directives required reports on splash‑pad repairs, immigration enforcement impacts on summer programs and city services, and potential contracts for health‑related community assistance.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
that the recommendations in the report are in compliance with the City's Financial Policies in that, to the extent possible, all grant funds will be utilized for grant-eligible activities. Community…
9 yea · 3 nay
Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Martinez nay
that the recommendations in the report are in compliance with the City's Financial Policies in that, to the extent possible, all grant funds will be utilized for grant-eligible activities. Community…
9 yea · 3 nay
Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Martinez nay
[context] Adopted Item as Amended by Motion 22A (Soto-Martinez — Raman — Yaroslavsky) - SEE ATTACHED
10 yea · 2 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea · Hutt nay · Park nay
[context] Community Impact Statement: Yes Against: Sherman Oaks Neighborhood Council Adopted Item - SEE ATTACHED
10 yea · 2 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Soto- Martinez yea · Yaroslavsky yea · Nazarian nay · Raman nay
The other 24 items passed by unanimous or near-unanimous consent.
Wed Sep 17, 2025 · 02:30 PM

Housing and Homelessness Committee

Draft ordinance would require landlords to file written termination notice with City

The Housing and Homelessness Committee will receive a verbal update from the Los Angeles Homeless Services Authority and HR&A Advisors on the status of a report requested in Council file 24-0996 about Time Limited Subsidies. The Mayor will report on the reappointment of Michelle Coulter to the United to House LA Citizen Oversight Committee. The City Administrative Officer will report on the grant closeout of four Project Homekey1 projects funded by the Community Development Block Grant Program under the CARES Act. The committee will consider a draft ordinance amending the Municipal Code to require landlords to file a written notice terminating a tenancy with the City. A report will be presented on the 2025 Community Development Grant awarded to the Low Income Purchase Assistance Homeownership Program.

housinghomelessnessgrantsordinancelandlordbudget
✓ Decided: City Attorney ordinance requiring landlord notice was approved

The committee approved the mayor's report reappointing Michelle Coulter to the United to House LA Citizen Oversight Committee. It also approved the City Attorney's report and draft ordinance that requires landlords to file a written notice terminating a tenancy. The Los Angeles Housing Department's report on the 2025 Community Development Grant was approved. The City Administrative Officer's report on the closeout of four Project Homekey1 grants was noted and filed.

Notable items
Wed Sep 17, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to discuss fire mitigation and law enforcement policies

The committee is reviewing reports on fire hazard management, electric vehicle fire mitigation, and aerial firefighting services. Members will also consider ordinances regarding theft rewards and law enforcement employment restrictions.

fire-safetypolicepublic-safetyordinancesbudget
Notable items
Wed Sep 17, 2025 · 02:45 PM

Housing and Homelessness Committee - Special

Committee reviews updated bed plan under Alliance Settlement Agreement

The Housing and Homelessness Committee will receive a report from the City Administrative Officer on an updated bed plan responding to the Alliance Settlement Agreement (item 23-1022‑S18). The agenda notes that a Fiscal Impact Statement and a Financial Policies Statement are attached, but no Community Impact Statement was submitted. Public comment is limited to in‑person remarks, and the committee will not take general public comment at this special meeting.

housinghomelessnessbed-plansettlement-agreementcommittee
✓ Decided: Housing and Homelessness Committee took no substantive actions

The committee met on September 17, 2025 for a special session. It considered item 23-1022‑S18, a report on an updated bed plan, with the continuation date to be determined. No votes, approvals, or other actions were recorded. The meeting was limited to procedural matters and in‑person public comment only.

Notable items
Tue Sep 16, 2025 · 08:30 AM

Government Operations Committee

Committee to consider appointment of Patrice Lattimore as permanent City Clerk

The Government Operations Committee will discuss the appointment of a new City Clerk and review several city contracts and facility leases. The body will also consider legal action against tobacco shops selling cannabis and a proposal for skating improvements at a municipal complex.

city-clerkcontractscannabispublic-facilitiesleasing
✓ Decided: Council approved Patrice Lattimore as permanent City Clerk

The Government Operations Committee approved the Mayor's report appointing Patrice Lattimore as permanent City Clerk. It also approved contracts for lightning protection, a non‑profit leasing policy, temporary skating improvements, an amendment to the Adopt‑A‑Lot pilot, legal action against illegal cannabis sales, and a no‑cost rooftop license agreement. The committee took no recommendation on a lease amendment for the Civil + Human Rights and Equity Department.

Room 401
Notable items
Tue Sep 16, 2025 · 10:00 AM

City Council Meeting

Council to consider protest and lien issues for 11643 West Otsego St

The Los Angeles City Council will hold a continued consideration of a hearing protest, appeals, or objections related to a Department of Building and Safety report. The council will also review confirmation of a lien for nuisance abatement costs and non‑compliance of code violations and annual inspection costs for the property at 11643 West Otsego Street. The meeting also includes routine items such as roll call, approval of minutes, commendatory resolutions, multiple agenda item comment, and public testimony of non‑agenda items.

building-codenuisance-abatementproperty-issuescouncil-procedurepublic-hearing
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Sep 16, 2025 · 02:00 PM

Budget and Finance Committee

Committee considers $990 million in bonds for Convention Center project

The Budget and Finance Committee will discuss funding and environmental reports for the Los Angeles Convention Center Expansion and Modernization Project. The body will also review fee increases for the Bureau of Engineering and revised parking meter rates.

budgetbondsconvention-centerparking-feeshomelessnesspublic-works
Notable items
Tue Sep 16, 2025 · 03:30 PM

Energy and Environment Committee

Board of Water and Power reports on multiple contracts and amendments

The Energy and Environment Committee will consider nine agenda items, including reports and proposed actions on contracts, amendments, and a pilot program. Items include a Master Memorandum amendment with the Board of Water and Power, a contract with McCrometer Inc. for wastewater flow monitors, and a virtual net energy metering pilot program change. The committee will also hear a transition plan for workers affected by the Phillips 66 refinery closure and a report on Alameda Street widening CEQA compliance.

water-and-powercontractsenergy-metersworkforce-developmentceqa
Notable items
Mon Sep 15, 2025 · 10:00 AM

Ah Hoc Committee for LA Recovery

City Attorney reports on reallocating Measure ULA funding under city code

The Ad Hoc Committee for LA Recovery will hear verbal updates on the 2025 wind and fire storm recovery. It will review a Bureau of Sanitation report on ocean water quality after the Palisades Fire, a City Administrative Officer report on August 2025 wildfire recovery fund expenditures, and a City Attorney report on reallocating Measure ULA program funding. No actions or votes are scheduled; the items are for information and discussion only.

recoveryenvironmentbudgethousingpublic-safety
✓ Decided: Committee took no action and only filed reports

The Ad Hoc Committee for LA Recovery heard a verbal update on storm recovery and took no action on that discussion item. Reports from the Bureau of Sanitation, the City Administrative Officer, and the City Attorney were received and filed. No votes or approvals were recorded.

Fri Sep 12, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee considers prohibiting city employees from working for immigration enforcement

The Personnel and Hiring Committee will discuss motions to ban city officials and employees from secondary employment with federal immigration enforcement agencies. The body will also review several civil service exemptions and personnel appointments.

employment-policycivil-serviceimmigration-enforcementpersonnelwage-theft
✓ Decided: Committee approved bans on off‑duty employment with immigration enforcement agencies

The Personnel and Hiring Committee voted unanimously (3‑0) to adopt two motions prohibiting city officials and employees from holding secondary jobs with U.S. immigration enforcement agencies. It also approved several mayoral exemption requests, salary adjustments, and policy extensions, each with a 3‑0 vote.

Room 401
Fri Sep 12, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee will consider ordinance to raise the city’s inter‑departmental transfer limit

The Rules, Elections and Intergovernmental Relations Committee will review several reports and resolutions that set Los Angeles’ positions on immigration enforcement, state legislation, and environmental agreements. It will also consider two ordinances that amend the Los Angeles Administrative Code: one to increase the maximum inter‑departmental transfer amount and another to set the Council‑approval threshold for Los Angeles World Airports contracts. Public comment will be accepted in‑person only.

budgetingcity-codeimmigrationenvironmentairportslegal-services
✓ Decided: Committee approved the ‘No Masks for ICE’ Act requiring ICE agents to wear ID

The Rules, Elections and Intergovernmental Relations Committee approved a series of reports and resolutions, all with unanimous or near‑unanimous votes. Items included positions on immigration enforcement identification, U‑visa caps, environmental agreements, and mobile‑home park protections. Each action was recorded as approved with the indicated vote tally.

Notable items
Fri Sep 12, 2025 · 10:00 AM

City Council Meeting

Council will vote to approve the meeting minutes

The Los Angeles City Council meeting on September 12, 2025 will conduct a roll call, approve the minutes from the previous meeting, and consider several procedural items. It will also hear commendatory resolutions, introductions, and public comments on multiple agenda items and non‑agenda items. No substantive policy decisions or contracts are listed on the agenda.

procedurespublic-commentgovernancecity-council
✓ Decided: Council authorized up to $1.1 million grant for Venice Local Coastal Program

The City Council approved the LAWA Fiscal Year 2025‑26 Statement of Debt Accountability and Capital Improvement Plan. It instructed the City Administrative Officer, the Chief Legislative Analyst and relevant departments to report on any City projects impacted by H.R. 1. The Council also authorized the Department of City Planning to accept a Local Coastal Program grant of up to $1.1 million and to execute the related agreement with the California Coastal Commission.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportuntiy for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) (Budget and Finance Committee…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea
that the City receives from the federal government. Fiscal Impact Statement: Neither the CAO nor the CLA has completed a financial analysis of this report. Community Impact Statement: None submitted
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea
Wed Sep 10, 2025 · 08:30 AM

Transportation Committee

Transportation Committee will consider new parking meter zone on West Adams Blvd

The Los Angeles Transportation Committee will hear public comment and discuss several reports and motions, including a LADOT report on transportation investment prioritization and a motion to standardize parking‑meter payment methods. A key item is the Board of Transportation Commissioners' report proposing a Parking Meter Zone on West Adams Boulevard between La Brea Avenue and Hauser Boulevard. Additional items cover a pilot to close 6th Street to car traffic and an update on the Automated Speed Enforcement Program.

parkingzoningtransportationsafetybike-lanes
✓ Decided: Transportation Committee approved multiple LADOT reports and motions, including a 6th Street pilot

The committee unanimously approved ten LADOT reports and eight committee motions. All items received a 3‑Yes, 0‑No vote. The approved motions cover parking payment methods, a new parking meter zone, wider bike lanes, procurement efficiency, event advertising, QR codes on signage, and a weekend pilot to close 6th Street to car traffic.

Notable items
Wed Sep 10, 2025 · 10:00 AM

City Council Meeting

City Council meets to consider building safety and nuisance abatement

The Los Angeles City Council will hold its regular meeting on September 10, 2025, at 10:00 AM in the John Ferraro Council Chamber. The agenda includes the approval of minutes, introductions, and public comment, followed by the continued consideration of a Department of Building and Safety report regarding a nuisance abatement hearing protest.

city-councilbuilding-safetypublic-hearingnuisance-abatementagenda
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Sep 10, 2025 · 03:30 PM

Public Works Committee

Public Works Committee to discuss infrastructure plan and Bureau of Engineering fees

The Committee will consider a multi-year plan for public right-of-way infrastructure and an ordinance to increase Bureau of Engineering fees. Members will also discuss the feasibility of vacating public right-of-way for parks and a construction moratorium for the 2028 Olympic Games.

infrastructurezoningfeesparksolympicspublic-works
Notable items
Tue Sep 9, 2025 · 10:00 AM

City Council Meeting

Council to consider protests against 10th Street Elementary School lighting district

The Los Angeles City Council will meet to discuss several items, including a continued consideration of protests regarding the improvement and maintenance of the 10th Street Elementary School Street Lighting District.

lightingpublic-worksschools
✓ Decided: Council approved $14.1M in fund transfers and a $613K recreation budget cut

The Council accepted a $317,543 state grant for the Workers’ Rights Protection program and directed the transfer of $1,122,714.74 from the Unclaimed Monies Seized Trust to the General Fund. It also approved a $107,827.16 refund claim for Wisteria Warner Center and authorized multiple inter‑departmental fund transfers totaling $14,094,371 along with a $613,443 reduction in recreation funding. Additionally, the Council instructed city departments to conduct a “Know Your Rights” training for homelessness service providers.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (24 roll-call votes)
Named votes as recorded in the official record.
Ordinance will take place at Council on October 7, 2025.) (Continued from Council meeting of August 12, 2025) Adopted Item
28 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item
39 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Reseda Neighborhood Council Adopted Item
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item
97 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Resolution Authority, one Assistant City Attorney position, Class Code 0598, within the Office of the City Attorney for the implementation of the Citywide HMWO. 2. NOTE and FILE the Joint Bureau of…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Ordinance No. 187719, which adopted portions of the 2022 California Building Standards Code and made local administrative, climactic, geological, topographical and environmental changes as specified…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes Against: Westside Neighborhood Council Adopted Item
26 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Tuesday - September 9, 2025 - PAGE 17 Community Impact Statement: None submitted Adopted Item
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Tuesday - September 9, 2025 - PAGE 23 TIME LIMIT FILE - SEPTEMBER 22, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 19, 2025) Adopted Item
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Tuesday - September 9, 2025 - PAGE 28 Community Impact Statement: Yes For: Harbor Gateway North Neighborhood Council TIME LIMIT FILE - SEPTEMBER 22, 2025 (LAST DAY FOR COUNCIL ACTION -…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Tuesday - September 9, 2025 - PAGE 29 Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the sum of $50,000 shall be the aggregate maximum sum of any payment or payments of a City reward in this instance. Adopted Item
28 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (Rules, Elections and Intergovernmental Relations Committee waived consideration of the above matter) Adopted Item to Continue to September 10, 2025
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (Planning and Land Use Management Committee waived consideration of the above matter) Adopted Item Forthwith
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted (Housing and Homelessness Committee waived consideration of the above matter) Adopted Item Forthwith Tuesday - September 9, 2025 - PAGE 37
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a fall incident on January 30, 2022, near 3427 Griffith Park Boulevard, in Los Angeles, California.) (Budget and Finance Committee considered the matter in closed…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident on August 23, 2022, on the Tuesday - September 9, 2025 - PAGE 38 sidewalk at 1107 West 61st Street, in the City of Los Angeles.) (Budget…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident on December 4, 2021, on a sidewalk located at 5255 Zelzah Avenue, in Encino, California.) (Budget and Finance Committee considered the…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a May 14, 2021, trip and fall incident at the intersection of South Culver Place and South Vista Del Mar in Playa Del Rey.) (Budget and Finance Committee considered…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a September 27, 2025 trip and fall incident at 15049 Burbank Boulevard, in Sherman Oaks.) (Budget and Finance Committee considered the matter in closed session on…
13 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Tue Sep 9, 2025 · 02:00 PM

Planning and Land Use Management Committee

Approval of 340,298‑sq‑ft warehouse project on South Vermont Ave & W Redondo Beach Blvd

The Planning and Land Use Management Committee will consider continuing the Environmental Impact Report for a 340,298‑square‑foot warehouse and manufacturing center proposed by Prologis LP at 15116‑15216 South Vermont Avenue and 747‑861 West Redondo Beach Boulevard. The committee will also hear a motion to investigate reported nuisance activities at 402 W. 5th Street in San Pedro and a recommendation to accept a Local Coastal Program grant of up to $1.1 million. Several mayoral communications appoint individuals to area planning commissions for terms ending June 30, 2030.

zoningenvironmentdevelopmentcoastalappointmentsnuisance
✓ Decided: Committee approves $1.1 M coastal grant and denies mixed‑use project appeal

The Planning and Land Use Management Committee approved a $1.1 million Local Coastal Program grant and adopted a motion to let the Zoning Administrator investigate reported nuisance at 402 W. 5th St. It denied an appeal concerning a mixed‑use development, sustaining the planning commission’s determination, and approved several mayoral appointments to planning commissions.

Notable items
Tue Sep 9, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Port of LA CEQA appeal on West Harbor Modification Project (Item 25-0781)

The Trade, Travel and Tourism Committee will hear a report from the Port of Los Angeles and an appeal filed by UNITE HERE Local 11 under the California Environmental Quality Act. The committee will also consider two Board of Harbor Commissioners reports: one on a retroactive five‑year compensation reset and a transfer of permits, and another on a proposed amendment to an agreement with Nossaman, LLP. Public comment on these items will be accepted in person only.

harborenvironmentlaborcontractspublic-comment
✓ Decided: Committee denies UNITE HERE appeal and approves three Harbor Commission reports

The Trade, Travel and Tourism Committee denied the appeal filed by UNITE HERE Local 11 with a 3‑0 vote. It also approved two Board of Harbor Commissioners reports dated September 2, 2025, each with a 3‑0 vote. All actions were recorded as formal committee decisions.

Notable items
Tue Sep 9, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to review park developments and Proposition K grant amendments

The Arts, Parks, Libraries, and Community Enrichment Committee will discuss several potential new park sites and grant extensions for youth projects. The body is also reviewing appointments to the Board of Zoo Commissioners and the Cultural Affairs Commission.

parksgrantszoningartsanimal-servicespublic-works
✓ Decided: Mayor report reappointing Daryl Smith to Board of Zoo Commissioners approved

The Arts, Parks, Libraries, and Community Enrichment Committee approved the mayor’s report to reappoint Daryl Smith to the Board of Zoo Commissioners through June 30, 2030. It also approved the mayor’s report to reappoint Robert Vinson to the Cultural Affairs Commission and several Proposition K‑for‑Kids reports covering child‑care construction, Boys & Girls Club projects, and park‑restoration authorizations. Additional approvals included a city‑admin officer right‑of‑entry agreement for animal‑services centers and multiple motions directing feasibility studies for new parks and community programs. All votes were 2 Yes, 0 No, with Councilmember Nazarian absent.

Notable items
Tue Sep 9, 2025 · 11:45 AM

Budget and Finance Committee

Committee to consider $990 million bond issuance for L.A. Convention Center

The Budget and Finance Committee will review a CAO report confirming no new Environmental Impact Report is needed for the Los Angeles Convention Center expansion. It will consider authorizing up to $990 million in MICLA lease‑revenue bonds (2025‑A and 2025‑B) to fund the project. The Committee will also hear a City Attorney report on a proposed amendment to the contract with Gibson, Dunn & Crutcher for legal services in a federal litigation matter.

budgetfinancebondsconvention-centerlegal-servicesenvironmental-review
✓ Decided: Committee postponed three items to September 16, 2025

The Budget and Finance Committee did not vote on any agenda items. All three items were continued to the next meeting on September 16, 2025. No approvals, denials, or other actions were taken.

Notable items
Mon Sep 8, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission to consider adding President Emeritus title to bylaws

The Los Angeles City Health Commission will hold its regular meeting on September 8, 2025 at City Hall. Commissioners will hear presentations on the completed Climate Vulnerability Assessment and on Measure ULA’s impact on low‑income housing. The commission will discuss and vote on a bylaw amendment to create a President Emeritus honorary title for former presidents who served at least two terms. The agenda also includes public comment, neighborhood council comments, and items for future discussion.

healthclimatehousingbylawspublic-comment
Notable items
Fri Sep 5, 2025 · 08:30 AM

Government Operations Committee

Committee discusses public bank study and cannabis regulation

The Government Operations Committee will discuss the creation of a publicly-owned bank and the enforcement of unlicensed cannabis businesses. The body will also consider a mayoral appointment and a property acquisition for a public park.

cannabisbankingparkspublic-safetycity-administration
✓ Decided: Committee approved seven motions, adding a $460K bank study and park purchase

The Government Operations Committee voted unanimously to approve six separate motions and one property acquisition. Actions include a $460,000 study for a publicly‑owned bank, expanding the cannabis application refiling window, improving audio‑recording access, and acquiring land for a new park. The committee also approved a mayoral communication about an appointment to the Cannabis Regulation Commission and a multi‑year public right‑of‑way infrastructure plan.

Room 401
Notable items
Fri Sep 5, 2025 · 10:00 AM

City Council Meeting

Council conducts roll call, approves minutes, and reviews multiple agenda items

The Los Angeles City Council will begin with a roll call, then approve the previous meeting's minutes. Council members will consider commendatory resolutions and introductions, followed by a Multiple Agenda Item Comment period where the public can speak on items without prior hearings. The meeting will also include public testimony on non‑agenda items.

councilprocedurepublic-commentminutesresolutions
✓ Decided: Council approves $2M grant deposit for Chinese American Museum renovation

The Los Angeles City Council approved amendments to prior grant actions, authorizing the Bureau of Engineering to deposit $2,000,000 in State funds into the Engineering Special Services Fund for the Chinese American Museum renovation and $500,000 for ACE building accessibility improvements. The Council also adopted a resolution opposing the EPA's proposal to rescind the greenhouse gas endangerment finding, and approved several motions including fund transfers for homeless services and a $100,000 public benefits payment from Lightstone DTLA. The meeting included commendatory resolutions and adjourning motions.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] TIME LIMIT FILE - SEPTEMBER 28, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 26, 2025) Adopted Government Operations Committee Report - SEE ATTACHED
8 yea
Blumenfield yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Park yea · Price Jr yea · Rodriguez yea
Wed Sep 3, 2025 · 10:00 AM

City Council Meeting

City Council meeting focuses on procedural items and public comments

The Los Angeles City Council will conduct a roll call, approve the previous meeting's minutes, and consider commendatory resolutions. It will also include introductions, a multiple‑agenda‑item comment period, and public testimony. No specific policy or funding decisions are listed on the agenda.

proceduralcouncilpublic-commentminutesresolutions
✓ Decided: Council approved multiple animal services donations and spay/neuter agreements

The Council approved donations of spay/neuter services from the San Diego Humane Society and a right‑of‑entry license for a mobile clinic, accepted a $500,000 animal‑intervention donation from the Lange Foundation, and authorized similar agreements with Animal Balance and The Rescue Train, all with no direct General Fund impact. It also instructed the Department of Recreation and Parks to set sunrise‑to‑sunset operating hours for Verdugo Mountain Park and to post the hours. All votes on these items were unanimous.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
123 yea · 15 nay
Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Blumenfield yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea
[context] Adopted Item Wednesday - September 3, 2025 - PAGE 26
9 yea · 3 nay
Blumenfield yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
The other 18 items passed by unanimous or near-unanimous consent.
Wed Sep 3, 2025 · 01:00 PM

Personnel and Hiring Committee

Follow-up reports on citywide layoff management presented to committee

The Personnel and Hiring Committee will receive follow‑up reports from various departments concerning citywide layoff management (Item 25‑0660). The item continues from meetings held earlier in 2025. No fiscal impact is noted, and a community impact statement is attached. The committee will accept limited public comment but is not required to take action.

layoffpersonnelhiringcitywidereportspublic-comment
✓ Decided: Personnel and Hiring Committee met; no actions taken

The Personnel and Hiring Committee met on September 3, 2025. The meeting reviewed agenda item 25-0660, a continuation of follow‑up reports on citywide layoff management. No votes or formal actions were recorded. The session was otherwise procedural.

Room 401
Wed Sep 3, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to consider analysis of withdrawing all allowable homelessness funding

The Housing and Homelessness Committee will hear a mayoral report on Aaron Thomas's appointment to the Housing Authority board, a City Administrative Officer report on the Alliance Settlement Agreement progress, and a status report on the Homelessness Emergency Account with funding recommendations. It will also consider two motions: one requesting an analysis of withdrawing all legally allowable homelessness funding from the Los Angeles Homeless Services Authority and contracting with the Los Angeles County Department of Homeless Services, and another requesting a comprehensive financial and conversion plan for interim housing sites funded by Project Homekey. Public comment will be taken in person only.

housinghomelessnessfundingcontractsproject-homekeycity-budgetpublic-comment
✓ Decided: Committee approves analysis of withdrawing homelessness funding and other motions

The Housing and Homelessness Committee approved the mayor's report appointing Aaron Thomas to the Housing Authority Board. It also approved City Administrative Officer reports on the Alliance Settlement Agreement and the Homelessness Emergency Account. The committee approved a motion to analyze withdrawing all legally allowable homelessness funding from the Los Angeles Homeless Services Authority and contracting with the County Department of Homeless Services. Finally, it approved a motion for a comprehensive financial and conversion plan for interim housing sites using Project Homekey funds.

Notable items
Wed Sep 3, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to consider $7.4 million donation to LAFD

The Public Safety Committee will discuss several administrative reports, including professional services agreements for crisis response and reward payments for criminal cases. The body will also review appointments for fire and police commissioners and a potential in-kind donation to the LAFD.

public-safetyfire-departmentpolice-commissioncrisis-responseappointments
Notable items
Tue Sep 2, 2025 · 10:00 AM

City Council Meeting

Council will handle roll call, minutes approval, and public comment procedures

The Los Angeles City Council meeting will begin with a roll call, approve the previous meeting's minutes, consider commendatory resolutions, and provide time for multiple agenda item comments and public testimony on non‑agenda items. No specific policy decisions or contracts are listed on the agenda.

councilprocedurepublic-commentminutesresolutions
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Sep 2, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee reviews final EIR direction for L.A. Convention Center expansion

The Economic Development and Jobs Committee will hear a report on the final direction for the Los Angeles Convention Center Expansion and Modernization Project, confirming no major revisions to the existing Environmental Impact Report are needed. It will also consider a motion on an extended negotiating agreement with AEG and the Plenary Group, a draft ordinance to amend pandemic-related code language, a transition plan for workers affected by the Phillips 66 refinery closure, and a wage comparison study for park and film monitors.

environmental-impactconvention-centernegotiating-agreementcode-amendmentworkforce-transitionwage-study
Notable items
Tue Sep 2, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers issuing up to $6.767 billion in water and power system bonds

The Energy and Environment Committee will review several motions, including two bond authorizations that would allow the Board of Water and Power to issue up to $2.530 billion in water system revenue bonds and up to $6.767 billion in power system revenue bonds. Other items include a trash‑bin enforcement clarification, a Brownfields program funding strategy, a review of water and power department procedures for housing goals, and a report on a single‑use printer cartridge ban. The committee will also hear public comment on these agenda items.

budgetbondsenvironmentpublic‑workswaste‑management
Notable items
Tue Sep 2, 2025 · 02:00 PM

Budget and Finance Committee

Committee to discuss options for increasing General Fund Tax revenue

The Budget and Finance Committee will review reports on fiscal year appropriations and construction projects. The body is discussing methods to increase General Fund Tax revenue and maximizing Transient Occupancy Tax for the 2028 Olympic and Paralympic Games.

budgettax-revenuegrantspublic-safetytransportation
✓ Decided: Budget Committee approved $1.995 M DNA grant and other key funding actions

The Budget and Finance Committee approved several City Administrative Officer reports and concurred with other committees on major grant programs, including a $1,995,862 DNA capacity enhancement grant and a $317,543 Workers’ Rights Protection grant. It also approved the escheatment of $1,122,714.74 to the General Fund and adopted amendments to a transportation grant report. Additional approvals covered a Department of Building and Safety report and a City Attorney report.

Notable items
Fri Aug 29, 2025 · 10:00 AM

City Council Meeting

City Council meets to discuss homelessness and employment programs

The Los Angeles City Council will convene at Van Nuys City Hall to discuss a multi-year work plan aimed at scaling up employment programs to help individuals transition out of homelessness. The meeting will include standard procedural items such as roll call, approval of minutes, and public comment.

city-councilhomelessnessemploymentpublic-hearingvan-nuys
✓ Decided: Council adopted multiple housing and homelessness committee reports

The Los Angeles City Council adopted five reports covering economic workforce development, Proposition HHH quarterly updates, the Homelessness Emergency Declaration, and the County Emergency Centralized Response Center. Each item was adopted subject to reconsideration under Council Rule 51, with one report adopted as amended by Motion 5A. Vote tallies ranged from 12‑0‑3 to 14‑0‑1.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
44 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Yaroslavsky yea · Rodriguez nay
The other 1 item passed by unanimous or near-unanimous consent.
Wed Aug 27, 2025 · 10:00 AM

City Council Meeting

City Council to consider nuisance abatement lien protests

The City Council will meet to discuss several administrative items. The primary substantive matter is a continued consideration of protests, appeals, or objections regarding Department of Building and Safety reports on nuisance abatement costs and code violations.

code-enforcementnuisance-abatementpublic-hearings
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Aug 27, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers extending contract for Lincoln Theater homeless housing site

The Housing and Homelessness Committee will take public comment and discuss eight agenda items, including two mayor communications, two chief legislative analyst reports, a housing department report, and three motions. One motion seeks to extend Contract No. C-143351 with the Coalition for Responsible Community Development for operating expenses at the Lincoln Theater emergency homeless housing site at 2300 South Central Avenue. Other motions address a lease extension for the A Bridge Home site at 3248 Riverside Drive and a “Know Your Rights” training program for City‑funded homelessness service providers.

housinghomelessnesscontractsleasestrainingcode-enforcement
✓ Decided: Committee approved extending contract for Lincoln Theater emergency homeless housing site

The Housing and Homelessness Committee approved several actions. It adopted the Los Angeles Housing Department report on code‑enforcement and rent‑escrow enhancements. It approved extending Contract No. C‑143351 with the Coalition for Responsible Community Development for the Lincoln Theater site. It also approved a lease extension and service‑provider change for the A Bridge Home site and concurred with a city‑wide “Know Your Rights” training initiative.

Notable items
Wed Aug 27, 2025 · 03:30 PM

Public Works Committee

Committee considers ban on renting or selling RVs in public right-of-way

The Public Works Committee is meeting to discuss updates to the Municipal Code regarding vehicle rentals and tree protection. The body will also consider infrastructure projects and the naming of two city intersections.

zoningtransportationpublic-worksordinancesinfrastructure
Notable items
Wed Aug 27, 2025 · 08:30 AM

Transportation Committee

Transportation Committee to discuss parking restrictions and infrastructure updates

The Committee will consider several motions regarding oversize vehicle parking restrictions and street-level safety improvements. Members will also review reports on private ambulance service rates and a contract for parking citation processing.

parkingroadspublic-safetycontractstransit
✓ Decided: Committee dissolves Major Transit & Construction Traffic Management Committee

The Transportation Committee approved several motions, including dissolving the Major Transit and Transportation Construction Traffic Management Committee, prohibiting vehicles over 6,000 lb on a section of Del Amo Boulevard, and funding infrastructure improvements near the Sun Valley Metrolink Station. It also approved new splash pads, an expansion of a Preferential Parking District, and the purchase of electric‑vehicle charging infrastructure at the Washington Bus Yard. Additional approvals covered transit‑funding allocations and a contract for parking‑citation processing services.

401
Notable items
Wed Aug 27, 2025 · 08:00 AM

Ad Hoc Committee on the 2028 Olympic and Paralympic Games

Committee to direct Recreation & Parks to develop Sepulveda Basin website

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games will hear a verbal update from LA28 representatives. It will consider a motion (24‑1453 CD 6) to instruct the Department of Recreation and Parks, with other departments, to create a website for the Sepulveda Basin. The committee will also review reports on a construction moratorium, a venue‑plan amendment, the 2025 LA28 Organizing Committee annual report, and the LA28 Impact and Sustainability Plan.

olympicsparksconstruction-moratoriumvenue-plansustainabilitypublic-comment
✓ Decided: Ad Hoc Committee approved four LA28 actions, including Sepulveda Basin website plan

The committee approved a motion directing the Department of Recreation and Parks, with other departments, to create a work plan for a Sepulveda Basin website (6 Yes, 1 absent). It approved the Bureau of Engineering’s report recommending a construction moratorium during the Games (6 Yes, 1 absent). It approved the Joint Chief Legislative Analyst and City Administrative Officer’s report on the second amendment to the venue plan (7 Yes, 0 No). It also approved the Joint Chief Legislative Analyst and City Administrative Officer’s report on the LA28 Impact and Sustainability Plan (7 Yes, 0 No).

Notable items
Tue Aug 26, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to review zoning code changes for RV parks and restaurant permits

The Planning and Land Use Management Committee will consider technical corrections to a building standards ordinance, a report on improving restaurant inspection processes, and a draft definition for 'ghost kitchens.' The body will also review proposed zoning code amendments for recreational vehicle parks and a proposed development agreement for a mixed-use project in downtown Los Angeles.

zoningbuilding-safetyrestaurant-permitsghost-kitchensrv-parksdowntown-developmentplanning-commission
✓ Decided: Committee adopted definition for "ghost kitchens" to guide land-use controls

The Planning and Land Use Management Committee approved a City Attorney report correcting technical errors in an ordinance and adopted several motions, including a definition for "ghost kitchens" and a zoning amendment for recreational vehicle parks. It also approved the mayor's appointments of Sarah Johnson and Priscilla Chavez to the City Planning Commission. Additionally, the committee approved Planning Commission reports and asked the City Attorney to draft related ordinances.

Notable items
Tue Aug 26, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Trade, Travel and Tourism Committee to discuss LAX wireless and ICE protocols

The committee will review proposed amendments to airport concessions agreements and a report on airport debt. The body will also discuss protocols for federal agents on airport property.

laxairportconcessionswirelessiceboard-of-airport-commissionersdebtpublic-safety
Notable items
Tue Aug 26, 2025 · 10:00 AM

City Council Meeting

Council will consider renaming Miner Street (Private) from 22nd Street (Private)

The City Council will begin with roll call, approve the minutes from the previous meeting, and consider several commendatory resolutions and introductions. A multiple‑agenda item comment period will allow brief public input. The council will take up a categorical exemption ordinance for the first consideration and public works committee report to rename Miner Street (Private) from 22nd Street (Private) to its southerly term.

councilproceduralordinancerenamingpublic-comment
✓ Decided: Council approved $37.4M amendment to LAX Terminal 4 baggage handling contract

The City Council adopted seven actions, all passing unanimously (15‑0). It approved the $37,425,021 amendment to the Terminal 4 Baggage Handling System contract with Hensel Phelps, and also approved several lease and exemption items for Los Angeles World Airports, including extensions with Southwest Airlines, Wise and Healthy Aging, Jet Pets Inc., and a maintenance contract with Johnson Controls. The council also renamed Miner Street (Private) to Dave Arian Way and directed the escheatment of idle Panorama City BID funds for traffic safety projects.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (23 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
42 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - AUGUST 28, 2025 Tuesday - August 26, 2025 - PAGE 4 (LAST DAY FOR COUNCIL ACTION - AUGUST 27, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the proposed First Amendment to Lease VNA-9148 between the LAWA and Wise and Healthy Aging, a nonprofit corporation, will have no impact on the General Fund. Revenues in the amount of $84,684…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Resolution No. 28143 and the proposed 10-year lease with Jet Pets, Inc. for an off-airport animal quarantine and kennel facility at Los Angeles International Airport will have no impact on the…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - SEPTEMBER 8, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 5, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - SEPTEMBER 27, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 26, 2025) Adopted Item Tuesday - August 26, 2025 - PAGE 9
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - AUGUST 27, 2025 (LAST DAY FOR COUNCIL ACTION - AUGUST 27, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - SEPTEMBER 27, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 26, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - SEPTEMBER 30, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 30, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] TIME LIMIT FILE - SEPTEMBER 30, 2025 (LAST DAY FOR COUNCIL ACTION - SEPTEMBER 30, 2025) Adopted Item
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Reseda Neighborhood Council Adopted item as Amended by Motion 13A (McOsker – Raman) Forthwith - SEE ATTACHED
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Question Whether to Substitute Adopted
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item
84 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item Tuesday - August 26, 2025 - PAGE 20
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item Forthwith
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted (Housing and Homelessness Committee waived consideration of the above matter.) Adopted Item as Amended by Motion 23A (Rodriguez – Park), Motion…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident which occurred on March 29, 2022, on the sidewalk near 321 Wall Street, in the city of Los Angeles.) (The Budget and Finance Committee…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter arises from a vehicle versus vehicle accident at 7th Street and Bixel Street, in the city of Los Angeles.) (The Budget and Finance Committee considered the above matter in…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] and (7) failure to prevent retaliation.] (The Budget and Finance Committee considered the above matter in closed session on August 19, 2025.) Adopted Motion (Yaroslavsky – Blumenfield) in…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] pedestrian accident that occurred on September 11, 2021, on Vista Del Mar, in the City of Los Angeles.) (The Budget and Finance Committee considered the above matter in closed session on…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Tue Aug 26, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee will vote on sunrise‑to‑sunset hours for Verdugo Mountain Park

The Arts, Parks, Libraries, and Community Enrichment Committee will consider a mayor report on the appointment of Domenika Lynch as permanent General Manager of the Department of El Pueblo de Los Angeles Historical Monument. It will hear a Board of Recreation and Parks Commissioners report on the condition of city skateparks and funding for a consultant to develop a strategic plan for new skatepark sites. A motion will be considered to set Verdugo Mountain Park’s operating hours to open at sunrise and close at sunset. Additional reports include animal services Right‑of‑Entry licenses for free animal intervention services and spay/neuter clinics, and financial status reports for several city funds.

historic-preservationparksanimal-servicesskateparkspreschoolfinance
✓ Decided: Committee approved mayor’s appointment of Domenika Lynch and multiple animal services agreements

The committee approved the mayor’s report appointing Domenika Lynch as permanent General Manager of the El Pueblo de Los Angeles Historical Monument. It also approved a motion setting Verdugo Mountain Park hours and several Right‑of‑Entry agreements to expand free animal services. Additional reports on skateparks, youth golf, and preschool funding were noted, filed, or approved.

Notable items
Fri Aug 22, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee will consider a supplemental contract with TELUS Health (US) Ltd.

The Personnel and Hiring Committee will hear reports on several matters, including a City Clerk report on interim resolution authorities for the Charter Reform Commission, a proposed amendment to Los Angeles Administrative Code Section 4.307 to repeal subsection (d) concerning the “Non‑Kaiser Full‑Network HMO Option,” and a 2026 LAwell Program update. A City Administrative Officer will present the First Supplemental Agreement to the Professional Services Agreement (Contract No. C‑133405) with TELUS Health (US) Ltd., which includes fiscal and financial policy statements. Additional items include follow‑up reports on citywide layoff management and a discussion of the Housing Authority’s personnel hiring goals in District 15. Public comment will be limited to in‑person remarks.

personnelhiringcontractshealth-carelayoffshousing-authority
✓ Decided: Approved supplemental contract with TELUS Health (US) Ltd.

The Personnel and Hiring Committee approved five agenda items. These included a City Clerk report on interim resolution authorities for the Charter Reform Commission, a repeal of a subsection of the Administrative Code concerning a non‑Kaiser HMO option, a report on the 2026 LAwell Program, a first supplemental agreement with TELUS Health (US) Ltd. under Professional Services Agreement Contract C‑133405, and follow‑up reports on citywide layoff management. All items were approved with two votes in favor and one member absent.

Room 401
Notable items
Fri Aug 22, 2025 · 10:00 AM

City Council Meeting

Council to consider report on kennel cleaning procedures (Item 25-0343)

The Los Angeles City Council will hold its regular meeting, including roll call, approval of minutes, and public comment periods. The agenda features a report from the Arts, Parks, Libraries, and Community Enrichment Committee on current kennel cleaning procedures and standards. Council members will discuss and consider the committee's recommendations regarding those procedures.

city-councilcommittee-reportkennel-cleaningpublic-comment
✓ Decided: Council adopted report authorizing fund transfers for Warner Grand Theater improvements

The Los Angeles City Council adopted the Economic Development and Jobs Committee Report that recommends amending a 2021 action to transfer $25,378 from CRA/LA Excess Non‑Housing Bond Proceeds, $52,534 from the Capital and Technology Improvement Expenditure Program, and $29,365 from the Municipal Improvement Corporation to the General Services Department for the Warner Grand Theater Improvements Project. The adoption was unanimous with a 10‑0 vote and five members absent. The council also adopted several informational items, noting and filing reports on the City Mall, personnel qualifications, police supplemental accounts, and transportation projects.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: Yes For: Downtown Los Angeles Neighborhood Council
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Wilmington Neighborhood Council Adopted Item as Amended by Motion 6A (Jurado - Hernandez, McOsker) - SEE ATTAC HED - August 22, 2025 - PAGE 4
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] *Journal Correction Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item as Amended by Motion (Lee - Harris-Dawson) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] *Journal Correction Fiscal Impact Statement: Not applicable - August 22, 2025 - PAGES (9) Community Impact Statement: None submitted Adopted Item as Amended by Motion (Lee - Harris-Dawson)…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] For: Wilmington Neighborhood Council
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] Recommendation for Council action: - August 22, 2025 - PAGE6 (12) Community Impact Statement: Yes For: Coastal San Pedro Neighborhood Council Adopted Item as Amended by Motion 11 A (McOsker…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Click on www.lacouncilfile.com for background documents.) Community Impact Statement: None…
9 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Soto-Martinez yea · Yaroslavsky yea
Wed Aug 20, 2025 · 10:00 AM

City Council Meeting

Council to consider dedicating City-owned property as public street on West Century Blvd

The Los Angeles City Council will meet to discuss several procedural items and one specific property dedication. The body is considering an ordinance to dedicate City-owned real property as a public street.

real-estateroadsordinance
✓ Decided: Council dedicated City land at 6141 West Century Blvd as a public street

The Council approved the dedication of City‑owned property at 6141 West Century Boulevard as a public street, finding it categorically exempt from CEQA and adopting the related ordinance. It also continued the hearing on a $3,850.39 lien for 6212 North Corbin Avenue to September 3. Additionally, the Council confirmed several mayoral appointments and authorized a five‑year agreement for the Pico‑Union Cesar Chavez Community Garden.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 6 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
50 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
that the Mayor's reappointment of Brian Chu to the Board of El Pueblo de Los Angeles Historical Monument Authority Commissioners for the term ending June 30, 2029 is APPROVED and CONFIRMED. Brian Chu…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
[context] Adopted Item
141 yea · 15 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Raman nay · Soto-Mart​ínez nay
[context] Wednesday - August 20, 2025 - PAGE 31 Adopted Item
11 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
that the Mayor’s appointment of Nicole Nicholas to the Board of Transportation Commissioners, for the term ending June 30, 2029, is APPROVED and CONFIRMED. The appointee resides in Council District…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
Resolution to the Governor of the State of California, the Director of the Office of Emergency Services of the State of California, the Los Angeles County Office of Emergency Management, and the Los…
9 nay · 4 yea · 1 absent
Harris-Dawson yea · Hutt yea · Price Jr yea · Soto-Mart​ínez yea · Blumenfield nay · Hernandez nay · Lee nay · Nazarian nay · Padilla nay · Park nay · Raman nay · Rodriguez nay · Yaroslavsky nay · Homelessness Committee absent
The other 35 items passed by unanimous or near-unanimous consent.
Wed Aug 20, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to review police fees and fire facility donations

The Public Safety Committee will discuss adjustments to police permit and service fees and evaluate several grants and donations for LAPD and LAFD. The body is also reviewing fire risk mitigation strategies and 911 response time improvements.

policefire-departmentpublic-safetygrantsfeesfire-mitigation
Notable items
Tue Aug 19, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee will consider a motion to amend bond proceeds for Warner Grand Theater improvements

The Economic Development and Jobs Committee will hear six agenda items, including public comment on immigration enforcement impacts, reports on funds for civil disturbance assistance, and a motion to amend the 2021 Council Action on CRA/LA bond proceeds for the Warner Grand Theater project. It will also receive a report on disposition options for a city‑owned property at 1636 West Manchester Boulevard and annual planning reports for the Downtown Industrial District and Village at Sherman Oaks business improvement districts.

economic-developmenthousingbudgetpublic-commentproperty
Notable items
Tue Aug 19, 2025 · 08:30 AM

Government Operations Committee

City proposes declaring 1901‑1905 North Highland Ave as exempt surplus land

The Government Operations Committee will consider a motion to declare the City‑owned property at 1901‑1905 North Highland Avenue as exempt surplus land under the California Surplus Land Act. It will also review a motion for an indemnity agreement with the owners of Watts Station and a motion for a non‑profit lease with After‑School All‑Stars at 6501 West Fountain Avenue. An adopted budget recommendation will address selling surplus properties or using City properties for joint development projects. Public comment will be taken on these items and on reports for proposed contracts with TPUSA, Inc. and Insight Public Sector, Inc.

surplus-landindemnitybudgetcontractslease
✓ Decided: City Council approves multiple contracts and surplus land designation

The Government Operations Committee approved twelve agenda items. Approvals included designating City‑owned property at 1901‑1905 North Highland Avenue as exempt surplus land, entering various lease and indemnity agreements for properties such as Watts Station, After‑School All‑Stars, and DE Wilshire 100, and adopting a budget recommendation to sell or develop surplus properties. The committee also approved reports and contracts for captioning services, technology services, and the My311 system. All votes were recorded as Yes (2) with one member absent.

Room 401
Notable items
Tue Aug 19, 2025 · 10:00 AM

City Council Meeting

Council to hear request for alcohol sales at Encanto Mestizo

The City Council will hold a public hearing regarding a determination of public convenience or necessity for the sale of alcoholic beverages for on-site consumption at Encanto Mestizo.

alcohol-licensingpublic-hearingbusiness-regulation
✓ Decided: Council approved liquor license for Encanto Mestizo at 13766 Foothill Blvd.

The City Council granted a Public Convenience and Necessity determination and approved the liquor license application for Encanto Mestizo. It also adopted several committee reports directing further study of human‑trafficking response, LAPD identity‑verification procedures, a federal immigration FOIA request, impacts of federal LGBTQIA+ policies, and immigration‑related city protocols. Additionally, the Council adopted an ordinance approving a quit‑claim deed of a public power easement to Sun Commons, LP and Dubnoff Center.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
122 yea · 4 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] l Greater Toluca Lake Neighborhood Council Greater Wilshire Neighborhood Council Harbor Gateway North Neighborhood Council Northwest San Pedro Neighborhood Council Sherman Oaks Neighborhood…
8 yea · 5 nay · 1 absent
Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Rodriguez yea · Yaroslavsky yea · Harris-Dawson nay · Hernandez nay · Price Jr nay · Raman nay · Soto-Mart​ínez nay · Blumenfield absent · Nazarian yea
The other 26 items passed by unanimous or near-unanimous consent.
Tue Aug 19, 2025 · 02:00 PM

Budget and Finance Committee

Committee to set tax rates for city bond interest and sinking funds

The Budget and Finance Committee will consider a draft ordinance to levy taxes and set rates for several interest and sinking funds that service the city's bonded indebtedness for fiscal year 2025‑26. It will also hear a motion to use idle funds from the Panorama City Business Improvement District for traffic safety on Lanark Street, a grant application report for the Homeless Housing Assistance program, and a motion on cannabis taxation impacts. Several items will be sent to closed session for legal review of pending lawsuits.

budgettaxesbond-fundshousingcannabislegal
✓ Decided: Committee approves transfer of idle funds for Lanark St traffic safety

The Budget and Finance Committee approved a motion (5‑0) to initiate the escheatment and transfer of idle funds from the Panorama City Business Improvement District for traffic safety measures on Lanark Street. It also concurred (5‑0) with the Housing and Homelessness Committee on a Homeless Housing Assistance grant, and (5‑0) with the Government Operations Committee on a cannabis taxation impact motion. Finally, the committee approved the City Attorney report and draft ordinance (5‑0) setting tax rates for interest and sinking funds for bonded indebtedness for FY 2025‑26.

Notable items
Tue Aug 19, 2025 · 02:15 PM

Economic Development and Jobs/Civil Rights, Equity, Immigration Aging, and Disability Joint Committee

Committee to consider department consolidation and four policy motions

The joint Economic Development and Jobs and Civil Rights, Equity, Immigration, Aging, and Disability Committee will review a report on consolidating several city departments and consider four motions: a “Know Your Rights” training directive for homelessness service providers, a study of a Continuum of Care and federal grant options, a report on city projects impacted by H.R. 1, and a feasibility study on waiving towing fees for individuals detained by immigration enforcement. Public comment will be limited to in‑person speakers.

economic-developmentcivil-rightshousinghomelessnessimmigrationagingdisabilitybudget
Fri Aug 15, 2025 · 10:00 AM

City Council Meeting

City Council will consider a Wildfire Recovery and Budget Committee report

The Los Angeles City Council meeting on August 15, 2025 will conduct roll call, approve the minutes, and consider several procedural items. Council members will hear commendatory resolutions, multiple agenda item comments, and public testimony on non‑agenda items. A report (item 25‑0006‑S48) from the ad hoc committee on LA Recovery and Budget & Finance regarding the Wildfire Emergency Response and Recovery Account will be presented.

councilprocedureswildfire-recoverybudgetpublic-comment
✓ Decided: Council authorized $2.525 M contract for City’s public access Channel 36

The council adopted the General City Purposes Fund monthly expenditures for April and June 2025, with an 11‑0 vote. It authorized a $2.525 million personal services contract with the Los Angeles Cable Television Access Corporation to operate public access Channel 36. The council also directed a new non‑profit lease for 309 West Opp Street, transferred jurisdiction of Harbor Boulevard medians to the Port of Los Angeles, and approved a $200,000 fund transfer to assist tenants at 8530 West La Tuna Canyon Road, each passing unanimously. Finally, it authorized an agreement with the Trust for Public Land to develop a portion of Ritchie Valens Recreation Center.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martf nez yea · Yaroslavsky yea
that the recommendation contained in the June 17, 2025 CAO report, attached to the Council file, is in compliance with the City's Financial Policies as contract expenditures are limited to the…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
that the use of competitive bidding would be undesirable and impractical for this contract, inasmuch as the WHS and its services are unique, and competitive bidding for this lease would be…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Coastal San Pedro Neighborhood Council Adopted Item to Continue to August 22, 2025
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] If a public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) [Scheduled pursuant to Los…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
Wed Aug 13, 2025 · 08:30 AM

Transportation Committee

Committee will consider a motion to let Metro install and remove temporary traffic control devices

The Transportation Committee will hear public comment and consider several motions and reports. Items include a motion to amend the Los Angeles Municipal Code so LADOT can delegate authority to the Metro Authority for temporary traffic control devices, a motion to close the Vincent Thomas Bridge for seismic retrofit and add camera monitoring, and a motion to prohibit excessive vehicle storage on city streets with higher penalties. The committee will also review LADOT reports on safety improvements, a request for proposals for North Region transit services, and resolutions on oversize vehicle parking restrictions.

transportationcode-amendmentbridgeparkingtransitsafetypublic-comment
✓ Decided: Committee approved delegating traffic‑control authority to Metro and key safety measures

The Transportation Committee approved a motion to let LADOT delegate temporary traffic‑control authority to Metro. It also approved several safety and parking actions, including a quiet‑zone designation, a planned bridge closure for seismic retrofit, overnight parking for a local event, and a new penalty for excessive vehicle storage. The committee adopted multiple oversize‑vehicle parking restrictions and endorsed a Vision Zero safety report.

Notable items
Wed Aug 13, 2025 · 10:00 AM

City Council Meeting

City Council meets to hear appeals on building safety and nuisance abatement

The Los Angeles City Council will convene to consider appeals and objections regarding reports from the Department of Building and Safety, specifically concerning nuisance abatement costs and lien confirmations.

city-councilbuilding-safetynuisance-abatementpublic-hearingbureau-of-building-safety
✓ Decided: Council confirmed multiple nuisance abatement liens and continued several hearings

The Los Angeles City Council voted unanimously to confirm liens for several properties and to continue hearings on others. Motions were adopted to receive and file liens for two addresses. All votes were 13‑0 with no opposition.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
190 yea · 6 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the recommendations in the report comply with the City’s Financial Policies. Community Impact Statement: None submitted Adopted Item
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
[context] (This matter arises from a vehicle versus vehicle automobile accident on November 20, 2021, on Vanowen Street just east of its intersection with Sylmar Avenue.) (The Budget and Finance…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - August nay
[context] (Budget and Finance waived consideration of the above matter.) Adopted to Continue Item to August 15, 2025
24 yea · 1 nay · 1 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - August nay · Price Jr absent
The other 53 items passed by unanimous or near-unanimous consent.
Wed Aug 13, 2025 · 02:00 PM

Personnel and Hiring Committee

Committee will hear departmental reports on citywide layoff management

The Personnel and Hiring Committee will receive continued reports (Item 25-0660) from six city departments about citywide layoff management. No fiscal impact or community impact statements were submitted. Public comment is limited to in‑person remarks of up to one minute per agenda item, with a total of two minutes for multiple items. General public comment is not permitted at this special meeting.

personnelhiringlayoffspublic-commentinterpretationreports
✓ Decided: Personnel Committee met; no decisions were made

The Personnel and Hiring Committee met on August 13, 2025, and reviewed agenda item 25-0660 CD 15, which included departmental reports on citywide layoff management and related matters. No fiscal impact statement, community impact statement, vote, or action was recorded for the item.

Room 401
Wed Aug 13, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $9.62 million cash‑flow loan for LA Homeless Services Authority

The Housing and Homelessness Committee will hear a motion to approve a $9,620,151 cash‑flow loan for quarter‑two funding requested by the Los Angeles Homeless Services Authority. It will also consider a transfer of funds from the Foreclosure Relocation Program to the Tenant Relocation Assistance Program to prevent homelessness for tenants at 8530 West La Tuna Canyon Road. Additional items include a statutory exemption and up‑to‑five‑year funding for an interim navigation center at 7253 Melrose Avenue, a multi‑year employment program budget recommendation, and several administrative reports on Proposition HHH.

housinghomelessnessfinancerelocationemploymentreports
✓ Decided: Committee approved $9.62 M cash‑flow loan and multiple homelessness reports

The Housing and Homelessness Committee approved several administrative reports and two funding motions. It adopted a $9,620,151 cash‑flow loan for the Los Angeles Homeless Services Authority and transferred funds to prevent homelessness for tenants at 8530 West La Tuna Canyon Road. All approvals recorded a unanimous three‑vote yes.

Notable items
Wed Aug 13, 2025 · 03:00 PM

Public Works/Transportation Joint Committee

Committee to discuss street maintenance, permits, and renaming

The Public Works and Transportation Committees will meet to review reports on alley inspections, street vacation proceedings, and permit requests for construction projects. The agenda also includes motions to rename streets and a report on updating trip fees for the On-Demand Mobility Program.

transportationpublic-worksstreetspermitsmobilityalley-inspectionsrenaming
Notable items
Tue Aug 12, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee will consider annexing 0.64 acres of county land to the City of Los Angeles

The Planning and Land Use Management Committee will review a City Administrative Officer Report and Joint Tax Transfer Resolution to approve the annexation of 0.64 acres of uninhabited county‑owned territory south of Beverly Boulevard and Genesee Avenue. The meeting also includes several CEQA categorical exemption requests, motions on zoning and historic‑cultural ordinance amendments, and mayoral communications appointing planning commission members. Public comment will be taken in person only.

land-useannexationceqazoningplanning-commissionhistoric-cultural
✓ Decided: Committee approved annexation of 0.64 acres of county land to Los Angeles

The Planning and Land Use Management Committee approved the annexation of 0.64 acres of uninhabited county‑owned land to the City of Los Angeles. It also denied two CEQA appeals, approved several mayoral appointments, and adopted motions to study a General Plan amendment and to amend the Cultural Heritage Ordinance. A veto and remand were issued for an RV‑park appeal.

Notable items
Tue Aug 12, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to review park agreements and city commission appointments

The Arts, Parks, Libraries, and Community Enrichment Committee will discuss several mayoral appointments and reappointments to city boards. The body is also considering agreements for the maintenance and development of local parks and community gardens.

parksappointmentscommunity-gardensrecreationanimal-services
✓ Decided: Committee approves multiple mayor reports and park agreements, 2‑0 vote

The Arts, Parks, Libraries, and Community Enrichment Committee approved ten agenda items, all with a 2‑Yes, 1‑Absent vote (Councilmember Hernandez). Approvals included mayor reports appointing board members, authorizations for park and garden agreements, a motion to add a park to the Gate Closure Program, and a contract amendment for a child‑care center.

Notable items
Tue Aug 12, 2025 · 10:00 AM

City Council Meeting

City Council meets to discuss building safety and nuisance abatement costs

The Los Angeles City Council will convene at 10:00 AM in Council Chamber Room 340 to conduct a roll call, approve minutes, and consider items including a public hearing on building safety reports and nuisance abatement costs.

city-councilbuilding-safetypublic-hearingnuisance-abatementagenda
✓ Decided: Council confirmed multiple nuisance abatement liens for properties across the city

The Los Angeles City Council adopted motions to hear protests and confirm nuisance‑abatement liens for a series of properties, with several items set to continue to future dates. All votes were unanimous (14‑0) with one member absent. Two motions specifically directed the city to receive and file the liens. No proposals were denied.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ORDINANCE OF INTENTION setting the date of October 14, 2025 as the hearing date for the maintenance of the Silver Ridge Avenue and Silver Ridge Way Street Lighting District, in accordance with…
13 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - August nay
The other 56 items passed by unanimous or near-unanimous consent.
Tue Aug 12, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Port of Los Angeles committee reviews federal immigration enforcement protocols

The Trade, Travel and Tourism Committee will hear a verbal update from the Port of Los Angeles and consider a motion requesting the Port Police to report on current procedures, jurisdictional roles, and recommendations for clear guidelines on future federal immigration enforcement activities at or near Port property. Several reports from the Board of Airport Commissioners and Harbor Commissioners on contracts, leases, and CEQA exemptions will also be presented for public comment.

portimmigrationairportcontractsceqa
Notable items
Mon Aug 11, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission to hear presentation on ER boarding and overcrowding impacts

The Los Angeles City Health Commission will approve the minutes from its April 4, 2025 meeting, hear a UCLA presentation on emergency‑room boarding and overcrowding and possible commission action, and conduct officer elections. It will also consider granting an honorary President Emeritus title and review and approve the 2024‑25 Annual Report. Additional items are slated for future discussion.

healthemergency-caregovernanceelectionsreports
Fri Aug 8, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee considers salary appointment for Timothy O’Connor as Executive Director

The Personnel and Hiring Committee will review several reports and resolutions, including a salary appointment for Timothy O’Connor as Executive Director of the Office of Public Accountability. Other items include a professional services agreement amendment, a mayoral communication about reappointing an interim animal services manager, and various personnel reports on salary settings and succession plans. Public comment will be limited to in‑person remarks.

personnelsalaryappointmentscontractscity-management
✓ Decided: Personnel Authority Resolution for FY 2025‑26 approved unanimously

The Personnel and Hiring Committee approved ten agenda items, each with a 3‑yes vote. Items included the 2025‑26 Personnel Authority Resolution, the FY 2025‑26 Unfreeze Resolution, an amendment to the police officers MOU, the interim reappointment of Annette Ramirez at Animal Services, and salary actions for several city positions. All approvals were recorded as “Yes (3)”. No items were denied, tabled, or postponed.

Room 401
Notable items
Fri Aug 8, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee to set city positions on state immigration and housing bills

The Rules, Elections and Intergovernmental Relations Committee will consider resolutions establishing the City of Los Angeles' official stance on various state legislative proposals. The agenda includes measures regarding immigration enforcement, housing demolition, and price gouging.

immigrationhousinglegislationstate-billspublic-safetybudgetcouncil-committee
✓ Decided: Committee approves USPS unique zip code resolution for Harbor Gateway

The Rules, Elections and Intergovernmental Relations Committee adopted a slate of resolutions establishing the City’s positions on a variety of state and federal measures. All items were approved unanimously with a 5‑0 vote. Highlights include a resolution directing the USPS to assign a single zip code to the Harbor Gateway area and several positions on immigration protocols, license‑plate‑obscuring devices, and price‑gouging penalties.

Notable items
Fri Aug 8, 2025 · 10:00 AM

City Council Meeting

Los Angeles City Council meets to discuss budget and public comment

The Los Angeles City Council will convene on Friday, August 8, 2025, at 10:00 AM in the John Ferraro Council Chamber to conduct a regular meeting. The agenda includes the approval of minutes, commendatory resolutions, and a continued consideration of the Mayor’s Proposed Budget for 2025-26. The public may submit written comments online or speak during the Multiple Agenda Item Comment period.

city-councilbudgetpublic-commentmeetinglos-angeles
✓ Decided: Council adjourned with only procedural motions recorded

The meeting recorded adjournment motions moved and seconded by various councilmembers. Several commendatory resolutions were also moved and seconded. No vote tallies or substantive approvals, denials, or tablings were documented.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Aug 6, 2025 · 10:00 AM

City Council Meeting

Council requests report on Encino evacuation orders from Palisades Fire

The Los Angeles City Council will hold its regular meeting to approve minutes, adopt commendatory resolutions, and hear public comments. A key item is an ad hoc committee request (item 25-0006‑S54) for a report on evacuation orders in Encino during the Palisades Fire and recommendations for future response. The council will also consider items that have already had public hearings.

councilproceduralpublic-commentrecoveryfireencinoreports
✓ Decided: Council approves $2 million for guaranteed income program for IPV survivors

The council adopted an ad‑hoc committee report directing the Emergency Management, Fire and Police Departments to report on Encino evacuation orders from the Palisades Fire. It approved the Community Investment for Families Department's guaranteed income program for intimate‑partner‑violence survivors and transitional‑aged youth and authorized a $2 million transfer to the Public Assistance Benefit Program Fund. The council also removed three properties from the Rent Escrow Account Program and approved multiple funding motions for community beautification, litter cleanup, and parkway repairs.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Adopted Item
188 yea · 8 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - August yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay
The other 10 items passed by unanimous or near-unanimous consent.
Wed Aug 6, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $9.62 million loan for Homeless Services Authority

The Housing and Homelessness Committee will hear a verbal update on streamlining contracting and invoicing for homeless service providers. It will review reports on a Round Six grant application, a status and funding plan for a RV storage lot at 16800 West Victory Boulevard, and performance indicators of the city’s homelessness investments. The committee will also consider a motion to approve a $9,620,151 cash‑flow loan for the Los Angeles Homeless Services Authority.

housinghomelessnessfinancecontractsgrantsfacilities
✓ Decided: Committee approved City Administrative Officer reports on homeless programs

The Housing and Homelessness Committee approved the City Administrative Officer report for the Homeless Housing Assistance and Prevention Program Round Six. It also approved an amended City Administrative Officer report and a Bureau of Engineering report concerning the Homelessness Emergency Account. Both approvals were recorded as affirmative votes.

Notable items
Wed Aug 6, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to review police fees and fire facility donations

The committee will discuss adjustments to police permit and service fees and evaluate fire risk mitigation strategies. Members will also consider several grants and donations for police and fire department equipment and services.

policefire-departmentpublic-safetygrantsfeesfire-mitigation
Notable items
Wed Aug 6, 2025 · 08:45 AM

Personnel and Hiring Committee

Committee to review citywide layoffs and pension litigation

The Personnel and Hiring Committee will hear reports from multiple city departments regarding citywide layoff management and continued litigation over retired employees receiving multiple pensions. The committee may recess to closed session to discuss legal counsel regarding pending litigation.

personnelhiringlayoffspensionslitigationcity-attorneylabor
✓ Decided: Personnel and Hiring Committee took no substantive actions, items continued

The committee received departmental reports on citywide layoff management and on retired employees receiving multiple pensions. Both agenda items (25-0660 and 24-0357) were continued for future consideration, and the committee noted it may recess to closed session to discuss pending litigation. No approvals, denials, or votes were recorded.

Room 401
Tue Aug 5, 2025 · 08:30 AM

Government Operations Committee

Committee to consider contracts and cannabis regulations

The Government Operations Committee will review proposed contracts for city services and cannabis regulations, including fee changes and a gas easement.

cannabiscontractsfeesgaszoningpublic-safetycouncil-committee
✓ Decided: City Council approved amendments to cannabis fee and fine regulations

The Government Operations Committee approved an ordinance amending sections 104.03, 104.13, 104.14, and 104.19 of the Los Angeles Municipal Code to change fees and fines for commercial cannabis activity, add exemptions for social‑equity applicants, and subsidize application costs. The vote was 3 in favor. The approval also directs the Cannabis Regulation Commission to report annually on funding.

Room 401
Notable items
Tue Aug 5, 2025 · 10:00 AM

City Council Meeting

Council to consider a CEQA exemption for a Reseda Blvd vacation

The City Council will hold its regular meeting, beginning with roll call, approval of minutes, and several procedural items. Councilmembers will consider a categorical exemption request for the vacation of a portion of Reseda Boulevard north of Sunset Boulevard, with a recommendation to find the project exempt from the California Environmental Quality Act. The meeting also includes multiple‑agenda item comments, public testimony on non‑agenda items, and notice of items slated for future public hearings.

zoningenvironmentpublic-hearingscouncilprocedures
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Aug 5, 2025 · 02:00 PM

Budget and Finance Committee

Committee to consider 5-year credit card services contract with American Express

The Budget and Finance Committee will discuss a proposed contract with American Express for credit card acceptance services. The body will also review fund transfers for transportation infrastructure and various legal claims against the city.

contractstransportationbudgetlegal-claimsadministrative-code
✓ Decided: Committee approved multiple budget and legal items, including ATSAC Trust Fund reallocation

The Budget and Finance Committee approved eight items, all with a 5‑yes, 0‑no vote. Approvals included a motion to reduce and reallocate ATSAC Trust Fund money, a draft ordinance to release Store Revolving Fund surpluses, and several reports on contracts, legal fees, and refund claims. Each decision was recorded as approved or concurred by the committee.

Notable items
Tue Aug 5, 2025 · 03:30 PM

Energy and Environment Committee

Committee will consider a new 480‑ft underground electric wireline crossing at 3400 East I St.

The Energy and Environment Committee will review ten agenda items, including contracts, exemptions, and motions. Key actions include authorizing a perpetual wireline crossing agreement with Union Pacific Railroad for a 480‑foot, 34.5‑kV underground electric line at 3400 East I Street in Wilmington. The committee will also consider a quitclaim deed for a public power easement, a shared‑use strategy for DWP parcels on Canterbury Avenue, and a motion to repeal all‑electric building standards. Public comment will be accepted in person only.

energyenvironmentwater-powerinfrastructurerenewable-energypublic-utilities
Notable items
Fri Aug 1, 2025 · 10:00 AM

City Council Meeting

Council to consider ordinance amending Port of LA Tariff for emissions control charges

The Los Angeles City Council will conduct roll call, approve minutes, and consider several routine items such as commendatory resolutions and public testimony. The key agenda item is Ordinance 25‑0404, which proposes amending Port of Los Angeles Tariff No. 4 to create Section 25‑Emissions Control Strategy Charges. The council will vote on this ordinance after discussion.

ordinanceportsenvironmentcouncilpublic-hearingadministrative
✓ Decided: Council approves $3.25 M amendment to legal services contract for Hyperion flood case

The City Council voted unanimously to raise the ceiling of Contract C‑140018 with Beveridge & Diamond PC to $3.25 million. It also approved three publishing agreements for the Los Angeles Public Library and continued work on budget items for mobile hygiene centers and interim housing contracts. The emissions‑control ordinance was held over for a second reading.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted TIME LIMIT FILE - AUGUST 5, 2025 (LAST DAY FOR COUNCIL ACTION - AUGUST 5, 2025) Adopted Item
10 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
The other 30 items passed by unanimous or near-unanimous consent.
Fri Aug 1, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee will consider ordinance requiring police to verify claimed officer identities

The Civil Rights, Equity, Immigration, Aging and Disability Committee will hear reports on RepresentLA funding, parking fines, the California Courts Protective Order Registry, and U‑Visas. It will also consider several motions, including protocols for monitoring federal immigration activity, a partnership with labor unions and immigrant‑rights groups for training marshals, coordination on human‑trafficking prevention, an ordinance requiring LAPD officers to verify the identity of anyone claiming to be a law‑enforcement officer, a FOIA request to federal agencies, and a code amendment to increase fines for impersonating law‑enforcement agents.

civil-rightsimmigrationpolicepublic-safetyequitydisability
✓ Decided: Committee approved multiple motions on immigration, police oversight, and public safety

The Civil Rights, Equity, Immigration, Aging, and Disability Committee voted unanimously to approve seven motions covering immigration enforcement protocols, police identity verification, partnerships with labor and immigrant‑rights groups, coordination on human‑trafficking response, municipal code amendments to increase fines for impersonating officers, and the impact of federal policies on LGBTQIA+ residents. All motions received a 5‑Yes, 0‑No vote. No other actions were taken.

Wed Jul 30, 2025 · 10:00 AM

City Council Meeting

Council to consider nuisance abatement lien protest for CD 2 property

The City Council will meet to discuss a continued hearing regarding a protest, appeal, or objection to a Department of Building and Safety report. This involves the confirmation of a lien for nuisance abatement costs and code violations in Council District 2.

code-enforcementnuisance-abatementlienscd-2
✓ Decided: Council approved $500,000 legal services fund transfer

The council confirmed two nuisance‑abatement liens of $78,629.95 and $87,923.60 for properties on West Otsego Street. It approved a $500,000 transfer to the City Attorney for a legal services contract with Covington & Burling, and reallocated up to $190,581 for the Family Source Center program. Additional actions included a $75,000 transfer for a public‑bank feasibility study, a directive for an emergency mudslide preparedness report, adoption of a spay‑and‑neuter voucher program, and adoption of a list of budget special studies.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
58 yea · 2 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Lee nay · Park nay · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item
180 yea · 1 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - July nay · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
The other 58 items passed by unanimous or near-unanimous consent.
Wed Jul 30, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $1.55 million funding for PATH Villas Hollywood supportive housing

The Housing and Homelessness Committee will hear reports on opioid remediation and a contract with the Liberty Hill Foundation. It will consider several motions, including a $1,552,139.57 funding commitment for the PATH Villas Hollywood Supportive Housing Project and a recommendation for fire sprinkler systems in all residential high‑rise buildings. The committee will also discuss mayoral communications about appointments and public‑comment procedures.

housinghomelessnessbudgetcontractsfire-safetyprice-gouging
✓ Decided: Approved $1.55M funding for PATH Villas Hollywood supportive housing

The Housing and Homelessness Committee approved a series of reports and motions, each passing with two votes in favor and one councilmember absent (Councilmember Blumenfield). Notably, the committee authorized up to $1,552,139.57 from Proposition HHH for the PATH Villas Hollywood Supportive Housing Project. It also adopted a motion requiring fire sprinkler systems in all residential high‑rise buildings and a motion to produce monthly reports on rental price‑gouging complaints. Additional approvals included a sole‑source contract with Weingart for services at Hilda Solis Care First Village and motions to establish a Continuum of Care, update a bed plan, and identify funding for permanent supportive housing.

Notable items
Thu Jul 17, 2025 · 10:00 AM

Personnel and Hiring Committee - SPECIAL MEETING

Departmental reports on citywide layoff management presented

The Personnel and Hiring Committee will hold a special meeting on July 17, 2025. The committee will receive continued reports (Agenda Item 25-0660) from the Personnel, Planning, Information Technology, Housing, Building and Safety, and Transportation departments regarding citywide layoff management and related matters. No fiscal impact statement is provided and the meeting will not include general public comment.

personnelhiringlayoffscitywidereportscommittee
✓ Decided: No substantive actions taken at Personnel and Hiring Committee special meeting

The Personnel and Hiring Committee met in a special session on July 17, 2025 at City Hall, Room 401. The meeting considered agenda item 25-0660, a continuation of reports from various city departments. No actions, approvals, or votes were recorded; the committee took no substantive action on the item.

Room 401
Mon Jul 14, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission hears presentations on Olympic disease prep and housing affordability

The Los Angeles City Health Commission will receive two expert presentations: one on infectious‑disease prevention and preparations for the 2028 Olympic and Paralympic Games, and another on housing affordability, Measure ULA, and the growing unhoused population. Commissioners will consider possible actions based on these presentations, review and approve the 2024‑25 Annual Report, and identify items for future discussion before adjourning.

healthinfectious-diseasesolympicshousingaffordabilityannual-reportcity-health-commission
340
Wed Jul 2, 2025 · 10:00 AM

Personnel and Hiring Committee - SPECIAL MEETING

Personnel Committee reviews citywide layoff management report

The Personnel and Hiring Committee will hold a special meeting to receive a report on citywide layoff management, continuing from the June 18 and June 27 meetings. The agenda item (25-0660) includes input from the City Clerk, City Attorney, Controller, Department of General Services, and Department of Neighborhood Empowerment. No fiscal or community impact statements were submitted. The committee is not required to take public comment at this special meeting.

personnelhiringlayoffscitywidereports
✓ Decided: Committee took no substantive actions at the special meeting

The Personnel and Hiring Committee held a special meeting on July 2, 2025. The agenda continued item 25-0660 concerning citywide layoff management, with no vote or resolution recorded. No decisions, approvals, or denials were made during this session.

Room 401
Tue Jul 1, 2025 · 10:00 AM

City Council Meeting

City Council meets Tuesday to consider agenda items

The Los Angeles City Council will convene on Tuesday, July 1, 2025, at 10:00 AM in the John Ferraro Council Chamber to consider a standard agenda of business. The meeting will be broadcast live on Cable Channel 35 and online, with opportunities for public comment available.

city-councilmeetingagendapublic-commentbroadcastlos-angeles
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Jul 1, 2025 · 02:00 PM

Budget and Finance Committee

Committee to discuss budget adjustments and legal matters

The Budget and Finance Committee will review several budget motions, including requests to advance funds for interim housing and restore funding for Mobile Hygiene Centers. The agenda also includes reports on grant awards and a proposed ordinance to consolidate city transportation commissions.

budgethousingtransportationgrantslegalpublic-safety
✓ Decided: Budget and Finance Committee approves multiple budget amendments and policy motions

The committee approved several motions, including establishing a Transportation Communications Network Revenue Fund, adding a digital component to the Proposition 218 protest process, amending the mayor’s proposed budget to provide quarterly advances for interim housing contracts and to fund the Mobile Hygiene Centers program, and updating fee schedules for business permits and police commissioner services. It also concurred with the Transportation Committee’s consolidation of the Board of Taxicab Commissioners with the Board of Transportation Commissioners and noted the City Administrative report on the Los Angeles Convention Center expansion. All approvals recorded a vote of five in favor and zero against.

Notable items
Fri Jun 27, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee considers payroll deduction program for fire and police veterans

The Personnel and Hiring Committee will hear seven agenda items, including four motions and three reports. Members will vote on motions to establish a voluntary payroll deduction for the Los Angeles Fire and Police Veterans Association, to address the Workday payroll system for the Department of Water and Power, to discuss the LAPD hiring process, and to amend the Administrative Code for the City Employees Ridesharing Trust Fund. Additional items include reports on crossing guard deployment, citywide layoff management, and a housing department staffing exemption.

personnelpayrollhiringridesharingtransportation
✓ Decided: Committee approved ordinance to let ridesharing fund reimburse city positions

The Personnel and Hiring Committee approved six separate motions, each passing with two votes in favor and one member absent. Items included a voluntary payroll deduction program for fire and police veterans, implementation of the Workday payroll system for LADWP, changes to the LAPD hiring process, an ordinance allowing the City Employees Ridesharing Trust Fund to reimburse related positions, a crossing‑guard deployment methodology report, and an exemption for a Housing Department project coordinator. All approvals were recorded as Yes (2); Absent (1) Rodriguez.

Room 401
Fri Jun 27, 2025 · 10:00 AM

City Council Meeting

City Council to consider $5 increase for Los Angeles Zoo admission fees

The Los Angeles City Council is meeting to discuss city business and consider an ordinance to adjust zoo pricing. The body will vote on a proposal to increase the Los Angeles Zoo admission fee schedule for Fiscal Year 2025-26.

los-angeles-zoofeesordinance
✓ Decided: City Council approved a $5 increase to Los Angeles Zoo admission fees for FY 2025‑26

The council adopted an ordinance raising the Los Angeles Zoo admission fee by $5. It also designated the Santa Monica and Sunset Boulevard intersection as "Jackie Goldberg Sunset Junction" and ordered a permanent ceremonial sign there. A permanent sign was approved for 324 East First Street to honor the historic Fuji‑Kan Theater. The council approved the Workforce Development Board Year 26 plan, including several fund transfers, and authorized a $60,000 transfer for the Public Bank Feasibility Study Phase I.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Neither the City Administrative Officer nor the Chief Legislative Analyst has completed a financial analysis of this report.* Friday - June 27, 2025 - PAGE 31 Community Impact Statement…
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Nazarian nay
The other 19 items passed by unanimous or near-unanimous consent.
Wed Jun 25, 2025 · 08:30 AM

Transportation Committee

Ordinance to ban recreational vehicle rentals on public right‑of‑way and raise fines

The Transportation Committee will consider a City Attorney report and ordinance amendment that adds recreational vehicles to the list of vehicles prohibited from being rented, leased, or sold on public right‑of‑way, and updates related fines and penalties. The committee will also review reports on construction projects, traffic signage, app‑based delivery exclusion zones, and the consolidation of taxicab and transportation commissioner boards. Public comment will be limited to in‑person remarks on agenda items.

transportationordinancevehiclesdelivery-servicestraffic-signageconstruction
✓ Decided: Committee approved consolidation of taxicab and transportation commissioner boards

The Transportation Committee approved several reports and motions, including the consolidation of the Board of Taxicab Commissioners with the Board of Transportation Commissioners, a policy creating exclusion zones for app‑based delivery services, and new traffic‑restriction signage on South Western Avenue and West 14th Street. All items were approved by a 2‑yes, 1‑absent vote. No other actions were taken.

401
Notable items
Wed Jun 25, 2025 · 10:00 AM

City Council Meeting

City Council meets to hear protests on Gateway to L.A. Business Improvement District

The Los Angeles City Council will convene to conduct a public hearing regarding protests against the establishment of the Gateway to L.A. Business Improvement District.

councilmeetingpublic-hearingbusiness-districtprotestagenda
✓ Decided: Council approved three new Business Improvement Districts

The City Council adopted ordinances establishing the Gateway to L.A., West Adams, and Lincoln Heights Industrial Zone Business Improvement Districts, authorizing the City Clerk to prepare operating agreements. The council also approved no‑cost lease agreements for a public restroom at 1627 Vine Street and for Alcott Center at 305 East 1st Street. A motion was adopted directs the Department of Disability to report on the feasibility of a fentanyl detection device pilot. The council extended Master Service Agreements with Bureau Veritas North America and Ten Architects.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item Forthwith
53 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
[context] Adopted Item Forthwith
107 yea · 6 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Wednesday - June 25, 2025 - PAGE 22 Adopted Item Forthwith
8 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Lee yea · Padilla yea · Park yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
The other 30 items passed by unanimous or near-unanimous consent.
Wed Jun 25, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee reviews funding and CEQA exemptions for multiple homeless navigation centers

The Housing and Homelessness Committee will consider several mayoral communications appointing individuals to city housing bodies. It will also review funding allocations, lease terms, and CEQA exemptions for a series of tiny‑home villages and low‑barrier navigation centers across the city. Additional reports from the Housing Department on affordable‑housing funding regulations and the FY 2025‑26 United to House LA expenditure plan will be discussed.

housinghomelessnessfundingceqaappointmentsaffordable-housingnavigation-centers
✓ Decided: Committee approved mayoral communications and several housing reports

The Housing and Homelessness Committee approved two mayoral communications appointing Aileen Morales and Roberto Barragan. It also approved the City Administrative Officer and Bureau of Engineering reports on homelessness funding and CEQA exemptions. Additional approvals were given to Los Angeles Housing Department reports on affordable‑housing regulations and the FY 2025‑26 United to House expenditure plan.

Notable items
Wed Jun 25, 2025 · 02:30 PM

Public Works Committee

Public Works Committee to discuss 2025-26 budget impacts and infrastructure projects

The Committee will hear reports on the 2025-26 budget's impact on Public Works programs and year-end reappropriations for capital and technology improvements. Members will also consider appointments to the Board of Public Works and a mudslide emergency preparedness plan.

budgetinfrastructurepublic-worksappointmentsemergency-preparednessbridges
Notable items
Tue Jun 24, 2025 · 09:00 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to approve publishing agreements for Angel City Press

The Arts, Parks, Libraries, and Community Enrichment Committee will consider three publishing agreements for the Los Angeles Public Library and a motion to set operating hours for a North Hollywood pocket park.

librarypublishingparksbudgetreappointmentceqapublic-comment
Notable items
Tue Jun 24, 2025 · 10:00 AM

City Council Meeting

Public hearing on Cahuenga Boulevard and Kling Street No. 1 Street Lighting District

The Los Angeles City Council will hold a meeting to address agenda items and public testimony. The primary scheduled public hearing concerns protests against the proposed improvement and maintenance of a specific street lighting district.

infrastructurestreet-lightingpublic-hearing
✓ Decided: Council approved a water pipeline easement in Brand Park

The City Council adopted hearings for eight street‑lighting district protest items, each passing 14‑0‑1. It approved a public convenience and necessity application for Lola Cafe’s on‑site alcohol sales (14‑0‑1) and continued the Sylmar Liquor off‑site alcohol application to July 1. The council also passed an ordinance waiving animal adoption fees and approved an easement for a LADWP water pipeline in Brand Park.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (The Council may recess to Closed Session pursuant to Government Code Section 54956.9(d)(1), to confer with its legal counsel.) (Planning and Land…
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay
that the Councilmember be authorized to execute any such documents on behalf of the City. 3. Authorize the LAPD and/or the Department of Public Works to make any corrections, clarifications or…
11 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
that the approval of the recommendations in the CAO report comply with the City’s Financial Polices in that to the extent the Reserve Fund loan reduces the Reserve Fund below the 5 percent policy…
11 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hernandez nay · Jurado nay
The other 39 items passed by unanimous or near-unanimous consent.
Tue Jun 24, 2025 · 02:00 PM

Planning and Land Use Management Committee

TFAR transfer lets 51‑story mixed‑use project exceed FAR, with $13 M in payments

The Planning and Land Use Management Committee will consider a Transfer of Floor Area Rights that moves up to 274,795 sq ft from the Los Angeles Convention Center to a 51‑story mixed‑use development, accompanied by a $1,373,975 TFAR payment and an $11,462,471.39 public‑benefits payment. Other items include a zoning and height district change for the North Campus high‑school expansion, several categorical CEQA exemptions for historic‑cultural monuments, and a report to extend demolition‑permit restrictions in the Boyle Heights area. The committee will adopt findings and reports on these proposals.

zoninghousinghistoric-culturalenvironmentalfinancedevelopmentdemolition
✓ Decided: Committee approved draft ordinance for high school campus expansion

The Planning and Land Use Management Committee approved the Los Angeles City Planning Commission report and draft ordinance for the North Campus high school expansion (4 Yes, 0 No, 1 Absent). It also approved three Cultural Heritage Commission reports granting CEQA categorical exemptions for historic‑cultural monument designations, and approved a Department of City Planning report extending demolition‑permit restrictions in Boyle Heights (4 Yes, 0 No, 1 Absent). The committee denied two appeals, sustaining the Planning Commission's determinations on the Oakdale Estates zoning variance and on a mixed‑use project by SAFER (each 4 Yes, 0 No, 1 Absent).

Notable items
Tue Jun 24, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Port of Los Angeles proposes new emissions control strategy charges

The Trade, Travel and Tourism Committee will discuss a draft ordinance to establish emissions control charges at the Port of Los Angeles. The body will also consider several airport contracts and appointments to the Board of City Tourism Commissioners.

portsaviationenvironmentcontractstourismlax
Notable items
Mon Jun 23, 2025 · 01:00 PM

Ad Hoc Committee for LA Recovery

City proposes waiving permit fees for wildfire‑damaged property repairs

The Ad Hoc Committee for LA Recovery will hear updates on emergency management and several departmental reports on wildfire impacts. It will consider a City Attorney and Administrative Officer report recommending an ordinance to waive fees for permits needed to repair or rebuild structures damaged by the January 2025 wildfires, and will discuss the feasibility of waiving related plan check and permit fees. Additional items include reports on water bill relief, reservoir status, and motions on hiring practices and price‑gouging complaints.

wildfire-recoveryfeeswater-billhousinghiringreservoir
✓ Decided: City approved ordinance waiving permit fees for wildfire reconstruction

The committee approved a City Attorney‑drafted ordinance that waives permit and plan‑check fees for rebuilding properties damaged by the January 2025 wildfires. It also approved an ordinance to expand the city’s ability to apply for and receive emergency grants. Several motions were adopted, including actions on hiring practices, price‑gouging reporting, evacuation‑order reporting, and contract transparency. Additional reports on animal‑services reunification and reimbursement for the One‑Stop Rebuilding Center were also approved.

Notable items
Fri Jun 20, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

City proposes $60 million boost for immigration legal services

The Rules, Elections and Intergovernmental Relations Committee will consider a series of resolutions to include various state and federal legislative program supports in the City’s 2025‑26 budget. Items include support for digital age‑verification requirements, outdoor dining, wildfire recovery funding, climate‑resilience financing, and a $60 million increase for immigration legal services. The committee will also review appointments to the Charter Reform Commission.

legislationbudgetimmigrationclimatepublic-healthcharter-reform
✓ Decided: Council approved 17 resolutions supporting state and federal legislative programs

The Rules, Elections and Intergovernmental Relations Committee approved seventeen resolutions, all with unanimous 5‑yes votes and no opposition. The measures endorse a range of state and federal bills covering short‑term rentals, climate funding, disaster‑mitigation tax credits, outdoor dining, age‑verification for digital products, stormwater reuse, and RV removal. The committee also approved charter reform appointments. No items were denied or tabled.

Notable items
Fri Jun 20, 2025 · 10:00 AM

City Council Meeting

Council to file Sanitation report on annual greenhouse‑gas inventory

The Los Angeles City Council meeting will conduct roll call, approve the minutes, consider commendatory resolutions and introductions, and allow multiple agenda item comments and public testimony. The Energy and Environment Committee will present item 22‑1402, recommending that the Bureau of Sanitation report dated March 24 2025 be filed with the council regarding the annual community and municipal greenhouse‑gas inventory.

city-councilprocedurespublic-commentenvironmentgreenhouse-gas
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Fri Jun 20, 2025 · 02:00 PM

Civil Right, Equity, Immigration, Aging, and Disability Committee

Committee will consider motions to extend service contracts with Bureau Veritas and Ten Architects

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will hear public comment and then vote on two motions. One motion seeks to extend the Master Service Agreements with Bureau Veritas North America and Ten Architects for Certified Access Specialist services. The other motion proposes to amend and restate the FamilySource Center contract (C-146095) to extend its term through December 31, 2025. Additional agenda items include reports from the Mayor and city departments related to housing plans, language access, and grant funding.

housingcontractscommunity-investmentgrantaccessibility
✓ Decided: Committee approved extending Master Service Agreements for Certified Access services

The Civil Rights, Equity, Immigration, Aging, and Disability Committee approved several reports and motions. It approved the Chief Legislative Analyst report and multiple Community Investment for Families Department reports. The committee also approved motions to extend the Master Service Agreements for Certified Access Specialist services and to extend the FamilySource Center contract through Dec. 31, 2025.

Notable items
Wed Jun 18, 2025 · 08:30 AM

Personnel and Hiring Committee

City council to consider changes to the Just Cause for Eviction ordinance

The Personnel and Hiring Committee will review mayoral communications on board reappointments, several administrative reports, and an ordinance to amend the Just Cause for Eviction ordinance and create two new positions to support substantial remodels of non‑rent‑stabilization housing. It will also consider salary revisions for non‑represented classifications in the City Council and Mayor’s offices and the establishment of new Bridge‑to‑Jobs classifications. Additional items include reports on wildfire recovery, fire chiefs bargaining, and citywide layoff management.

personnelhiringsalarieshousingevictionordinanceboard-reappointmentsbridge-to-jobs
✓ Decided: Committee approved revised salary structure for City Council and Mayor offices

The Personnel and Hiring Committee approved several actions, including salary revisions for non‑represented City Council and Mayor staff, new Bridge‑to‑Jobs classification salaries, and reappointments to city boards. It also approved reports on wildfire recovery, hotel worker minimum wage resources, and citywide layoff management. All approvals recorded a unanimous Yes vote from the three members.

Room 401
Notable items
Wed Jun 18, 2025 · 10:00 AM

City Council Meeting

Council to consider storm drain easement on South Sepulveda Boulevard

The City Council will meet to discuss a categorical exemption and communication from the City Engineer. The primary item involves an offer to dedicate an easement for a storm drain.

infrastructurestorm-draineasementpublic-works
✓ Decided: Council authorized up to $16.2 M in SCAG grant funding for transportation projects

The City Council adopted categorical exemptions for easements on 6501 South Sepulveda Boulevard and 4000 Chevy Chase Drive. It approved the reappointment of six commissioners to various city boards. The Council also authorized LADOT and other agencies to accept up to $16.2 million in SCAG grant funding for transportation improvements.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Adopted Findings for Special 1 Motion (Lee, Yaroslavsky – McOsker) Forthwith
13 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Soto-Mart​ínez nay
The other 25 items passed by unanimous or near-unanimous consent.
Wed Jun 18, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $2.7 million loan for Southside Senior Housing project

The Housing and Homelessness Committee will hear reports on the Alliance Settlement Agreement, the HHAP‑6 grant application, and statutory exemptions for several tiny‑home and navigation‑center projects. It will consider two motions: one to disburse up to $749,331 from the Affordable Housing and Sustainable Communities Fund to BRIDGE Housing Corporation, and another to loan up to $2,700,000 from the HOME program to Southside LA Housing Partners for the Southside Senior Housing Project. Public comment will be taken in‑person only.

housinghomelessnessfinanceloansaffordable-housingtiny-homes
✓ Decided: Committee approves emergency housing voucher group, $749K grant and $2.7M loan

The Housing and Homelessness Committee approved a motion to create an Ad Hoc Emergency Housing Voucher working group. It also approved a $749,331 disbursement from the Affordable Housing and Sustainable Communities Fund to BRIDGE Housing for the Vermont and Manchester Project, and a $2.7 million HOME loan to Southside LA Housing Partners for the Southside Senior Housing Project. The committee noted and filed reports on the Alliance Settlement Agreement and a City Planning progress report, and concurred with a prior action on the HHAP‑6 grant.

Notable items
Wed Jun 18, 2025 · 03:30 PM

Public Safety Committee

Police Foundation donates $145,904.88 for ALPR equipment

The Public Safety Committee will consider several reports and motions, including a donation of $145,904.88 from the Los Angeles Police Foundation for West Los Angeles Division automated license plate recognition equipment. Other items include a donation of $114,705.00 for restroom repairs at the 77th Street Community Police Station, a proposed professional services agreement for inmate telephone and video visitation systems, and motions on hazardous waste management RFPs and medical services at the 77th Street Police Detention Facility.

public-safetypolicedonationscontractshazardous-wastefacility-maintenance
Notable items
Tue Jun 17, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee will consider transferring AB 1290 funds for Public Bank Feasibility Study

The Economic Development and Jobs Committee will hear a report on the Los Angeles Convention Center Expansion and Modernization Project and consider several motions, including the transfer of AB 1290 Fund money for Phase 1 of a public‑bank feasibility study. It will also discuss allocating CRA/LA bond proceeds to Beacon Street Redevelopment projects, extending contracts for BusinessSource Centers, and adopting the Workforce Development Board Year 26 Annual Plan.

economic-developmentfinancepublic-bankbondworkforceconvention-center
✓ Decided: Committee approved public‑bank study funding and multiple bond‑project allocations

The Economic Development and Jobs Committee approved several reports and motions, including funding for a Public Bank Feasibility Study Phase 1, a referendum petition to suspend wage increases and benefits for hotel and airport workers, and allocations of CRA/LA bond proceeds for projects in San Pedro. It also adopted the Workforce Development Board Year 26 Annual Plan and extended contracts for the existing BusinessSource Centers. All items were approved by votes ranging from 4‑1 to unanimous.

Notable items
Tue Jun 17, 2025 · 03:45 PM

Energy and Environment Committee

Amendment to contract for North Haiwee Dam No. 2 construction services

The Energy and Environment Committee will consider a second amendment to a contract with Road and Highway Builders, LLC for construction services on the North Haiwee Dam No. 2 Project. It will also receive updates on the LA100 Strategic Long‑Term Resource Plan to achieve carbon‑free status by 2035, and a mayoral communication reappointing George McGraw to the Board of Water and Power Commissioners. Additional reports include letters of support for Safe, Clean Water program projects and personal services contracts for environmental consultants and e‑recycling services.

water-powerenvironmentcontractsinfrastructurerecyclingcarbon-freesafe-clean-water
Notable items
Tue Jun 17, 2025 · 10:00 AM

City Council Meeting

Council to consider ordinance for Street Lighting Maintenance Assessment District

The Los Angeles City Council will hold its regular meeting at 10:00 AM on June 17, 2025. After roll call, approval of minutes, and commendatory resolutions, members will address multiple agenda item comments and public testimony. The agenda includes Item 25‑0535, a hearing on protests and first‑consideration of an ordinance establishing the Fiscal Year 2025‑26 Street Lighting Maintenance Assessment District.

street-lightingassessmentordinancepublic-hearingbudget
✓ Decided: Council approved $850,000 increase to legal services contract for Vadnais case

The council unanimously adopted three street‑lighting assessment ordinances for the 2025‑26 fiscal year. It approved an $850,000 increase to the City Attorney’s contract with Maynard Nexsen for the Vadnais Trenchless Services case (14‑1 vote). The council also authorized substituting Stoel Rives LLP for Downey Brand LLP in a related contract (14‑1). Additionally, a $965,635 grant for the HEART Criminal Records Clearance Project was accepted (13‑0).

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
53 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea
that the City’s Financial Policies are not applicable to the recommendations since no funding commitment is being made at this time. Approval of the recommendations in the report will allow the…
10 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ínez nay
The other 24 items passed by unanimous or near-unanimous consent.
Tue Jun 17, 2025 · 02:00 PM

Budget and Finance Committee

Budget and Finance Committee to review FY 2025-26 budget and innovation pilots

The Committee is discussing the Fiscal Year 2025-26 budget, including specific funding for a police human trafficking task force. Members will also review several pilot projects funded by the Innovation Fund and various grant acceptances for city departments.

budgetpoliceinnovation-fundtax-levygrantstransportation
✓ Decided: City approved three new community facilities district tax levies for FY 2025‑26

The Budget and Finance Committee approved the Chief Legislative Analyst’s FY 2025‑26 budget report and a LADOT plan to fund electric bus fleet upgrades. It also approved three new community facilities district tax levies for Legends at Cascades, Ponte Vista and Playa Vista for FY 2025‑26. Additional approvals included grants for animal‑services emergency relief, reauthorizing MICLA funds for Fire Station 31 design, and amending a legal services contract with Nossaman LLP.

Notable items
Tue Jun 17, 2025 · 08:30 AM

Government Operations Committee

Committee to review cannabis land use and city property leases

The Government Operations Committee will discuss amendments to cannabis land use restrictions and review several city-owned property leases. The body will also consider mayoral appointments to the Cannabis Regulation Commission.

cannabiszoningleasingpublic-facilitiesappointments
✓ Decided: Committee approved cannabis commission appointments and several city leases

The Government Operations Committee approved the reappointment of David Nash and the appointment of Adam Bierman to the Cannabis Regulation Commission. It also approved lease agreements for a public restroom and visitor center at 1627 Vine Street, a lease amendment for police vehicle storage at 1440 North Spring Street, and a license amendment for off‑site parking at 350 South Figueroa Street. Additional approvals included an amendment to the municipal code on cannabis land‑use restrictions and a lease with Alcott Center for space at 305 East 1st Street.

Room 401
Notable items
Wed Jun 11, 2025 · 08:30 AM

Transportation Committee

Committee to consider shifting bike‑path maintenance responsibility to Public Works

The Transportation Committee and Public Works Committee will hear reports and consider motions on bus electrification, parking district changes, and enforcement policies. Items include a LADOT report on South Coast Air Quality funding for electric buses, BOTC proposals to convert and expand preferential parking districts, and a motion to suspend parking enforcement at a Hollywood cleanup site. The committees will also review a contract amendment with Modaxo Traffic Management for citation processing and a pilot program using cameras to enforce parking violations in bicycle lanes. A motion will amend the Administrative Code to place responsibility for city bicycle and multi‑use paths with the Department of Public Works.

transportationpublic-worksparkingbike-pathsbus-electrificationenvironmentcontracts
✓ Decided: Committee approved pilot camera enforcement in bike lanes on Hollywood Blvd

The Transportation Committee approved several reports and motions, including a pilot program to use cameras for enforcing parking violations in bicycle lanes along Hollywood Boulevard. It also approved a LADOT report on funding for bus electrification, a contract amendment with Modaxo Traffic Management, and a new parking meter zone on Adams Boulevard. Additional approvals established oversize‑vehicle parking restrictions on multiple streets and transferred a parking revenue surplus to the Reserve Fund.

401
Notable items
Wed Jun 11, 2025 · 10:00 AM

City Council Meeting

Council to consider CEQA exemption for FY 2025‑26 Proposition K assessment

The Los Angeles City Council will conduct roll call, approve the previous meeting minutes, and adopt commendatory resolutions and introductions. It will hold a multiple‑agenda item comment period and hear public testimony on non‑agenda items. The council will then consider Item 24‑1029, which seeks a CEQA exemption for a communication from the City Attorney and an ordinance first consideration related to the FY 2025‑26 Proposition K assessment.

city-councilproceduralceqabudgetproposition-k
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Jun 11, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to consider reappointments and homelessness funding

The Housing and Homelessness Committee will consider reappointments to the United to House LA Citizens Oversight Committee and review a report on the Homelessness Emergency Account. The body will also discuss issuing tax-exempt and taxable revenue notes for supportive housing and a grant application for homeless assistance.

homelessnesshousingbudgetfinancecouncilcommitteereappointment
✓ Decided: Approved up to $45,163,792 tax‑exempt conduit note for Weingart Tower supportive housing

The committee approved several mayoral communications reappointing members to the LA Citizens Oversight Committee. It also approved reports and funding recommendations related to homelessness and the Homeless Housing Assistance and Prevention Program. Most notably, it adopted a resolution authorizing a tax‑exempt multifamily conduit revenue note of up to $45,163,792 for the Weingart Tower 1B Supportive Housing Project at 554 South San Pedro Street.

Notable items
Wed Jun 11, 2025 · 03:30 PM

Public Works Committee

Committee will consider contracts for Hyperion Phase 1A design‑build program

The Public Works Committee will discuss a series of motions and reports, including designating intersections as public squares, temporary street closures for safety, and increasing fines for illegal dumping. It will also hear reports on personal‑services contracts for Brownfields projects and on using progressive‑design‑build contracts for the Hyperion Phase 1A program. Several items may be recessed to closed session to consult legal counsel on pending lawsuits.

public-workscontractsstreetsdesign-buildbrownfieldslegal
Notable items
Tue Jun 10, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Zoo Department awards contracts to manage membership and events

The Arts, Parks, Libraries, and Community Enrichment Committee will hear reports and consider draft ordinances, including a Zoo Department report awarding agreements to SSA Group, LLC and The Superlative Group, Inc. to operate the Los Angeles Zoo membership, special events, publications, and sponsorship programs. The committee will also review a draft ordinance to waive animal adoption and redemption fees, an easement for a water pipeline in Brand Park, and a pilot program for fentanyl detection devices. Several mayoral reports on reappointments to various commissions will be presented for public comment.

zoocontractsanimal-servicesparksutilitiesreappointments
✓ Decided: Committee approved ordinance to waive adoption and redemption fees for animals

The committee approved several reports and ordinances, including a city‑admin officer report on a fentanyl detection pilot, a change to the primary merchant designation for the El Pueblo historic monument, and an ordinance allowing the animal services department to waive adoption and redemption fees for pets. It also approved an easement for a water pipeline in Brand Park and reappointed multiple commissioners to various boards. All actions passed with two votes in favor and one member absent, except three items that passed unanimously.

Notable items
Tue Jun 10, 2025 · 10:00 AM

City Council Meeting

Council considers exemption for FY 2025‑26 Proposition K assessment

The City Council will review item 24‑1029, seeking an exemption from the California Environmental Quality Act for a communication from the City Attorney and an ordinance first‑consideration related to the FY 2025‑26 Proposition K assessment. The council will vote on whether to grant the exemption.

ordinanceceqabudgetassessment
✓ Decided: Council approved FY 2025‑26 Proposition K assessment and allocated $561,953

The Council adopted the ordinance confirming the FY 2025‑26 Proposition K assessment, approved the two‑year L.A. for Kids program plan, and allocated $561,953 in administrative funds. It also authorized the City Engineer to negotiate grant agreements and directed the Controller and ITA to set up accounts and increase ITA funding. Additional actions included approving liquor licenses for Liquid Partyworks and The Teragram Ballroom and adopting ordinances for several street‑lighting districts.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Adopted Item
54 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay
The other 41 items passed by unanimous or near-unanimous consent.
Tue Jun 10, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to consider $6.8 million REAP 2.0 grant agreement

The Planning and Land Use Management Committee will consider authorizing the Department of City Planning to apply for, accept, and execute a grant agreement of up to $6,803,759 for the Regional Early Action Program (REAP 2.0). It will also review several categorical CEQA exemptions, including one for VA Corner Dining’s Full House Restaurant and another for a Hyundai dealership project on West Martin Luther King Jr. Boulevard. Additional items include a historic‑cultural monument designation for The Du Barry and a report on pending litigation involving a 7‑Eleven store on West Santa Monica Boulevard.

grantsenvironmentzoninghousingdevelopmentlitigationplanning
✓ Decided: Committee approves major General Plan changes and multiple zoning ordinances

The Planning and Land Use Management Committee approved a set of General Plan actions, including dismissing a Community Plan amendment, adopting the Transportation Element of the General Plan, and approving a Modified Vesting Zone Change and Height District Ordinance along with a new Sign District. The committee also approved several reports and draft ordinances from the Planning Commission, Cultural Heritage Commission, and City Attorney. All approvals were recorded with vote tallies. No other substantive items were decided.

Notable items
Tue Jun 10, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

LAWA contract amendments for arts programs and services at LAX and Van Nuys

The Trade, Travel and Tourism Committee will consider several amendments to Los Angeles World Airports contracts, including a musical arts program at LAX and on‑call art handling services at LAX and Van Nuys. Each amendment seeks a CEQA administrative exemption and has a fiscal impact. The items are time‑limit files with council action due by July 1, 2025 (or June 20 for one item).

airportscontractsartsceqabudget
Notable items
Mon Jun 9, 2025 · 06:00 PM

Los Angeles City Health Commission

Health Commission to discuss infectious disease prep for 2028 Olympics

The Los Angeles City Health Commission will receive a presentation on infectious disease prevention strategies for the 2028 Olympic and Paralympic Games. The body will also review the 2024-25 Annual Report.

public-healtholympics-2028infectious-diseasesannual-report
340
Fri Jun 6, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee to consider accepting penalty payments from Lynn Tollakson and Century Hill

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will discuss a motion to accept compensatory penalty payments from Lynn Tollakson and Century Hill Association for a violation of the Civil and Human Rights Law. The agenda also includes a cancelled item for a Community Investment for Families Department report on the FY 2023-24 Citywide Language Access Annual Report. Public comment will be taken in person only.

civil-rightsequitypenaltiescity-councilcommittee
Fri Jun 6, 2025 · 10:00 AM

City Council Meeting

Council reviews continued hearing protest on building safety lien

The Los Angeles City Council will meet at 10:00 a.m. in the Council Chamber. The council will conduct roll call, approve the minutes, consider commendatory resolutions, allow multiple agenda item comments, hear public testimony on non‑agenda items, and note items for public hearing. The main agenda item is a continued consideration of a hearing protest, appeals or objections to the Department of Building and Safety report and confirmation of a lien for nuisance‑abatement and code‑violation inspection costs under the municipal and administrative codes.

councilhearing-protestbuilding-safetynuisance-abatementpublic-comment
✓ Decided: Council confirmed $238,901 lien and approved $1.4M fire waste contract

The council voted 13‑0 to confirm a $238,901.18 lien for nuisance abatement at 1017 North Heliotrope Drive. It also approved the Los Angeles Fire Department’s hazardous‑materials contract with Clean Harbors, a two‑year agreement up to $1.4 million, by a vote of 11‑0. In closed session, the council authorized payments of $1,193,493.62 for the Edward Prokop judgment and $2,250,000 for the Sherin Sheriff settlement, each adopted 13‑0.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $238,901.18) (Continued from Council meeting of April 2, 2025) Adopted Item
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Friday - June 6, 2025 - PAGE 2 Adopted Item
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea
[context] Adopted Item
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item Friday - June 6, 2025 - PAGE 3
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea
that the LAFD has identified funds in its FY 2024-25 Contractual Services Account 3040 to cover expenses related to this Agreement. Community Impact Statement: None submitted TIME LIMIT FILE - JUNE…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Mart​ínez yea
[context] (This matter arises from Plaintiff’s claims of discrimination under the Fair Employment and Housing Act.) Friday - June 6, 2025 - PAGE 5 (The Budget and Finance Committee will consider the…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (This matter involves an alleged trip and fall incident on November 24, 2019 at 9158 Hargis Street, Los Angeles, California.) (Budget, Finance and Innovation Committee will consider the…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Friday - June 6, 2025 - PAGE 6 Adopted Item to Continue to June 10, 2025
10 yea · 5 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Soto-Martinez yea · ·Lee absent · Raman absent · Rodriguez absent · Soto-Martfnez absent · Yaroslavsky absent
Wed Jun 4, 2025 · 10:00 AM

City Council Meeting

City Council to consider eminent domain proceedings for project 25-0069

The City Council will meet to discuss various administrative matters and one specific item noticed for public hearing. The body is considering the commencement of eminent domain proceedings related to project 25-0069 in Council District 11.

eminent-domainenvironmentpublic-hearingcd-11
✓ Decided: Council approved eminent‑domain acquisitions for LAX modernization project

The City Council adopted four Resolutions of Necessity and accompanying ordinances that authorize eminent‑domain to acquire several parcels for the Airfield and Terminal Modernization Project at LAX, passing 14‑0. It also approved financing measures for the Locke Lofts affordable‑housing project, including a $50 million tax‑exempt conduit note and an $8 million subordinate bond. Additionally, the Council directed reports on LA28 venue reuse, the Fats, Oil and Grease program, and approved the Watershed Investment Strategic Plan.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
[context] Adopted to Continue Item to June 6, 2025
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Wednesday - June nay
The other 12 items passed by unanimous or near-unanimous consent.
Wed Jun 4, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to consider amendment to Just Cause for Eviction Ordinance for substantial remodels

The Housing and Homelessness Committee will hear a verbal update from the Los Angeles Homeless Services Authority on the Coordinated Entry System and review several reports and motions. Items include an interim housing bed‑rate adjustment for transitional aged youth, a memorandum of understanding with the California Housing Finance Agency to issue conduit bonds and study fees for the Affordable Housing Bond Program, and an amendment to the Just Cause for Eviction Ordinance related to substantial remodels. The committee will also consider a revised ordinance establishing a Right to Counsel program and other motions on performance measures and budgetary efforts to address homelessness.

housinghomelessnessevictionaffordable-housingbondsyouth-housingordinance
✓ Decided: Approved appropriation of Proposition HHH funds for staff to speed affordable housing approvals

The committee approved several City Administrative Officer and Housing Department reports, including an interim housing bed‑rate adjustment for transitional aged youth and a memorandum of understanding with the California Housing Finance Agency. It also approved amendments to the Just Cause for Eviction Ordinance and the creation of a Right to Counsel program. A motion was approved to appropriate funds from the Proposition HHH Permanent Supportive Housing Loan Program Revenue Fund for staff positions to expedite 100% affordable housing projects and temporary shelters.

Notable items
Wed Jun 4, 2025 · 03:30 PM

Public Safety Committee

Committee votes to shift police overtime funds to fund Task Force rentals

The Public Safety Committee will consider a budget motion to reallocate police overtime funds to the Human Trafficking Task Force for vehicle rentals. It will also hear motions authorizing a hazardous waste services agreement for the LAFD, directing the Emergency Management Department to develop an Emergency Standby Services contract, and improving enforcement of unauthorized cannabis shops. Several reports will be presented on in‑kind donations to the Fire Department totaling millions of dollars.

public-safetybudgetfire-departmentpoliceemergency-managementdonationscannabis-enforcement
Tue Jun 3, 2025 · 08:30 AM

Government Operations Committee

Committee to discuss cannabis fees and retail license lottery pause

The Government Operations Committee will review reports on commercial cannabis fees and a proposal to pause the 2025 retail license lottery. The body will also consider budget amendments for the General Services Department and review construction project reports.

cannabisbudgetfeeslicensingconstruction
✓ Decided: Budget motions restoring General Services funding approved by committee

The committee approved two budget motions (Price – Hutt and Price – Nazarian) to restore funding and positions in the General Services Department for 2025‑26. It also approved a motion to pause the Department of Cannabis Regulation's Phase 3 Round 3 retail license lottery in 2025. Additional items, including the 2024 Comprehensive Fee Study and several reports, were approved as amended.

Room 340
Notable items
Tue Jun 3, 2025 · 10:00 AM

City Council Meeting

City Council to consider 2025 Annual Weed and Brush Abatement Program

The City Council is meeting to discuss and potentially adopt an ordinance for the 2025 Annual Weed and Brush Abatement Program. This program authorizes the removal of weeds, rubbish, refuse, and dirt from specific streets.

public-worksordinancemaintenance
✓ Decided: Council approved $783 million geothermal power purchase amendment

The City Council adopted an ordinance approving the First Amendment to the Heber‑1 Geothermal Energy Project Power Sales Agreement, extending the term to 2051 with an estimated annual cost of $31,320,000 and a total cost of $783,000,000. The council also found the amendment exempt under CEQA, delegated authority to the Board of Water and Power Commissioners, and authorized the LADWP chief accounting employee to draw on the Renewable Energy Fund. The vote was 13‑0 in favor with 2 members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
73 yea · 4 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the recommendations in the report comply with the City’s Financial Policies in that budgeted funds are being used to fund recommended actions. Community Impact Statement: None submitted Adopted…
11 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Rodriguez nay
The other 13 items passed by unanimous or near-unanimous consent.
Tue Jun 3, 2025 · 02:00 PM

Budget and Finance Committee

City proposes $1.7 billion Tax and Revenue Anticipation Notes for FY 2025‑26

The Budget and Finance Committee will receive a year‑end financial status report for FY 2024‑25 and consider the issuance and sale of 2025 Tax and Revenue Anticipation Notes up to $1.7 billion for FY 2025‑26. It will also discuss two budget motions to restore funding and positions in the General Services Department, one offset by the Sewer Construction and Maintenance Fund and the other by the postage account. Additional items include grant acceptances, fee changes, and a municipal code amendment affecting cannabis businesses.

financebudgettaxationgrantsordinancepublic-safetytransportation
✓ Decided: Committee approved $1.7 billion of Tax and Revenue Anticipation Notes

The Budget and Finance Committee approved several items, including the issuance and sale of up to $1.7 billion in Tax and Revenue Anticipation Notes for FY 2025‑26. It also adopted budget motions restoring funding and positions in the General Services Department, and approved a fee increase for Emergency Ambulance Transport Services. Additional approvals covered a cannabis tax definition amendment, reserve‑fund borrowing authority, and a surplus transfer to the Reserve Fund. All votes were unanimous with one member absent (McOsker) where noted.

Tue Jun 3, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee to discuss Hollywood Walk of Fame amenities and labor enforcement

The Economic Development and Jobs Committee will review reports on workforce center redesigns and labor violation enforcement. The body will also consider funding for public amenities on the Hollywood Walk of Fame.

laborwage-thefthollywoodworkforce-developmentpublic-amenities
✓ Decided: Committee approved CRA/LA bond funds for Hollywood Walk of Fame amenities

The Economic Development and Jobs Committee approved three reports and noted one. Approvals included the Joint Economic and Workforce Development report, the Citywide Hotel Worker Minimum Wage report, and the CRA/LA bond appropriation for Hollywood Walk of Fame public amenities. The Public Housekeeping Training report was noted and filed. Two items were continued for future consideration.

Notable items
Tue Jun 3, 2025 · 03:30 PM

Energy and Environment Committee

Committee to review Milford Solar agreements and new LADWP customer center lease

The Energy and Environment Committee will discuss solar energy agreements with the Southern California Public Power Authority and a lease for a customer service center. The body will also review reports on greenhouse gas inventories, zero-waste plan compliance, and a waste collection pilot program.

solar-energywaste-managementgreenhouse-gasladwppublic-works
Notable items
Fri May 30, 2025 · 10:00 AM

City Council Meeting

Council to consider Right‑of‑Entry Permit for The Nine Club Cup skate event

The Los Angeles City Council will hold its regular meeting, beginning with roll call, approval of minutes, and commendatory resolutions. The council will then hear public comments and consider a Government Operations Committee report recommending a Right‑of‑Entry Permit for the Nine Club Cup skateboarding event at the West LA Municipal Building (1645 Corinth Avenue) and the West LA Courthouse Skate Plaza (1633 Purdue Avenue). No other specific actions are listed in the agenda.

city-councilpermitsskateboardinggovernment-operationspublic-comment
✓ Decided: Council adopted the FY 2025‑26 annual budget resolution

The council approved a Right of Entry permit for the Nine Club Cup skateboarding event at the West LA Municipal Building (vote 10‑0). It also approved a lease and CEQA exemption for a Tiny Home Village at 2377 Midvale Avenue (vote 13‑0). The Five‑Year Workforce Development Strategic Plan was adopted (vote 10‑0), and the FY 2025‑26 annual budget resolution was adopted forthwith.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] Adopted Item
8 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Padilla yea · Park yea · Price Jr yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item
8 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Padilla yea · Park yea · Price Jr yea
Wed May 28, 2025 · 10:00 AM

City Council Meeting

City Council to consider street easement at 6101 West Century Boulevard

The City Council will meet to conduct business including a public hearing regarding a street easement. The agenda also includes procedural items such as roll call and approval of minutes.

roadseasementspublic-hearing
✓ Decided: Council approved West Century Blvd easement exemption and recessed Merrywood acquisition

The council adopted a categorical exemption for an easement on 6101 West Century Boulevard, with all 13 members present voting yes. The council also adopted a motion to recess into closed session to consider the acquisition of properties on Merrywood Drive, again with unanimous support from the 13 members present.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (Personnel and Hiring Committee waived consideration of the above matter)
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martinez yea
[context] d Special Motions for Posting and Referral - SEE ATTACHED Council Members' Requests for Excuse from Attendance at Council Meetings Closed Session (24) 23-0782 CD 4 The City Council shall…
12 yea · 2 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martinez yea · Rodriguez absent · Soto-Martfnez absent
Wed May 28, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee reviews lease for Tiny Home Village at 2377 Midvale Avenue

The Housing and Homelessness Committee will consider two agenda items. Item 23-1182 is a report from the Chief Legislative Analyst on homelessness outreach services and policy. Item 23-1022‑S15 is a statutory exemption and Municipal Facilities Committee report on a lease agreement between the City and the Whittier Area First Day Coalition for operating a Tiny Home Village interim housing site at 2377 Midvale Avenue in Council District 5, with a fiscal impact statement required.

housinghomelessnessleasestiny-homesdistrict-5fiscal-impact
✓ Decided: Committee approved lease report for Tiny Home Village at 2377 Midvale Ave

The Housing and Homelessness Committee approved the Municipal Facilities Committee report dated May 19, 2025, which authorizes a lease agreement with the Whittier Area First Day Coalition for an interim Tiny Home Village housing site at 2377 Midvale Avenue in Council District Five. The report included a fiscal impact statement. Item 23-1182 (Chief Legislative Analyst report on homelessness outreach) was noted as continued to a date to be determined, with no action taken.

Notable items
Tue May 27, 2025 · 10:00 AM

City Council Meeting

Council to review FEIS/EIR for Bellanca Avenue vacation and Crenshaw/LAX Transit Corridor

The Los Angeles City Council will consider the final environmental impact statement and report for the vacation of Bellanca Avenue from Arbor Vitae Street to its southern terminus (VAC‑E1401401). It will also review the FEIS/EIR for the Crenshaw/LAX Transit Corridor. The meeting includes routine business such as roll call, approval of minutes, commendatory resolutions, and public comment periods.

environmental-impacttransitpublic-hearingcouncil-proceduresagenda
✓ Decided: Council approved up to $11 million in bonds for facilities at 20801 Rinaldi St.

The Council adopted the street vacation of Bellanca Avenue from Arbor Vitae Street to its southerly terminus, relieving the city of maintenance and liability. It also authorized up to $11 million in bonds to finance the acquisition and construction of educational facilities at 20801 Rinaldi Street in District 12. Additional actions included approving the mayor’s appointment of Julio Esperias, Jr. to the South Los Angeles Area Planning Commission, directing the Building and Safety Department to study code amendments for erosion and flood hazards, and ratifying court‑ordered annulments of prior council actions on projects at North Wilbur Avenue and West Olinda Street.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] (Continued from Council meeting of May 20, 2025) Adopted Item
9 yea · 4 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay
The other 28 items passed by unanimous or near-unanimous consent.
Tue May 27, 2025 · 02:00 PM

Planning and Land Use Management Committee

Approval of a 181‑unit mixed‑use project at 4579 West Hollywood Blvd

The Planning and Land Use Management Committee will consider a categorical exemption from CEQA for the demolition of an existing commercial building and the construction of a seven‑story, 181‑unit mixed‑use building at 4579 West Hollywood Boulevard. The agenda also includes a status report from the Director of Planning, an exemption to relocate a municipal code section, a mayoral appointment, and several other CEQA‑related items and appeals. Public comment will be accepted in person only.

zoningceqadevelopmenthousingplanning
✓ Decided: Approved CEQA exemption ordinance and denied several planning appeals

The committee approved a City Attorney report and draft ordinance creating a new Division 13B.12 and amending several code sections, with a 5‑yes, 0‑no vote. It also approved the mayor’s appointment of David Ryan to the West Los Angeles Area Planning Commission (5‑yes, 0‑no). Appeals on a categorical CEQA exemption, a mitigated negative declaration, and a mixed‑use project were all denied or partially granted, each with a 5‑yes, 0‑no vote, sustaining the Planning Commission’s original determinations.

Notable items
Fri May 23, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee to discuss city employee class titles and labor agreements

The Personnel and Hiring Committee will review proposed changes to city employee class titles and amendments to labor agreements for three bargaining units. The body will also discuss language access reporting and the acceptance of a federal security grant.

city-employeeslabor-agreementsgrantspublic-safetyadministration
Room 401
Fri May 23, 2025 · 10:00 AM

City Council Meeting

Council to vote on transfer of Olvera Street Space C-9 interest

The Los Angeles City Council will consider a recommendation to approve the transfer of interest for Olvera Street Space C-9 from merchant Bertha Gomez to merchant Felix Muñoz. The item is listed as agenda number 25-0438 and includes Contract No. C-119542. The council will also conduct routine business such as roll call, approval of minutes, and public comment periods.

zoningcommercecommunitypublic-commentcity-council
✓ Decided: Council approved $200,000 Innovation Fund for Sanitation Smart Meter pilot

The council approved the allocation of $200,000 from the Innovation Fund to the Bureau of Sanitation for a Smart Meter Installation pilot, establishing a new appropriation account. It also approved $125,000 for an LAPD Use‑of‑Force Dashboard pilot and $200,000 for a Department of Cultural Affairs Watts Towers virtual accessibility pilot. The council approved the transfer of interest for Olvera Street Space C‑9 from merchant Bertha Gomez to Felix Muñoz and adopted a resolution supporting Senate Bill 71 in the 2025‑26 State Legislative Program. All actions were adopted unanimously with 11 votes in favor and 0 against, except the employee‑transfer process motion which passed 14‑0.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted [Council adopted Motion (Harris-Dawson – Jurado) at Council meeting of May 16, 2025.] Adopted Item Forthwith
7 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Price Jr yea · Soto-Mart​ínez yea · Lee nay · Park nay · Rodriguez nay
The other 21 items passed by unanimous or near-unanimous consent.
Thu May 22, 2025 · 09:00 AM

City Council Meeting (Recessed from Wednesday, May 21, 2025)

City Council meeting recessed from May 21

This meeting is a recess of the session originally held on Wednesday, May 21, 2025. The agenda is primarily procedural boilerplate, with public comment closed for Item 1.

proceduralbudget
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed May 21, 2025 · 08:30 AM

Ad Hoc Committee on the 2028 Olympic and Paralympic Games

LA28 committee meets to plan for 2028 Olympics

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games will discuss venue lists, visitor accommodations, and accessibility plans. The body will also review funding allocations and project plans for the city's Youth Sports Program.

olympicsla28sportsbudgetaccessibilityparkscouncil
✓ Decided: Committee approved motions advancing LA28 venues, accessibility and youth sports plans

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games approved several motions to move forward with venue planning, visitor accommodation, and accessibility initiatives. It also approved multiple reports on the city's youth sports partnership projects and related fiscal plans. No action was taken on the discussion-only item about a verbal update from LA28 representatives.

Notable items
Wed May 21, 2025 · 10:00 AM

City Council Meeting

City Council to review the 2025‑26 budget report from the Budget & Finance Committee

The Los Angeles City Council will consider a presentation of the Budget and Finance Committee's report on the Mayor's proposed 2025‑26 city budget (item 25-0600). The meeting also includes routine business such as roll call, approval of the minutes, commendatory resolutions, and opportunities for public comment on multiple agenda items. Additional items include public testimony of non‑agenda matters and items noticed for future public hearing.

budgetingfinancecity-budgetcouncil-procedurepublic-commentmeetings
✓ Decided: Council recessed without any substantive actions

The meeting recorded roll call, approval of minutes, a budget report presentation, and public comment on item 25-0600. No motions were voted on or decisions approved. The council recessed to continue on May 22, 2025.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
Wed May 21, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $50 million for Locke Lofts affordable housing project

The Housing and Homelessness Committee will discuss reports on homelessness outreach and the Coordinated Entry System. The body is also reviewing funding for affordable housing projects and interim housing bed rate increases.

affordable-housinghomelessnesscontractsfinancingtenant-services
Notable items
Tue May 20, 2025 · 10:00 AM

City Council Meeting

Council will review protests and appeals to a Building Safety lien for nuisance abatement.

The City Council meeting will begin with roll call, approval of the previous meeting minutes, and commendatory resolutions. Council members will allow multiple agenda item comments and public testimony on non‑agenda items. The primary substantive item is the continued consideration of protests, appeals, or objections to a Los Angeles Department of Building and Safety report and the confirmation of a lien for nuisance abatement costs.

councilbuilding-safetynuisance-abatementpublic-hearingprocedural
✓ Decided: City Council held procedural session with no substantive decisions

The council conducted roll call, approved the previous meeting's minutes, and noted a public hearing item regarding a lien for nuisance abatement at 11643 West Otsego Street. No votes or approvals were recorded for any agenda items.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
Tue May 20, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee to discuss LA28 hiring program and workforce development plan

The Economic Development and Jobs Committee will review the status of the LA28 Community Business and Procurement Program, adopt a new Workforce Development Strategic Plan, and discuss the WorkSource Center system redesign. The committee will also consider appointments to the Workforce Development Board.

jobsworkforcela28procurementhiringcity-councilbudget
✓ Decided: Committee approved the Workforce Development Board's five‑year strategic plan

The committee approved a communication from the Mayor about Workforce Development Board appointments (5‑0 vote). It also approved the Workforce Development Board’s five‑year strategic plan report (3 votes in favor, 2 members absent). Additionally, the committee noted and filed Bureau of Contract Administration reports on the Local Business Preference Program (5‑0 vote).

Notable items
Tue May 20, 2025 · 03:30 PM

Energy and Environment Committee

Committee to discuss energy projects and water program updates

The Energy and Environment Committee will review reports on geothermal energy, water infrastructure, and power outages. The body is also considering the selection of a new Executive Director for the Office of Public Accountability.

energywaterinfrastructureenvironmentpublic-works
Notable items
Tue May 20, 2025 · 08:30 AM

Government Operations Committee

Committee to discuss cannabis fees and unauthorized shop enforcement

The Government Operations Committee will review reports on construction projects and cannabis regulatory fees. Members will also discuss a fentanyl detection pilot program and a permit for a skateboarding event in West LA.

cannabispublic-healthconstructionpermitsfees
Room 401
Fri May 16, 2025 · 08:30 AM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee to review mayor's report on 2025‑26 Housing & Community Development Action Plan

The Civil Rights, Equity, Immigration, Aging and Disability Committee will hear a report from the Mayor on the requested determinations, findings, instructions and authorizations for the 51st Program Year (2025‑2026) of the Housing and Community Development Consolidated Plan Action Plan. The report will address whether the Action Plan is a CEQA project, a fiscal activity, or exempt under specific CEQA guidelines. The committee will note the fiscal impact statement (recorded as “Yes”) and the absence of a community impact statement.

housingcommunity-developmentceqacivil-rightsequity
✓ Decided: Committee postpones action on 51st Program Year housing plan

The Civil Rights, Equity, Immigration, Aging, and Disability Committee received Mayor Report 25‑0525 on the 51st Program Year of the Housing and Community Development Consolidated Plan. The report stated the Action Plan is not a CEQA project and is exempt under the applicable guidelines. The item was continued to a date to be determined, with no vote recorded.

Notable items
Fri May 16, 2025 · 10:00 AM

City Council Meeting

Council to review report on city office leases and at‑home workstation costs

The City Council will conduct its regular procedural business, including roll call, approval of minutes, and commendatory resolutions. Council members will hear public comments on non‑agenda items and items that have already held hearings. The council will consider item 25‑0357, a report from the Government Operations and Efficiency committees on the city’s use of resources for office leases, workspace and at‑home workstation equipment, and will receive a recommendation to instruct the Department of General Services.

governmentoperationsleasesworkspaceequipmentcouncil-procedure
✓ Decided: City Council held a meeting but recorded no substantive decisions

The council met on May 16, 2025 with 11 members present and 5 absent. A report from the Government Operations and Efficiency committees on office leases and remote‑work equipment was presented. No vote or final action on the recommendations was recorded in the minutes.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Fri May 16, 2025 · 01:00 PM

Budget Hearings (Full Agenda Available on PDF)

Budget committee to review mayor's 2025-26 proposed budget

The Budget and Finance Committee will consider the Mayor's proposed 2025-26 budget, including changes reported by the Chief Legislative Analyst. Public comment will be taken in-person only.

budgetfinancecity-councilpublic-hearinglos-angeles
Wed May 14, 2025 · 10:00 AM

City Council Meeting

Council considers dedicating City-owned land as public street on West Century Boulevard

The City Council is meeting to conduct general business and hold a public hearing regarding a property dedication. The body will consider an ordinance to dedicate City-owned real property as a public street.

roadsreal-estateordinance
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed May 14, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to consider report on corporate-owned homes and possible tax

The Housing and Homelessness Committee will hear seven agenda items, including reports on interagency agreements, the Homekey1 program, a criminal‑record clearing grant, and loan and incentive programs for housing projects. Two motions will be considered: one to identify data silos related to homelessness and another to request a study of corporate‑owned single‑family homes and explore a possible tax measure. The meeting also includes a period for general public comment.

housinghomelessnesstaxdatafinance
✓ Decided: Committee approved seven housing reports and two data‑related motions

The Housing and Homelessness Committee approved seven City Administrative Officer and Housing Department reports covering inter‑agency services, interim housing extensions, loan programs, and grant acceptance. It also approved two motions: one to identify and share data related to homelessness, and another to study corporate ownership of single‑family homes and a possible tax measure. All items were adopted with a vote of three in favor.

Notable items
Tue May 13, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to discuss park fee updates and Coach LA staffing

The Arts, Parks, Libraries, and Community Enrichment Committee will consider updating the method for adjusting park fees and an amendment to the Coach LA Initiative staffing structure. The body will also review a transfer of a concession space on Olvera Street and a grant application for a summer lunch program.

parksfeescoach-lasummer-luncholagrantstaffing
✓ Decided: Committee approves four reports and an ordinance update

The Arts, Parks, Libraries, and Community Enrichment Committee approved a City Attorney report and ordinance to update park fee adjustments (3 votes Yes). It also approved three Board of Recreation and Parks Commissioners reports – an amendment to the Coach LA partnership, a transfer of interest for Olvera Street Space C‑9, and authority to apply for a Summer Food Service grant – each with 2 votes Yes and 1 member absent.

Notable items
Tue May 13, 2025 · 10:00 AM

City Council Meeting

Council to consider alcohol sale application for Sakura Market

The City Council will meet to discuss one public hearing item regarding the sale of alcoholic beverages. The remainder of the agenda consists of procedural boilerplate and standard meeting rules.

alcohol-salespublic-hearingbusiness-licensing
✓ Decided: Council approved up to $124.25 M in bonds for two affordable housing projects

The council adopted a motion granting a public convenience for Sakura Market (14‑0 vote). It approved revenue bonds of $63.25 M for Weingart Tower II and $61 M for Weingart Tower I, each passing 13‑0 with two members absent. The council also authorized up to $8.63 M from the state for a 13.3‑mile fiber‑optic network and a $1.29 M fund transfer, both approved unanimously. Additional items adopted include two civil‑service exemptions and directives for brownfield and oil‑and‑gas reports.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
74 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Tuesday - May 13, 2025 - PAGE 16 (Personnel and Hiring Committee and Budget and Finance Committee waived consideration of the above matter)…
10 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
The other 21 items passed by unanimous or near-unanimous consent.
Tue May 13, 2025 · 02:00 PM

Planning and Land Use Management Committee

Approval of TFAR transfer and 51‑story mixed‑use project at 1201 S. Figueroa

The Planning and Land Use Management Committee will consider a range of items, including a request to continue a CEQA categorical exemption for a 184‑unit residential project on Mission Road and Lincoln Park Avenue, and a motion directing the Department of Building and Safety to study code changes for erosion and flood hazards. The agenda also includes a mayoral appointment, a City Attorney report to correct technical errors in an existing ordinance, and several Sustainable Communities Environmental Assessments. The most significant item is the transfer of floor‑area rights from the Los Angeles Convention Center to a 51‑story mixed‑use development, with associated transfer and public‑benefits payments.

zoninghousingenvironmentfinancedevelopmentplanningcode
✓ Decided: Committee approved TFAR transfer and $13M public benefit payment for 51‑story project

The Planning and Land Use Management Committee approved a Transfer of Floor Area Rights allowing a 51‑story mixed‑use development, including a $1,373,975 transfer payment and $11,462,471.39 public‑benefits payment. The committee also approved related City Attorney and Mayor reports, adopted a motion for a building‑code study on erosion and flood hazards, and denied an appeal, sustaining the Planning Commission’s earlier determination.

Notable items
Fri May 9, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee to review city employee pay, benefits, and hiring exemptions

The Personnel and Hiring Committee will discuss updates to city employee salaries, parental leave, and military leave. The body is also reviewing requests to exempt specific technical positions from Civil Service requirements.

city-employeessalarieshiringbenefitscivil-service
✓ Decided: City Council approved adding two new employee unions to the recognized list

The Personnel and Hiring Committee approved a series of exemptions and ordinance amendments. Items included exemptions for a chief information security officer and a process safety engineer, additions of two labor unions to the recognized employee‑organization list, salary provisions for new helicopter‑mechanic classifications, implementation of military leave with pay, updates to minimum‑wage‑aligned salaries, and a change allowing work experience to satisfy education requirements. Approvals were recorded with vote counts ranging from three votes in favor to three‑to‑two splits.

Room 401
Notable items
Fri May 9, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee to review 2025-26 state and federal legislative program positions

The Rules, Elections and Intergovernmental Relations Committee is discussing the City's official positions on several state and federal bills. These items determine whether the City will support or oppose specific legislation regarding taxes, utilities, and environmental regulations.

state-legislationfederal-legislationtax-creditsutilitiesenvironmenttransportation
Notable items
Fri May 9, 2025 · 10:00 AM

City Council Meeting

Council considers $65 million bond for 116‑unit Oaks on Balboa affordable housing

The Los Angeles City Council will vote on a motion and resolution to issue revenue bonds not to exceed $65,000,000. The funds would be used for the acquisition, development, construction and equipping of a 116‑unit affordable housing project called Oaks on Balboa, located at 5435‑5445 Balboa Boulevard in Council District Four. The meeting also includes routine items such as roll call, approval of minutes, commendatory resolutions, and public comment periods.

affordable-housingbondsfinancecouncilpublic-commentprocedural
✓ Decided: Council approved resolutions backing two state film‑tax‑credit bills

The council adopted several items by unanimous vote. It noted and filed the Innovation and Performance Commission 2023‑24 annual report and the Department of Animal Services wildlife‑education funding request withdrawal. It also noted and filed reports on gun‑buyback resources and the federal clean‑energy tax‑credit status. Additionally, the council approved resolutions supporting Senate Bill 630 and Assembly Bill 1138, and transferred jurisdiction of a city‑owned alley from the General Services Department to the Bureau of Engineering.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
[context] Adopted Item
18 yea
Blumenfield yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Blumenfield yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
9 yea
Blumenfield yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Visit www.lacouncilfile.com for background documents.) Community Impact Statement: None…
9 yea
Blumenfield yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
18 yea
Blumenfield yea · Harris-Dawson yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Blumenfield yea · Harris-Dawson yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea
[context] Adopted Item - SEE ATTACHED
9 yea
Blumenfield yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea
Thu May 8, 2025 · 10:00 AM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee to review Mayor's 2025-26 Proposed Budget

The Budget and Finance Committee is holding special meetings to consider the Mayor's 2025-26 Proposed Budget. The committee will review memos and question General Managers and the Chief Legislative Analyst regarding proposed changes.

budgetfinancecity-government
Wed May 7, 2025 · 10:00 AM

City Council Meeting

City Council to hear nuisance abatement lien appeal for CD 4 property

The City Council will hold a meeting to address administrative matters and a specific public hearing. The body is considering a protest or appeal regarding a Building and Safety Department report for nuisance abatement costs in Council District 4.

nuisance-abatementcode-violationspublic-hearing
✓ Decided: Council confirmed 13 nuisance‑abatement liens totaling about $63K

The Los Angeles City Council adopted motions to confirm nuisance‑abatement liens for 13 properties, each passing with a 15‑0 vote. One lien (16053 West Victory Boulevard) was not confirmed but continued for further consideration on June 6, 2025. All confirmations were recorded as motions by Harris‑Dawson and Hernandez.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Adopted Item
81 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
The other 30 items passed by unanimous or near-unanimous consent.
Wed May 7, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to review police permits and grant awards

The Public Safety Committee will review reports on police permit regulations, grant awards for security initiatives, and a proposed fee increase for emergency ambulance services. The committee will also discuss the disposal of recreational vehicles in police garages.

policefirebudgetgrantsfeessafetypublic-safety
Notable items
Tue May 6, 2025 · 10:00 AM

City Council Meeting

Council to hear nuisance abatement protest for 728 South Hartford Avenue

The City Council will conduct a public hearing regarding a property at 728 South Hartford Avenue. The body will consider protests, appeals, or objections to a Building and Safety Department report concerning nuisance abatement costs and code violations.

code-enforcementpublic-hearingnuisance-abatement
✓ Decided: Council confirmed and continued multiple nuisance abatement liens citywide

The Los Angeles City Council adopted motions to confirm nuisance‑abatement liens for several properties and postponed further action on others until May 20, 2025. All votes were unanimous with no dissent. The actions affect properties on Hartford Avenue, Pico Boulevard, Gardner Street, and others.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) Adopted Motion (Harris-Dawson – Hernandez) - SEE ATTACHED
39 yea · 3 absent · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hutt absent · Nazarian yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hutt absent · Nazarian yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hutt absent · Nazarian yea · Tuesday - May nay
[context] Community Impact Statement: None submitted Adopted Item
36 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted (Trade, Travel and Tourism Committee Report adopted at the Council meeting of April 29, 2025) Adopted Item
10 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
The other 30 items passed by unanimous or near-unanimous consent.
Tue May 6, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee to discuss wage ordinances and fund reallocations for various projects

The Economic Development and Jobs Committee will consider ordinances to increase wages and benefits for hotel and airport workers, as well as motions to redirect funding for specific community projects like the Pio Pico Library Park and school safety initiatives.

wageshousingbudgettransportationlibraryeducationairporthotel
Notable items
Tue May 6, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers ordinance to halt oil‑well acid maintenance

The Energy and Environment Committee will hear a motion to adopt an interim control ordinance that would stop oil‑well acid maintenance practices. It will also review reports on Los Angeles River maintenance contracts, the Watts Civic Center Serenity Greenway project and Measure W projects, a lease for a customer service center at 931 North Avalon Boulevard, and federal clean‑energy tax credits. Additional items include a security upgrade ordinance for electrical substations and a possible closed‑session recess to discuss pending litigation.

energyenvironmentwaterpowersanitationoil-wellordinance
Notable items
Tue May 6, 2025 · 08:30 AM

Government Operations Committee

Committee to discuss cannabis fees and fiber-optic network construction

The Government Operations Committee will review reports on cannabis regulation fees and a proposed ordinance regarding cannabis business taxes. The body will also consider a motion to build a 13.3-mile fiber-optic network along the Highway 110 Corridor.

cannabisinfrastructurebudgetpublic-healthreal-estate
✓ Decided: Committee approves fiber‑optic network funding and multiple city facility agreements

The Government Operations Committee approved a motion to let the Bureau of Street Lighting receive state funds for a 13.3‑mile fiber‑optic network along Highway 110. It also approved a cannabis tax ordinance, a jurisdiction transfer of an alley, and several Municipal Facilities Committee reports authorizing leases and a farmer’s market. All approvals were recorded with vote tallies; one item received no action.

Room 401
Notable items
Mon May 5, 2025 · 10:00 AM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee reviews Mayor's 2025‑26 proposed budget

The Los Angeles Budget and Finance Committee will consider the Mayor's 2025‑26 proposed budget. Members will review memos and answer questions from general managers for various city departments. The Chief Legislative Analyst will report on proposed changes to the budget on May 16. Public comment will be taken in‑person only.

budgetfinancecity-governmentpublic-commentmeeting
Notable items
Fri May 2, 2025 · 10:00 AM

City Council Meeting

City Council to consider nuisance abatement lien protest

The City Council will meet to conduct business, including a continued consideration of a hearing protest regarding a lien for nuisance abatement costs and code violations. The agenda otherwise consists of procedural boilerplate and standard meeting rules.

nuisance-abatementcode-violationspublic-hearings
✓ Decided: Council confirmed two nuisance liens and adopted several legislative position notes

The council voted unanimously (14‑0, Raman absent) to confirm a $1,276.56 lien for 6851 North Cedros Avenue and a $3,813.75 lien for 132 West 109th Place. It also unanimously adopted note‑and‑file resolutions supporting a series of state and federal bills, including AB 1775, SB 1170, the Adoptee Citizenship Act, SB 1137 opposition, SB 1255, and AB 1990. Additionally, the council recommended that the mayor accept a $311,470 Family Justice Center grant, pending mayoral approval.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) (Continued from Council meeting of April 1, 2025) Adopted Item as Amended by Motion 1A (Padilla – Price) - SEE ATTACHED
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] (Lien: $3,813.75) (Continued from Council meeting of April 1, 2025) Adopted Item as Amended by Motion 2A (Harris-Dawson – Soto-Martinez) - SEE ATTACHED
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Adopted Item
53 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Friday - May yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes Against: Sunland-Tujunga Neighborhood Council Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Resolution 8606 (Carter), the Never Again Education Reauthorization and Study Act of 2024, which would reauthorize an appropriation for the Director of the United States Holocaust Memorial Museum…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Westside Neighborhood Council Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: Yes For: Studio City Neighborhood Council Sunland Tujunga Neighborhood Council Westside Neighborhood Council Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the acceptance of the grant and the recommendations in the above-mentioned report are in compliance with the City’s Financial Policies in that all grant- eligible costs are fully covered by…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Fri May 2, 2025 · 01:00 PM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee reviews Mayor’s 2025‑26 proposed budget

The Budget and Finance Committee will meet on May 2, 5, 8, and 16, 2025 to consider the Mayor’s 2025‑26 Proposed Budget. Members will review memos and hear questions from general managers for a range of city departments, including Public Works, Recreation and Parks, Water and Power, and others. The committee will also accept in‑person public comment with Spanish interpretation and additional language services available on request.

budgetingfinancecity-governmentpublic-commentinterpretationmayor-budget
Fri May 2, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging, and Disability Committee

Committee to review CVS Health penalty and grant for senior nutrition program

The Civil Rights, Equity, Immigration, Aging, and Disability Committee will discuss a penalty payment from CVS Health Corporation and the transition of a senior farmers market program to electronic benefits. The body will also consider reprogramming Community Development Block Grant funds for various projects.

civil-rightssenior-servicesgrantsappointmentscommunity-development
✓ Decided: Committee approved grant to move Senior Farmers Market Nutrition Program to e‑benefit cards

The committee approved five agenda items. It adopted a mayoral communication appointing Ana Karen Estrada to the Commission on the Status of Women. It approved a grant to transition the Senior Farmers Market Nutrition Program to electronic benefit cards. It also approved reprogramming of CDBG funds, a Community Investment for Families report amendment, and a CVS Health penalty settlement.

Room 401
Thu May 1, 2025 · 09:00 AM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee will review the Mayor’s 2025‑26 Proposed Budget

The committee will consider the Mayor’s proposed 2025‑26 budget over several days in May. Each session includes memo reviews and discussion of specific department allocations such as homeless services, public works, and transportation. Public comment will be taken in‑person only, with live broadcast and interpretation available. The final meeting on May 16 will feature a report on proposed budget changes.

budgetfinancehousingpublic-workstransportationcity-services
Notable items
Wed Apr 30, 2025 · 01:00 PM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee to review Mayor's 2025-26 Proposed Budget

The Budget and Finance Committee is holding a series of special meetings from April 30 to May 16, 2025. The body will consider the Mayor's 2025-26 Proposed Budget through memo reviews and department head questioning.

budgetpublic-safetyhousinginfrastructurecity-government
Notable items
Wed Apr 30, 2025 · 10:00 AM

City Council Meeting

Council to consider dedication of easement on 5300 Beethoven St for storm drain

The Los Angeles City Council will hold routine business such as roll call, approval of minutes, and commendatory resolutions. The primary agenda item is a categorical exemption and dedication of an easement for storm‑drain purposes on 5300 Beethoven Street (Right of Way No. 36000-10309). Council members will vote on the recommendation to find the dedication categorical.

easementstorm-draincity-engineerpublic-hearingcouncil-procedures
✓ Decided: Council adopts zone change for North De Soto Ave self-storage project

The Los Angeles City Council approved a zone change for 9129, 9143, and 9145 North De Soto Avenue, allowing four self‑storage buildings. It also approved a categorical exemption and easement dedication for 5300 North Beethoven Street, directed a vision plan for Sheldon Skatepark, and ordered the Animal Services Department to report on kennel cleaning procedures. The council directed a pilot program on pet microchip education and approved the William Mellenthin Birdhouse Apartments as a historic‑cultural monument. Finally, it authorized the Department of City Planning to amend contracts for historic preservation studies.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
140 yea · 8 nay
Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Martínez nay · Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Martínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto- Martínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea
[context] 1 and 3 of Amendment 18A (Lee – Park)6(($77$&+('
10 yea · 5 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Lee nay · Nazarian nay · Park nay · Yaroslavsky nay · Soto-Mart ínez nay
ORDINANCE SECOND CONSIDERATION relative to amending the Los Angeles Municipal Code (LAMC) to update the approval process for metal plaques, plates, or individual letters or figures on a sidewalk…
11 yea · 1 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Yaroslavsky yea · Padilla nay
The other 27 items passed by unanimous or near-unanimous consent.
Tue Apr 29, 2025 · 10:00 AM

City Council Meeting

Council to hear alcohol sale application for Sakura Market

The Los Angeles City Council will hold a public hearing regarding an application for the sale of alcoholic beverages for off-site consumption. The request concerns Sakura Market located at 2632 East Cesar E Chavez Avenue.

alcohol-salespublic-hearingbusiness-licensing
✓ Decided: Council approved $425 million extension of Letter of Credit facilities for MICLA CP program

The City Council unanimously adopted authorizing resolutions to extend Letter of Credit facilities totaling $425 million for the MICLA lease‑revenue commercial paper program and an additional $100 million for the Convention Center portion. The Council also approved $26.3 million in multifamily housing revenue bonds for the 78‑unit Westlake Apartments project. Additional actions included continuing a liquor‑sale application, requesting utility maps from LADWP, and approving disaster‑relief donations for animal services.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 10 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
121 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted Adopted Item
79 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Tuesday - April nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea
Ordinance held over to May 6, 2025 for second consideration
12 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hernandez nay · Jurado nay
to adopt the Transportation Committee Report - SEE ATTACHED
32 yea · 10 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Raman nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Mart​ínez nay
[context] Community Impact Statement: None submitted Adopted Item Tuesday - April 29, 2025 - PAGE 37
11 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto- Mart​ínez nay
that the recommendations in the report are in compliance with the City's Financial Policies in that, to the extent possible, all grant funds will be utilized for grant-eligible activities. Community…
13 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hernandez nay
that the recommendations provided in the report are in compliance with the City’s Financial Policies in that one-time grant funding will be utilized for one-time program expenditures. Community…
12 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay
that the recommendations in the report comply with the City’s Financial Policies in that one-time grant funding will be utilized for one-time program expenditures. Community Impact Statement: None…
12 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay
that the recommendations provided in the report comply with the City’s Financial Policies in that one-time grant funding will be utilized for one-time program expenditures. Community Impact…
12 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · Hernandez nay · Soto-Mart​ ínez nay
[context] Community Impact Statement: None submitted Tuesday - April 29, 2025 - PAGE 48 (Public Safety Committee waived consideration of the above matter) Adopted Item
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Hernandez nay
The other 24 items passed by unanimous or near-unanimous consent.
Tue Apr 29, 2025 · 01:00 PM

Budget Hearings (Full Agenda Available on PDF)

Budget and Finance Committee to review Mayor's 2025-26 Proposed Budget

The Budget and Finance Committee is holding a series of special meetings from April 29 to May 16, 2025. The body will discuss the Mayor's 2025-26 Proposed Budget, including revenue, personnel, and departmental allocations.

budgetfinancepublic-safetyhomelessnesspersonnel
Mon Apr 28, 2025 · 04:00 PM

Budget Hearings (Full Agenda Available on PDF)

Budget Committee will review the Mayor’s 2025‑26 proposed budget

The Budget and Finance Committee will consider the Mayor’s proposed 2025‑26 city budget over a series of meetings from April 28 to May 16, 2025. Each session includes presentations, memo reviews, and public comment on various city departments and programs. The committee will hear from the Mayor’s Office, the City Administrative Officer, and department heads on revenue, capital projects, and service budgets. No final decisions are indicated in this agenda.

budgetfinancecity-governmentpublic-commentmayordepartments
Fri Apr 25, 2025 · 01:00 PM

Budget Hearings

Consideration of the Mayor’s 2025‑26 Proposed Budget by the Budget & Finance Committee

The Budget and Finance Committee will review the Mayor’s 2025‑26 Proposed Budget over a series of meetings from April 25 to May 16, 2025. Sessions include chair comments, public comment, presentations by the Mayor’s Office and City Administrative Officer, and memo reviews of departmental budget items. The committee will also hear a report from the Chief Legislative Analyst on proposed budget changes.

budgetfinancecity-governmentpublic-commentmayoral-budget
Fri Apr 25, 2025 · 10:00 AM

City Council Meeting

Council considers up to $12 million bond for Japanese American National Museum

The Los Angeles City Council will discuss a motion and resolution to issue bonds not exceeding $12,000,000. The funds would finance, refinance, construct, improve, install, furnish, and equip museum and ancillary facilities for the Japanese American National Museum. The project is located at 100 North Central Avenue in Council District 14.

bondsfinancemuseumdistrict-14construction
✓ Decided: Council approved up to $12 million in bonds for Japanese American National Museum project

The City Council authorized the California Enterprise Development Authority to issue bonds not exceeding $12 million to finance the Japanese American National Museum facilities. The Council also created an Advisory Group on the City’s finances and budget. Several reports were noted and filed, including an aviary sanctuary report, a housing authority appointment, a building‑safety notice, and transportation‑related studies.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: Yes For: Palms Neighborhood Council Friday - April 25, 2025 - PAGE 9 Adopted Item
10 yea · 1 nay
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Park yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay
The other 11 items passed by unanimous or near-unanimous consent.
Fri Apr 25, 2025 · 01:00 PM

Budget Hearings - Complete Schedule

Budget and Finance Committee will consider the Mayor's 2025‑26 Proposed Budget

The committee will review the Mayor's proposed 2025‑26 budget over several meetings in April and May 2025. Members will hear chair comments, presentations, and public comment on the budget items. Various city departments will present budget memos and the Chief Legislative Analyst will report proposed changes. Public comment is limited to in‑person participation.

budgetfinancepublic-hearingcity-governmentpolicy
Wed Apr 23, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to review homelessness funding and housing contracts

The Housing and Homelessness Committee will review status reports and funding recommendations for the Homelessness Emergency Account. The body is also considering lease agreements, federal grant allocations, and strategies to prevent homelessness for voucher holders.

homelessnessaffordable-housingfederal-grantseviction-defensehousing-vouchers
✓ Decided: Committee approved new lease for A Bridge Home site at 1920 West 3rd St

The Housing and Homelessness Committee approved several reports and motions, including a new lease agreement for the A Bridge Home site (Casa Azul) at 1920 West 3rd Street. All items were adopted with unanimous three‑member votes. No items were denied or tabled.

Notable items
Wed Apr 23, 2025 · 03:30 PM

Public Works Committee

Committee will consider street vacation proposals for Bellanca Ave and Pacific View Drive

The Public Works Committee will hear a verbal update from the Department of Public Works on the proposed 2025‑26 budget. It will review the final Environmental Impact Statement and City Engineer report for the vacation of Bellanca Avenue from Arbor Vitae Street to its southern terminus. The committee will also consider a motion on contracting opportunities for January 2025 fire‑recovery work and a City Engineer report on vacating the easterly portion of Pacific View Drive.

budgetenvironmental-impactstreet-vacationpublic-workscontracting
Notable items
Wed Apr 23, 2025 · 08:30 AM

Transportation Committee

Committee will consider 15 mph school‑zone speed limits and several parking measures.

The Transportation Committee will review reports on grant applications, bus driver safety, and crime statistics. It will discuss and potentially adopt resolutions establishing oversize‑vehicle parking restrictions, "No Stopping Anytime" signs, and a 15 mph speed limit in school zones covering 343 street segments near 201 schools. The meeting also includes a motion to reassign two crossing guards and a proposal for a temporary preferential parking district in the Pico neighborhood.

transportationsafetyspeed-limitsparkinggrantsschools
✓ Decided: Approved 15‑mph speed limits on 343 street segments near schools

The Transportation Committee approved a series of reports and motions, including a resolution to set 15‑mph speed limits in school zones on 343 street segments adjacent to 201 schools. It also approved a motion reassigning two crossing guards, a resolution to post “No Stopping Anytime” signs on Little Canoga Avenue, and several grant‑related reports. All items passed unanimously with a 3‑0 vote.

401
Notable items
Wed Apr 23, 2025 · 08:30 AM

Government Operations Committee

Committee to review city facility leases and cannabis fees

The Government Operations Committee will consider renewing or authorizing several agreements for the use of city-owned properties, including community gardens, a police credit union branch, and a parking lot for the Los Angeles Philharmonic. The body will also discuss the costs of city office leases and a proposed cannabis regulatory fee study.

cannabiscity-leasescommunity-gardensparkspolicetransportationbudget
✓ Decided: Committee approved lease for city parking lot at Sylmar/San Fernando Metrolink Station

The Government Operations Committee approved eight Municipal Facilities Committee reports and one motion, each passing with a 2‑1 vote (Jurado absent). Approvals include license agreements for community gardens, a public plaza, co‑working space seats, banking services for the police department, and a lease with the Los Angeles Philharmonic for a parking lot at the Sylmar/San Fernando Metrolink Station. All items were recorded as approved on April 23, 2025.

Room 340
Notable items
Wed Apr 23, 2025 · 10:00 AM

City Council Meeting

Council to consider dedicating an easement on 9606 Bellanca Avenue

The Los Angeles City Council will vote on a categorical exemption and dedication of a street easement at 9606 Bellanca Avenue (Right‑of‑Way No. 36000‑10262). The item is listed as agenda number 25‑0386 for Council District 11. The council will also conduct routine business such as roll call, approval of minutes, and public comment.

zoningpublic-hearingscity-councileasementprocedural
✓ Decided: Council allocates $100,000 for wildfire debris testing in Sunshine Canyon

The council approved two categorical exemptions to dedicate easements for street use at 9606 Bellanca Avenue and on Aviation Boulevard south of 96th Street, with no additional city funds required. It adopted a series of directives for the January 2025 wildfire recovery, directing multiple departments to report on recovery plans, land surveys, and environmental protections. The council also resolved to appropriate $100,000 from the Sunshine Canyon Community Amenities Trust Fund for a debris‑testing plan. All actions were adopted unanimously.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Ordinance held over to April 30, 2025 for second consideration
10 yea · 1 nay
Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Mart​ínez yea · Yaroslavsky yea · Padilla nay
The other 29 items passed by unanimous or near-unanimous consent.
Tue Apr 22, 2025 · 02:00 PM

Planning and Land Use Management Committee

Approval of mixed-use project at Sunset Blvd and Vine St

The Planning and Land Use Management Committee will review several reports and appeals, including a status update on the Warner Center 2035 Specific Plan, an environmental assessment and appeal for a mixed‑use development at 6266‑6290 Sunset Boulevard and 1460‑1480 Vine Street, and CEQA categorical exemptions for residential projects at 1459 South Hi Point Street and 504 West Avenue 44. The committee will also consider an appeal concerning a Vesting Tentative Tract Map for Oakdale Avenue. Findings and recommendations may be adopted at this meeting.

zoninghousingenvironmentceqadevelopmentmixed-useplanning
✓ Decided: Committee denied appeal and sustained LACPC decision on 201,134‑sq‑ft mixed‑use project

The committee approved the Los Angeles City Planning Commission report for the Warner Center 2035 Specific Plan (5‑0). It denied appeals and sustained the Planning Commission determinations for four separate projects, including a 201,134‑sq‑ft mixed‑use development, a CEQA exemption at 1459 South Hi Point Street, a two‑story single‑family dwelling at 504 West Avenue 44, and the Oakdale Estates project at 5300 North Oakdale Avenue (each 5‑0). The committee also approved the Modified Conditions of Approval for the Oakdale Estates project (5‑0).

Notable items
Tue Apr 22, 2025 · 02:00 PM

Trade, Travel, and Tourism Committee

Committee reviews ordinance to establish Los Angeles Harbor Port Police Reserve Corps

The Trade, Travel, and Tourism Committee will discuss several reports and motions, including updates from the Port of Los Angeles and Los Angeles World Airports. A draft ordinance to amend the Los Angeles Administrative Code and formally create a Harbor Department Port Police Reserve Corps will be considered. Additional items include motions on departmental reforms and requests for executive reports on the Goods Movement Training Campus. Public comment will be taken in person only.

harborpoliceordinanceairportcontractsbondstrade-travel-tourism
Notable items
Tue Apr 22, 2025 · 10:00 AM

City Council Meeting

Council to consider alcohol sale application for Cali Market

The Los Angeles City Council will meet to conduct business and hear public comments. The primary item for consideration is a determination of public convenience or necessity regarding alcohol sales at a specific business.

alcohol-salespublic-hearingbusiness-licensing
✓ Decided: Council adopted ordinances setting June 24 hearings for multiple street lighting districts

The Los Angeles City Council adopted reports and ordinances of intention for several street lighting districts, establishing June 24, 2025 as the hearing date for each and creating annual assessment fees. The council also continued consideration of an off‑site alcohol sales application for Cali Market to April 29, 2025, and adopted an amended motion on Gelson's Market alcohol sales application. All street‑lighting votes were 13‑0 with two members absent; the Cali Market vote was 12‑0 with three absent, and the Gelson's vote was 13‑0 with two absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: Yes For: North Hollywood Northeast Neighborhood Council Amending Motion 27A (Park – Lee) – Failed of Adoption - SEE ATTACHED
8 nay · 4 yea · 1 absent
Harris-Dawson yea · Lee yea · Nazarian yea · Park yea · Blumenfield nay · Hernandez nay · Jurado nay · Hutt nay · Price Jr nay · Raman nay · Soto-Mart​ínez nay · Yaroslavsky nay · Padilla absent
[context] Adopted Item
34 yea · 2 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Yaroslavsky yea · Raman nay · Soto-Mart​ínez nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea
that the subdivider has paid a fee of $9,064 for the processing of this final parcel map pursuant to Section 19.02(B)(3) of the Los Angeles Municipal Code. No additional City funds are needed…
12 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Tuesday - April nay
The other 42 items passed by unanimous or near-unanimous consent.
Mon Apr 21, 2025 · 10:00 AM

Ad Hoc Committee for LA Recovery

Committee considers state aid request for Pacific Palisades Fire recovery

The Ad Hoc Committee for LA Recovery will hear multiple reports on infrastructure, animal services, and utility impacts from the January 2025 wildfires. It will review a contract with IEM International for technical assistance and accept donations and grants for disaster relief. A resolution will be considered to request temporary financial assistance from the State of California for the Pacific Palisades Fire, with repayment expected from the federal government.

wildfire-recoveryinfrastructurecontractsdonationsstate-aidpublic-safety
✓ Decided: Committee approved a resolution seeking state aid after the Pacific Palisades fire

The Ad Hoc Committee for LA Recovery approved several items. An amendment on infrastructure reports was approved unanimously (5 Yes). The committee also approved acceptance of a $40,000 donation from the LA Chargers and a $50,000 grant from PetSmart Charities, each with a 4‑Yes vote and Councilmember Nazarian absent. A resolution requesting temporary state financial assistance for the Pacific Palisades fire was approved (4 Yes, 1 absent). Finally, a motion on utility mapping and tiered undergrounding of powerlines was approved (4 Yes, 1 absent).

Room 401
Notable items
Mon Apr 21, 2025 · 03:00 PM

Government Efficiency, Innovation, and Audits Committee - Special

Committee reviews motions on office lease resources and legal case spending

The Government Efficiency, Innovation, and Audits Committee will consider two motions: one addressing the use of city resources for office leases, workspace, and at‑home equipment (Motion 25-0357), and another examining expenditures and outcomes of legal cases handled by outside counsel versus City Attorney staff (Motion 25-0192). The meeting also includes eight Innovation Fund reports on pilot projects for various city departments.

budgetlegalinnovation-fundcity-resourcespublic-safetysanitation
✓ Decided: Committee approved a motion to analyze legal case costs and outcomes.

The Government Efficiency, Innovation, and Audits Committee noted and filed several City Administrative Officer reports and approved additional recommendations for Innovation Fund pilot projects. The committee also approved a motion to analyze expenditures and outcomes of legal cases handled by outside counsel versus City Attorney staff. Councilmember McOsker was absent for each vote.

401
Mon Apr 14, 2025 · 06:00 PM

Los Angeles City Health Commission

Commission to consider action on silicosis epidemic and engineered stone health risks

The City Health Commission will hear two presentations on the recent silicosis outbreak linked to engineered stone and on Cal/OSHA regulations addressing the issue. Commissioners will review the draft 2024 Annual Report and may take action based on the presentations and report. The meeting also includes routine approvals of minutes and public comment periods.

healthsilicosisoccupational-safetypublic-commentannual-report
Fri Apr 11, 2025 · 08:30 AM

Personnel and Hiring Committee

Mayor appoints Carlton Jenkins to Fire & Police Pension Board

The Personnel and Hiring Committee will hear communications from the Mayor about two key appointments: Carlton Jenkins to the Board of Fire and Police Pension Commissioners and Malaika Billups as permanent General Manager of the Personnel Department. The committee will also review reports on hiring benchmarks for the Targeted Local Hiring and Strategic Workforce Development Task Force, fund transfers for a Materials Testing Technician pilot program, and payroll issues affecting the Los Angeles Fire Department's Workday system. Public comment will be taken in‑person only, and the meeting includes several items referred to other committees for further action.

personnelhiringappointmentspensionsworkforceairportpayroll
✓ Decided: Approved fund transfers for Materials Testing Technician pilot program

The Personnel and Hiring Committee approved several reports and motions. It noted and filed the fire‑and‑police pension annual report and the targeted local hiring benchmark report. It approved as amended a fund‑transfer motion for a Materials Testing Technician pilot program, and approved reports on sole‑source contracts for homelessness services, a Community Oriented Policing Services grant, three new positions for the Van Nuys Airport plan, and recruitment practices for the Pacific Palisades reconstruction.

Room 401
Notable items
Fri Apr 11, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee to discuss City Council rule changes and new financial advisory group

The Rules, Elections and Intergovernmental Relations Committee will consider changes to City Council rules and the creation of an Advisory Group on the City's Finances and Budget. The body will also review various positions on state and federal legislative programs.

city-council-rulesbudgetlegislative-programredistrictingpublic-safety
Notable items
Fri Apr 11, 2025 · 10:00 AM

City Council Meeting

Council considers historic status for Maycrest Bungalow Court

The Los Angeles City Council will discuss the appointment of a permanent Personnel Department General Manager and the designation of a historic monument. The body is also reviewing proposed rate actions for the Solid Resources Program and a hazardous waste management contract for the LAFD.

historic-preservationappointmentswaste-managementpublic-safetyfees
✓ Decided: Council approves 10% Port of LA parking rate hike and ratifies local emergency

The council adopted several committee reports, disapproved a hazardous‑waste contract with Clean Harbors, and approved a report to raise parking rates at the Port of Los Angeles, with the ordinance set for further consideration. It also adopted a resolution that ratifies the mayor’s local emergency declaration and suspends competitive‑bidding rules for emergency purchases. All actions were taken with unanimous or near‑unanimous votes where recorded.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Visit www.lacouncilfile.com for background documents.) (Budget, and Finance and Innovation*…
9 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Price Jr yea · Raman yea · Soto-Mart​ínez yea · Yaroslavsky yea · Nazarian nay
The other 6 items passed by unanimous or near-unanimous consent.
Fri Apr 11, 2025 · 01:00 PM

Ad Hoc Committee on Unarmed Crisis Prevention, Intervention, and Community Services

Committee orders city departments to report on crisis‑worker training workshops

The Ad Hoc Committee will consider Motion 25‑0358, directing the Civil + Human Rights and Equity Department and the Youth Development Department to prepare a report on strategies and steps for co‑sponsoring workshops that educate pathways to become crisis workers for outreach to homeless individuals and unarmed crisis response teams. The Committee will also hear a verbal report from Los Angeles County on its Alternate Crisis Response Program and how it coordinates with the City’s Unarmed Model of Crisis Response (UMCR) and Community‑Led Engagement (CIRCLE) programs. No formal action beyond the report request is indicated.

crisis-responsetraininghomelessnesscity-departmentsla-countypublic-comment
Wed Apr 9, 2025 · 08:30 AM

Transportation Committee

Transportation Committee reviews multiple DOT reports and resolutions

The committee will consider eight agenda items, including a resolution to install red curbs on Inglewood Boulevard and several Los Angeles Department of Transportation reports on transit funding, pedestrian improvements, speed‑safety programs, and vehicle parking restrictions. Some items have fiscal impact statements and community impact statements, and several are referred to other committees for further action.

transportationbudgetpedestrian-safetyparkinginfrastructure
✓ Decided: Council approved red curbs and no‑stopping signage on Inglewood Blvd

The Transportation Committee approved a resolution to install red curbs and “No Stopping Anytime” signage along Inglewood Boulevard between Bray Street and Hammack Street, passing 2‑1. Several Department of Transportation reports were also approved or noted, including the Low Carbon Transit Operations Program report and the Mobility Plan 2035 report. A resolution establishing oversize‑vehicle parking restrictions on Western Avenue was approved 2‑1. Other items were noted without action.

Notable items
Wed Apr 9, 2025 · 10:00 AM

City Council Meeting

Council to consider establishing Los Angeles Tourism Marketing District

The City Council will hold a hearing on protests and consider an ordinance to establish the Los Angeles Tourism Marketing District. This would involve assessments on lodging businesses with 50 or more rooms. Additionally, the Council will discuss expanding fiber optic infrastructure in JEDI Zones.

tourismtaxesinfrastructureeconomic-developmentfiber-optics
✓ Decided: Council approved the Los Angeles Tourism Marketing District ordinance and related debt

The City Council adopted the ordinance establishing the Los Angeles Tourism Marketing District, authorizing $14,712,568 in new debt. It also approved a lease for a Tiny Home Village at 5301 Sierra Vista Avenue and a $10,000 fund transfer for supplemental charter‑bus services in District 12. Several Economic Development and Jobs Committee reports were adopted after multiple amendments.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
13 yea · 2 nay · 2 absent
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea · Blumenfield nay · Rodriguez nay · Harris-Dawson) SEE ATTACHED absent · Wednesday -April yea · Price) absent
[context] (This matter arises from the June 30, 2021, incident in which the Los Angeles Police Department Bomb Squad detonated explosive material.) (Budget and Finance Committee considered this…
42 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Wednesday -April nay · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
The other 8 items passed by unanimous or near-unanimous consent.
Wed Apr 9, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee to discuss affordable housing funding and homeless service updates

The Housing and Homelessness Committee will review financial commitments for affordable housing projects and a state grant for the Micro Operational Reserve Replenishment Program. The body will also receive updates on the CARE/CARE+ program and strategies for Time Limited Subsidies.

affordable-housinghomelessnessgrantshousing-authority
✓ Decided: Committee approved three reports and a mayoral filing, each 2‑0 vote

The Committee took no action on the discussion item about the FY 2024‑25 CARE/CARE+ program. It received and filed a communication from the Mayor withdrawing Rafael Aguilar. The City Administrative Officer report (amended) was approved. An amendment to the Homeless Services Authority report and a revised Housing Department report were also approved.

Notable items
Wed Apr 9, 2025 · 02:30 PM

Special Public Works Committee Meeting and Special Joint Public Works and Energy and Environment Committee Meeting

Committees to discuss Solid Resources Program rate action

The Public Works and Energy and Environment Committees are meeting to discuss several infrastructure and administrative matters. Key items include proposed rate changes for the Solid Resources Program and funding for transit shelter installations.

sanitationfeestransitstreet-lightingpublic-works
Tue Apr 8, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to discuss park projects, animal services grants, and zoo governance

The Arts, Parks, Libraries, and Community Enrichment Committee will consider several grant applications for animal adoptions and aquatics programming. The body will also discuss park infrastructure projects and updates to the Los Angeles Administrative Code regarding the Board of Zoo Commissioners.

parksanimal-servicesgrantsinfrastructurezoopublic-health
✓ Decided: Committee approved ordinance for County Public Health to collect hospital debt data (3‑0)

The Arts, Parks, Libraries, and Community Enrichment Committee approved eleven items. All reports and motions were adopted unanimously with three votes in favor and none against. Notable approvals included a grant for fee‑waived pet adoptions, a non‑exclusive easement in MacArthur Park, and a motion directing the County Department of Public Health to collect and publish hospital debt‑collection data. The committee also approved a vision plan for Sheldon Skatepark and updates to the Los Angeles Zoo administrative code.

Notable items
Tue Apr 8, 2025 · 10:00 AM

City Council Meeting

Council to consider confirming a $3,970.06 lien for nuisance abatement at 22113 West Cantlay Street

The Los Angeles City Council will hear protests, appeals, or objections and decide whether to confirm a proposed lien of $3,970.06 for nuisance‑abatement costs at 22113 West Cantlay Street. The Council will also consider a similar lien of $386.16 for 2302 South Virginia Road, a public‑convenience application for off‑site alcohol sales at Cali Market on West Venice Boulevard, and a categorical exemption to terminate a covenant for a parking area at 19681 South Pacific Gateway. These items will be voted on after public comment periods.

liensnuisance-abatementpublic-conveniencealcohol-salesparkingcovenant
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Apr 8, 2025 · 12:00 PM

Economic Development and Jobs Committee

Committee to discuss Los Angeles Convention Center construction options

The Economic Development and Jobs Committee will review a joint report from the City Administrative Officer and Chief Legislative Analyst. The discussion focuses on options for starting construction on the Los Angeles Convention Center Expansion and Modernization Project in 2025.

economic-developmentconvention-centerconstructioninfrastructure
Notable items
Tue Apr 8, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee considers $8.78 million funding for BuildLA consultant services

The Planning and Land Use Management Committee will hear a status report from the Director of Planning and consider several project proposals, including a denied appeal for the Oakdale Estates development. It will vote on a contract amendment that raises the maximum compensation for historic preservation consultants to $3.2 million and on a draft ordinance to change zoning for a self‑storage project on North De Soto Avenue. The committee will also allocate $8,782,000 from the Development Services Trust Fund to continue BuildLA consultant services.

zoningcontractsfinancedevelopmenthistoricenvironmentalhousing
✓ Decided: Committee approved $8.78 million BuildLA consultant funding

The committee approved a $8,782,000 allocation from the Development Services Trust Fund to continue consultant services for the BuildLA project. It also approved a contract amendment raising compensation for historic‑preservation consultants to $3.2 million and a zoning change for new self‑storage facilities on North De Soto Avenue. Additionally, the committee rescinded a prior cell‑tower approval at 1731 West Colorado Boulevard and ordered a new public hearing. Several cultural‑heritage designations and CEQA exemptions were also approved.

Notable items
Fri Apr 4, 2025 · 10:00 AM

City Council Meeting

Council to consider naloxone distribution pilot funded by opioid settlement

The Los Angeles City Council will discuss three committee reports. One directs the Chief Legislative Analyst to report on a pilot program for distributing naloxone in South Los Angeles using opioid settlement funds. The other two request reports on invasive plant removal in the Sepulveda Basin and on fire department compliance with IAFF Standards of Cover. No financial analyses have been completed for these items.

public-healthenvironmentpublic-safetycity-councilreports
✓ Decided: Council directs reports on naloxone pilot, invasive plant removal, and fire standards

The City Council adopted three motions directing city staff to prepare reports. The Chief Legislative Analyst will report on a South Los Angeles naloxone distribution pilot funded by opioid settlement money. The Department of Recreation and Parks and the Bureau of Engineering will report a work plan for invasive plant removal in the Sepulveda Basin within 60 days. The Fire Department and City Administrative Officer will report on IAFF Standards of Cover compliance and potential funding for fire‑station restoration.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted
9 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea
[context] Community Impact Statement: None submitted Adopted Item as Amended by Motion 2A (Padilla - Rodriguez) - SEE ATTACHED
9 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Rodrigu ez yea · Soto-Martinez yea
[context] Community Impact Statement: Yes For: Downtown Los Angeles Neighborhood Council Northwest San Pedro Neighborhood Council Wilmington Neighborhood Council
9 yea
Harris-Dawson yea · Hernandez yea · Hutt yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea
Wed Apr 2, 2025 · 08:30 AM

Public Works Committee

Public Works Committee to receive street lighting and services updates

The Public Works Committee will hold a special meeting to receive verbal reports from two city bureaus. The body will discuss updates regarding the policies and programs of the Bureau of Street Lighting and the Bureau of Street Services.

street-lightingstreet-servicespublic-works
Wed Apr 2, 2025 · 10:00 AM

City Council Meeting

City Council to hear protests on nuisance abatement liens

The Los Angeles City Council will hold public hearings to hear protests, appeals, or objections regarding proposed liens for nuisance abatement and code violations. The Council will consider confirming these liens for several specific properties.

nuisance-abatementcode-violationspublic-hearingsliens
✓ Decided: Council approves $2.85 M settlement in police tort case

The council adopted a recommendation to settle the John Sylvester Penny police tort lawsuit with up to $2.85 million. It also confirmed several Building and Safety liens for properties on North Figueroa Street, Lankershim Boulevard, West Runnymede Street, South Potomac Avenue, and South Carmona Avenue. Multiple amending motions were adopted, while one amendment failed.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Amending Motion 288 (Blumenfield - Park) - Failed of Adoption - SEE ATTACHED
8 nay · 7 yea
Blumenfield yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Harris-Dawson nay · Hernandez nay · Jurado nay · Hutt nay · Price Jr nay · Raman nay · Soto-Martinez nay · Wednesday -April nay · Yaroslavsky yea
The other 7 items passed by unanimous or near-unanimous consent.
Wed Apr 2, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers extending ADU Accelerator program and amending ONEgeneration contract

The Housing and Homelessness Committee will hear a verbal update on Measure ULA revenue and expenditures. It will consider a motion to extend the Accessory Dwelling Unit Accelerator Program and amend the contract with ONEgeneration for rental assistance processing. Additional reports include a building safety compliance issue, a loan increase for accessibility retrofits at 8740‑8750 South Vermont Avenue, and a motion to identify a parcel in District 12 for further housing interventions.

housinghomelessnessadufinancedevelopmentaccessibilityzoning
✓ Decided: Committee approved extension of ADU Accelerator Program and related contract amendment

The committee approved the City Administrative Officer’s report and a motion to extend the Accessory Dwelling Unit Accelerator Program and amend the ONEgeneration contract. The Los Angeles Housing Department’s report to increase the maximum loan for accessibility retrofits at a South Vermont Avenue project was also approved. A motion to identify a parcel in Council District 12 for additional housing interventions was approved. The Department of Building and Safety report was noted and filed, and a verbal update on Measure ULA resulted in no action.

Notable items
Wed Apr 2, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee to review grants and fire safety measures

The Committee will discuss police reports on gun buybacks and transit crime, and consider several grant acceptances. Members will also review hazardous waste management for the LAFD and risk assessments for the Rancho LPG facility.

policefire-safetygrantspublic-safetyhazardous-waste
Notable items
Tue Apr 1, 2025 · 03:30 PM

Energy and Environment Committee

Committee to discuss wastewater bonds and illegal dumping fines

The Energy and Environment Committee will consider an ordinance for issuing Los Angeles Wastewater System revenue bonds. The body will also discuss increasing penalties for illegal dumping and a work plan for fire hydrant repairs.

wastewaterbondsillegal-dumpingfire-hydrantsenvironment
Notable items
Tue Apr 1, 2025 · 10:00 AM

City Council Meeting

City Council to confirm liens for code violations

The Los Angeles City Council will consider confirming liens for nuisance abatement and code violation costs at four properties. The items are continued from a previous meeting and include a hearing on a lien for $386.16.

building-safetycode-violationsliensnuisance-abatementcouncil-hearing
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Apr 1, 2025 · 02:00 PM

Budget and Finance Committee

LA Budget Committee reviews wildfire recovery, housing, and legal costs

The Budget and Finance Committee will review items related to wildfire recovery, including a guaranteed income program for affected residents and the re-employment of retired city employees. The agenda also includes financial reports, contract amendments, and a request to extend letters of credit for $525 million in commercial paper notes.

budgetwildfirehousinglegalcontractsfinancerecovery
Notable items
Fri Mar 28, 2025 · 01:00 PM

Ad Hoc Committee on Unarmed Crisis Prevention, Intervention, and Community Services

Committee hears reports on crisis response models

The Ad Hoc Committee on Unarmed Crisis Prevention, Intervention, and Community Services will hold a special meeting on March 28, 2025. Members will receive verbal reports from community partners on the Sequential Intercept Model and from the City Administrative Officer on the Office of Unarmed Response and the Unarmed Model of Crisis Response Program. No decisions or actions are scheduled; the agenda consists of discussion items only.

crisis-responsecommunity-servicespublic-comment
Fri Mar 28, 2025 · 10:00 AM

City Council Meeting

Council considers funding for Valley LA RiverWay Segment 4

The City Council is reviewing a motion to seek funding from Metro for the Valley LA RiverWay project. The body is also considering a contract with MSL Electric, Inc. for traffic signal services and a grant amendment for a mobility pilot in South Los Angeles.

transportationinfrastructuregrantspersonnelvalley-la-riverway
✓ Decided: Council approved reallocation of $1.49M in LADOT grant funds

The council authorized the Los Angeles Department of Transportation to shift $1,494,179.05 from the electric‑vehicle car‑share program to the on‑demand shuttle pilot in the Sustainable Transportation Equity Project, with no impact on the city’s General Fund. The council also unanimously adopted a series of "note and file" resolutions establishing the city’s positions on several state and federal transportation and housing bills.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Adopted Item
22 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea · Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] TIME LIMIT FILE ­ MARCH 28, 2025 (LAST DAY FOR COUNCIL ACTION ­ MARCH 28, 2025) Friday - March 28, 2025 - PAGE 1 Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] TIME LIMIT FILE ­ APRIL 14, 2025 (LAST DAY FOR COUNCIL ACTION ­ APRIL 11, 2025) Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
to amend Grant Agreement No. STEP­ IG­02 to shift the remaining grant budget of $1,494,179.05 from Task 3.3, Electric Vehicle Carshare Program, to Task 3.2, Pilot Electric On­Demand Shuttle, as…
12 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Jurado yea · Hernandez yea · Harris­Dawson yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Community Impact Statement: Yes For, if amended: Rampart Village Neighborhood Council For: PICO Neighborhood Council Del Rey Neighborhood Council South Robertson Neighborhood Council North…
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
Resolution for this item in order to seek action in the 2025­2026 Federal Legislative Program, to be submitted for adoption in Council, and amend the existing language to SUPPORT or SPONSOR any…
13 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Jurado yea · Hernandez yea · Harris­Dawson yea · Soto­Mart ínez yea
[context] Community Impact Statement: Yes Against: Studio City Neighborhood Council Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Friday - March 28, 2025 - PAGE 6 Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
Resolution 8682 (Huffman), the Water Conservation Rebate Tax Parity Act, inasmuch as the 2023­24 Federal Legislative Session has concluded. Fiscal Impact Statement: Not applicable. Community Impact…
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Community Impact Statement: Yes For: Los Feliz Neighborhood Council Friday - March 28, 2025 - PAGE 8 Adopted Item
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
to amend the State’s constitution to enshrine the right to clean air, water, and a healthy environment for every Californian, inasmuch as the 2023­24 State Legislative Session has concluded. Fiscal…
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Community Impact Statement: None submitted Adopted Item
22 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea · Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Friday - March yea · Lee yea · Hernandez yea · Harris­Dawson yea
to amend the amount of cannabis excise taxes, support commercial cannabis businesses and directly further the purpose of the Social Equity Program, inasmuch as the 2023­24 State Legislative Session…
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] If a public hearing is not held in Committee, an opportunity for public comment will be provided.) Friday - March 28, 2025 - PAGE 11 (Please visit www.lacouncilfile.com for background…
13 yea · 1 absent
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Jurado yea · Hernandez yea · Harris­Dawson yea · Forthwith absent · Blumenfield yea
that the recommended actions comply with the City’s Financial Policies. Community Impact Statement: None submitted Adopted Item to Continue to April 1, 2025
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Jurado yea · Hernandez yea · Harris­Dawson yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
10 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] Adopted Item Forthwith
11 yea
Yaroslavsky yea · Soto­Mart​ínez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris­Dawson yea
[context] If a public hearing is not held in Committee, an opportunity for public comment will be provided.) Friday - March 28, 2025 - PAGE 18 (Please visit www.lacouncilfile.com for background…
12 yea
Yaroslavsky yea · Soto-Martinez yea · Rodriguez yea · Raman yea · Price Jr yea · Park yea · Padilla yea · Nazarian yea · Lee yea · Hernandez yea · Harris-Dawson yea · Blumenfield yea
Wed Mar 26, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee will consider a motion to create a public homelessness‑budget database

The Housing and Homelessness Committee will hear a communication appointing Jeanne Lynette Nishimoto to the LA Citizen Oversight Committee. It will review reports on the Alliance Settlement Agreement progress and a proposed encampment‑resolution funding application process. Two motions will be considered: one to break down the city’s homelessness budget and create a publicly updated database, and another to increase funding for the ADU Accelerator Program.

housinghomelessnessbudgetadureportsmotions
✓ Decided: Committee approves homelessness budget transparency motion and multiple housing reports

The Housing and Homelessness Committee approved the Council President's communication appointing Jeanne Lynette Nishimoto, approved reports on the Alliance Settlement Agreement, Encampment Resolution Funding notices, and the Homekey+ co‑applicant list, and approved a motion to create a public database of the city’s homelessness budget. All approvals recorded three votes in favor with Councilmembers Price and Nazarian absent. The extension of the ADU Accelerator Program was not decided and will be continued later.

Notable items
Wed Mar 26, 2025 · 08:30 AM

Transportation Committee

Transportation Committee to discuss traffic signals and parking restrictions

The Transportation Committee will review a contract for traffic signal installations and a grant for a mobility pilot in South Los Angeles. The body will also consider several parking prohibitions for oversized vehicles and specific street segments.

traffic-signalsparkinggrantspublic-transitroad-safety
✓ Decided: City approves MSL Electric contract for traffic signal conduit work

The Transportation Committee approved the mayor's communication appointing Juan Solorio to the Board of Transportation Commissioners. It also approved the City Administrative Officer's report authorizing a contract with MSL Electric for conduit installation and material services for traffic signal projects. Additional approvals included a grant agreement for the Sustainable Transportation Equity Project pilot, a Letter of Intent for Metro Active Transportation funding, a Green Curb Zone at 25904 South Western Avenue, a parking restriction amendment in Reseda, a citywide traffic‑signal timing modification for transit priority, and a report on peak‑hour lane options.

401
Wed Mar 26, 2025 · 08:30 AM

Ad Hoc Committee on the 2028 Olympic and Paralympic Games

Committee reviews proposed amendment to 2028 Olympic venue plan

The Ad Hoc Committee on the 2028 Olympic and Paralympic Games will hold a special meeting on March 26, 2025. It will consider a motion (item 15‑0989‑S40) about employment opportunities for the local workforce tied to the Games, and a joint report (item 15‑0989‑S44) on a proposed First Amendment to the Venue Plan, which includes a fiscal impact statement. Public comment will be accepted in‑person only, with no teleconference option.

olympicsemploymentvenue-planfiscal-impactpublic-comment
Notable items
Wed Mar 26, 2025 · 10:00 AM

City Council Meeting

Council to approve $70,602 grant for Aging & Disability Resource Connection program

The Los Angeles City Council will consider two grant-related actions: a $13,000 contract for the Pedestrian and Bicycle Safety Program and a $70,602 grant for the Aging and Disability Resource Connection program. The Council will also vote on routine items such as approval of the minutes, commendatory resolutions, and a multiple‑agenda item comment period. All actions are subject to mayoral approval where required.

grantsagingdisabilitypedestrian-safetybicycle-safetycontractscity-council
✓ Decided: Council approved Dodgers contract and police support for World Series

The City Council authorized a contract with the Los Angeles Dodgers to reimburse city resources for World Series events and approved the use of supplemental police services for those events (12‑0 vote). It also approved the Community Investment for Families Department to negotiate a one‑year grant contract with Central City Neighborhood Partners (12‑0 vote) and adopted requests for the City Attorney to review immigration‑enforcement policies (12‑0 vote). An ordinance to raise the blanket purchase order limit to $5,000 was held over for a second consideration (10‑0 vote).

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
That the Mayor authorize the General Manager, CIFD, or designee, to negotiate and execute a contract with Central City Neighborhood Partners (which was competitively procured) for a one-year term…
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] INSTRUCT the City Administrative Officer (CAO), with the assistance of the City Attorney, Personnel Department and Chief Legislative Analyst (CLA), to issue an employee bulletin to all -…
11 yea · 2 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Lee absent · Park absent
Ordinance held over to April 2, 2025 for second consideration
10 yea · 3 absent
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Lee absent · Nazarian absent · Park absent
[context] If a public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] AUTHORIZE the CAO to execute and administer the contract between the City and Dodgers, subject to the approval of City Attorney as to form and legality
12 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises out of a trip and fall accident that occurred on February 14, 2023, at 1320 Main Street in Venice.) (Budget and Finance Committee considered this matter on March 18…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises out of a trip and fall incident that occurred on May 15, 2020, in the street located at 550 Loring Avenue, Los Angeles, California.) (Budget and Finance Committee…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from an October 15, 2022, trip and fall incident that occurred near 2630 North Vermont Avenue) (Budget and Finance Committee considered this matter on March 18, 2025.)…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident on November 11, 2020, on the sidewalk on Canby Street, - March 26, 2025 - PAGE 32 adjacent to the property located at 18435 Kingsbury…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident that occurred on June 26, 2021, near 10424 Crockett Street, in the City of Los Angeles.) (Budget and Finance Committee considered this…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident that occurred on August 28, 2020, near 6601 Lindenhurst Avenue, in the City of Los Angeles.) (Budget and Finance Committee considered this…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
Wed Mar 26, 2025 · 02:45 PM

Housing and Homelessness Committee - SPECIAL

Committee to consider motion on new LA County homelessness department and city contracts

The Housing and Homelessness Committee will consider Motion 25‑0316, introduced by Councilmembers Raman and Blumenfield, regarding the creation of a new Los Angeles County Department for Homelessness. The motion addresses how the new county department could affect the City’s contracts with the Los Angeles Homeless Services Authority. It also explores options for coordinating services, sharing data, and managing a regional homelessness response without LAHSA participation. No community impact statement was submitted.

homelessnesscounty-departmentcontractsdata-sharingregional-response
✓ Decided: Committee approves motion on new county homelessness department and city coordination

The Housing and Homelessness Committee approved a motion concerning the creation of a new Los Angeles County Department for homelessness and how it would affect the city's contracts with LAHSA. The motion also explored ways the city can coordinate services, share data, and manage a regional response without LAHSA participation. The vote was 3 Yes, with Councilmembers Price and Nazarian absent.

Notable items
Wed Mar 26, 2025 · 03:30 PM

Public Works Committee

Public Works Committee to discuss infrastructure grants and fiber optic expansion

The Committee is reviewing funding for surface transportation via RAISE grants and the CleanLA Jobs Program. Members will also discuss expanding fiber optic infrastructure in JEDI Zones and various local right-of-way and street naming requests.

infrastructuretransportationbudgetfiber-opticspublic-works
Notable items
Tue Mar 25, 2025 · 08:30 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to discuss LA28 Olympic venues and Sepulveda Basin invasive species

The Arts, Parks, Libraries, and Community Enrichment Committee will consider reports on grants for youth arts and internships. The body will also discuss a work plan for the Sepulveda Basin and a report on proposed 2028 Olympic and Paralympic venues.

olympicsenvironmentartsparksgrantsbudget
✓ Decided: Committee ordered a 90‑day report on proposed LA28 game venues

The Arts, Parks, Libraries, and Community Enrichment Committee approved five items. A motion was adopted directing the Chief Legislative Analyst to deliver a list of proposed LA28 game venues and training facilities within 90 days (2‑1). The committee also approved a work plan to remove invasive species in Sepulveda Basin, accepted two cultural‑affairs grants, and authorized a transfer of appropriations to the IT Agency for communication services (each 2‑1).

Notable items
Tue Mar 25, 2025 · 10:00 AM

City Council Meeting

Council considers $2.37 million pilot for sidewalk training in District 7

The City Council is reviewing proposals to fund a youth jobs training pilot program and establish a pre-qualified list for grant writers. The body is also considering an increase in funding for outside legal counsel.

budgetjobs-trainingcontractslegal-serviceseconomic-development
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Tue Mar 25, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to review One San Pedro redevelopment and building code changes

The Planning and Land Use Management Committee will discuss the phased redevelopment of Rancho San Pedro public housing and potential building code modifications for multifamily residential buildings. The body will also consider appeals regarding a new home in Mount Washington and a self-storage facility on West Ventura Boulevard.

zoninghousingbuilding-codespublic-housingenvironmental-regulation
✓ Decided: Committee approved One San Pedro Specific Plan for 1,553 units and 130k sq ft

The Planning and Land Use Management Committee adopted the One San Pedro Specific Plan, establishing the OSP Zone and permitting up to 1,553 dwelling units and 130,000 square feet of commercial space. Several motions were adopted, directing city agencies to prepare reports on brownfield coordination, building‑code changes for six‑story multifamily buildings, oil‑well acid maintenance controls, labor‑standard integration into affordable‑housing ordinances, and best practices for oil and gas land‑use regulation. The City Attorney report on a court‑issued writ concerning the 8217 Winnetka case was also approved.

Notable items
Tue Mar 25, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Committee reviews lease approval for Kinkisharyo at LAWA Palmdale facility

The Trade, Travel and Tourism Committee will consider five items, including reports on LAWA project delivery and a three‑year lease with Kinkisharyo International to operate a hanger at 2825 East Avenue P, Palmdale. It will also hear a Harbor Commission report on a zero‑emission truck voucher program, a motion for annual power‑surge reporting at the Port of Los Angeles, and a motion for LAWA to study space for nonprofit immigration services at the Tom Bradley International Terminal. No fiscal impacts are noted for three items, while the lease and the truck voucher program have fiscal impact statements marked Yes.

airportsportleaseszero-emission-truckspublic-comment
Notable items
Mon Mar 24, 2025 · 10:00 AM

Ad Hoc Committee for LA Recovery

Committee to consider temporary re‑employment of retired staff for wildfire recovery

The Ad Hoc Committee for LA Recovery will review reports on March 2025 wildfire recovery spending, a proposal to temporarily re‑hire retired employees, and updates to recovery planning documents. It will also hear motions on quarterly emergency operations reports, a guaranteed‑income assistance program, and environmental testing of wildfire debris. The meeting is for discussion and comment; no final actions are indicated.

wildfire-recoverybudgetemploymentenvironmenthousingemergency-planning
✓ Decided: Committee approved multiple wildfire recovery actions, including income aid

The Ad Hoc Committee for LA Recovery approved a series of reports and motions addressing the January 2025 wildfires. All items were approved with four votes in favor and one member absent, except one amendment that passed with three votes and two absences. Decisions covered budget amendments, staffing reports, quarterly recovery reporting, a guaranteed income program, debris distribution, and soil remediation work plans.

Notable items
Fri Mar 21, 2025 · 10:00 AM

City Council Meeting

LA City Council to review investment and homelessness reports

The City Council is meeting to note and file several financial and administrative reports. These include investment policy statements and annual reports for specific community facilities districts.

budgetfinancehomelessnessinvestmentreports
✓ Decided: Council ratifies Mayor’s local emergency declaration for windstorm and wildfires

The Council adopted Resolution 25-0030, ratifying the Mayor’s January 7 and 13, 2025 declarations of a local emergency due to windstorm and extreme fire weather. The resolution continues the state of emergency, authorizes city departments to act, and suspends competitive bidding requirements for emergency purchases. The Council also noted and filed six Budget and Finance Committee reports and one Housing and Homelessness Committee report, each approved unanimously.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
79 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea
[context] Fiscal Impact Statement: Not applicable Adopted Item
16 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea
Resolution to the Governor of the State of California, the Director of the Office of Emergency Services of the State of California, the Los Angeles County Office of Emergency Management, and the Los…
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea
Wed Mar 19, 2025 · 10:00 AM

City Council Meeting

Council to consider recommendations on amending Neighborhood Council bylaws for youth participation

The Los Angeles City Council will review items that have completed public hearings. It will consider a committee report requesting the Board of Neighborhood Commissioners, with assistance from the Department of Neighborhood Empowerment, the Chief Legislative Analyst and the City Clerk, to study possible amendments to Neighborhood Council bylaws to add a youth seat and increase participation. The council will also consider a Transportation Committee report on posting traffic‑restriction signs to mitigate vehicle congestion (Agenda Item 25‑0156). No financial analysis has been completed for the Neighborhood Council proposal.

neighborhood-councilyouth-participationtransportationtrafficcouncil
✓ Decided: Council adopted resolution to use 711 N Alameda St. lot as temporary shelter

The City Council adopted Resolution 24‑0008‑A to designate the parking lot at 711 North Alameda Street as an emergency temporary crisis shelter, exempt from CEQA. It also approved a draft ordinance amending the LA Administrative and Municipal Codes for Measure HLA and the Safe Streets for All Initiative. Additionally, the Council continued traffic‑restriction signs on South Sycamore Avenue/Obama Boulevard and instructed various departments to study air‑quality programs, grade‑separation options, and impacts of the Vincent Thomas Bridge project.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (33 roll-call votes)
Named votes as recorded in the official record.
[context] North Westwood Neighborhood Council Rampart Village Neighborhood Council Arleta Neighborhood Council Studio City Neighborhood Council Westside Neighborhood Council Palms Neighborhood…
10 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martínez yea
[context] Adopted Item to Continue to April 22, 2025
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martínez yea
[context] Adopted Item
33 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
Ordinance to incorporate the amendments detailed in the Communication from the Transportation Committee Chair dated February 25, 2025, and the Communication from the Public Works Committee Chair…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted Adopted Item
76 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted Adopted Item as Amended by Amending Motion 11A (Raman for Lee - Yaroslavsky) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted Adopted Item Forthwith
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - MARCH 31, 2025 (LAST DAY FOR COUNCIL ACTION - MARCH 28, 2025) Adopted Item
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted Adopted Item as Amended by Amending Motion 16A (Jurado – Nazarian) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted Adopted Motion (Yaroslavsky – Park) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - MARCH 21, 2025 (LAST DAY FOR COUNCIL ACTION - MARCH 21, 2025) Adopted Item
22 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Wednesday - March 19, 2025 - PAGE 24 Community Impact Statement: None submitted TIME LIMIT FILE - MARCH 21, 2025 (LAST DAY FOR COUNCIL ACTION - MARCH 21, 2025) Adopted Item
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE - APRIL 1, 2025 (LAST DAY FOR COUNCIL ACTION - APRIL 1, 2025) Adopted Item
22 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
that the increase in the 2025 budget concurs with the intentions of the Pacific Palisades BID's Management District Plan and does not adversely impact the benefits received by assessed property…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
that the increase in the 2025 budget concurs with the intentions of the Arts District Los Angeles BID's Management District Plan and does not adversely impact the benefits received by assessed…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
that the increase in the 2025 budget concurs with the intentions of the Fashion District BID's Management District Plan and does not adversely impact the benefits received by assessed property…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
that the recommendations in the report are in compliance with the City’s Financial Policies in that funding for the 2024-25 WDB Annual Plan is provided by special funds and the 2024-25 Adopted…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
Ordinance amending the LAAC as follows: a. Delete Sections 22.712 and 22.716 to remove all references to the City’s contractual relationship with the GLAZA. b. Amend Subdivision (d) of Section 22.704…
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
[context] Adopted Item as Amended by Amending Motion 28A (Hernandez – Hutt) and 28B (Yaroslavsky – Park) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea
Wed Mar 19, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers $1.78 M financing for Avalon Supportive Housing project

The Housing and Homelessness Committee will discuss several reports and motions, including a resolution to issue a supplemental tax‑exempt conduit revenue note up to $1,784,300 for the Avalon 1355 Supportive Housing Project in Council District 15. Other items include mayoral communications about appointments, updates on encampment fund contracts, and statutory exemptions for low‑barrier navigation centers. The meeting also features public comment and several budget‑related reports.

housingfinanceaffordable-housinghomelessnesstax-exempt-bondcity-budget
✓ Decided: Committee approved $1.78M financing for Avalon Supportive Housing project

The Housing and Homelessness Committee approved several mayoral communications, reports, and motions, each passing with a 3‑yes to 2‑absent vote. Notably, it authorized up to $1,784,300 in supplemental tax‑exempt financing for the Avalon 1355 Supportive Housing project under the TEFRA resolution. Additional approvals included a funding amendment to the Emergency Solutions Grant contract and a directive for the Housing Department to study options for applicants denied Emergency Renters Assistance.

Notable items
Tue Mar 18, 2025 · 08:30 AM

Government Operations Committee

City considers $3.5 million cannabis equity grant and new fire station land

The Government Operations Committee will discuss accepting a $3.5 million state grant for cannabis equity and the acquisition of property for a new fire station. The body will also review several lease agreements and a proposal to raise purchase order limits.

cannabisgrantsreal-estatefire-departmentleasingcity-administration
Room 401
Tue Mar 18, 2025 · 03:30 PM

Energy and Environment Committee

Committee discusses illegal dumping fines and fire safety infrastructure

The Energy and Environment Committee will review motions regarding illegal dumping penalties and fire hydrant maintenance. The body will also discuss powerline undergrounding in high-fire hazard zones and building decarbonization.

illegal-dumpingfire-safetyutilitiesdecarbonizationenvironment
Notable items
Tue Mar 18, 2025 · 10:00 AM

City Council Meeting

City Council to consider alley offer rejection and lighting district assessments

The Los Angeles City Council will consider rejecting an offer to turn an alley into a public alley on Van Noord Avenue and continued consideration of a lighting district assessment on Waterloo Street.

city-councilalleylighting-districtassessmentsnuisancepublic-works
✓ Decided: Council approves $8M settlement in officer-involved shooting lawsuit

The Los Angeles City Council approved five lawsuit settlements, including an $8 million payout in a police shooting case and a $675,000 settlement in a police disability discrimination case. The council also advanced a $55 million bond for a 238-unit affordable housing project, approved a new tourism marketing district, and authorized a development agreement for the Slauson and Wall Project. Several street lighting district assessments were confirmed, while two were abandoned due to majority protests.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (27 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) (Continued from Council meeting of December 11, 2024) Adopted to Continue Item to May 6, 2025
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
Resolution rejecting the offer for future alley as public alley to the RED for processing. Fiscal Impact Statement: The City Engineer reports that a fee of $7,075.91 was paid for processing this…
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting district, in accordance with Sections 6.95­6.127 of the Los Angeles Administrative Code and Government Code…
55 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting Tuesday - March 18, 2025 - PAGE 5 district, in accordance with Sections 6.95­6.127 of the Los Angeles…
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
that the streetlights are not installed or are removed from service if previously installed. (Continued from Council meeting of February 11, 2025) Adopted Item Tuesday - March 18, 2025 - PAGE 6
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting district, in accordance with Sections 6.95­6.127 of the Los Angeles Administrative Code and Government Code…
22 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
that the streetlights are not installed or are removed from service if previously installed. (Continued from Council meeting of February 11, 2025) Adopted Item
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] (Continued from Council meeting of March 14, 2025) Adopted Item
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] (Government Operations Committee waived consideration of the above matter.) Adopted Item
10 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Item Tuesday - March 18, 2025 - PAGE 11
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] Community Impact Statement: Yes For: Bel Air­Beverly Crest Neighborhood Council Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
ordinance and/or Charter. Fiscal Impact Statement: Neither the CAO nor the CLA has completed a financial analysis of this report. Community Impact Statement: None submitted Adopted Item
10 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Item
29 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Tuesday - March 18, 2025 - PAGE 16 Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
that the increase in the 2025 budget concurs with the intentions of the Downtown Center BID's Management District Plan and does not adversely impact the benefits received by assessed property owners…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
that the increase in the 2025 budget concurs with the intentions of the Figueroa Corridor BID's Management District Plan and does not adversely impact the benefits received by assessed property…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
Ordinance held over to March 25, 2025 for second consideration
27 yea · 9 absent
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield absent · Lee absent · Padilla absent · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield absent · Lee absent · Padilla absent · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield absent · Lee absent · Padilla absent
Ordinance held over Tuesday - March 18, 2025 - PAGE 27 to March 25, 2025 for second consideration
9 yea · 3 absent
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Blumenfield absent · Lee absent · Padilla absent
Ordinance No. 186197; Council file No. 14­1635­S7), a new fee study analyzing both the registration and Per Night Fee would be required. Tuesday - March 18, 2025 - PAGE 30 Community Impact Statement…
10 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
that the subdivider Tuesday - March 18, 2025 - PAGE 31 has paid a fee of $9,064 for the processing of this final parcel map pursuant to Section 19.02(B)(3) of the Los Angeles Municipal Code. No…
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
Tue Mar 18, 2025 · 02:00 PM

Budget and Finance Committee

City to accept $3.5 million Cannabis Equity Act grant

The Budget and Finance Committee will review several reports and motions, including updates on emergency management, revenue forecasts, and grant programs. Members will consider a motion to accept a $298,044 donation for the Mayor’s Office of Strategic Partnerships and a motion to reallocate funds to the Emergency Rental Assistance program. The committee will also vote on accepting a $3,500,000 Cannabis Equity Act grant and on proposed changes to the Transportation Demand Management ordinance and related fee ordinances.

budgetgrantshousingtransportationpublic-safetylegalenvironment
✓ Decided: LA budget committee approves $298K Harbor Freight donation, wildfire rental aid reallocation

The Budget and Finance Committee approved 15 items, all by 5-0 votes, including accepting a $298,044 donation from Harbor Freight Tools Foundations for the Mayor's Office of Strategic Partnerships, reallocating United to House LA Fund administration money to the Emergency Rental Assistance Program for wildfire victims, and establishing a Grant Writers Pre-Qualified List. The committee also concurred with other committees' actions on grants for parks, aging services, port security training, and cannabis equity, and considered 27 litigation matters in closed session. Two verbal updates on wildfire recovery planning and budget hearing schedule were received with no action taken.

Notable items
Fri Mar 14, 2025 · 08:30 AM

Personnel and Hiring Committee

City proposes contract with Cornerstone OnDemand for employee training portal

The Personnel and Hiring Committee will consider a First Amended and Restated Professional Services Agreement (Contract No. C‑140215) with Cornerstone OnDemand, Inc. to provide an online training portal and learning management system for city employees. The committee will also hear multiple mayoral communications seeking civil‑service exemptions for several senior positions, and reports on hiring benchmarks, payroll issues, and other personnel matters.

personnelcivil-servicecontractstraininghiring
✓ Decided: Committee approves 5 civil service exemptions and training contract

The Personnel and Hiring Committee approved all five civil service exemption requests from the Mayor, covering positions in Engineering, General Services, Economic and Workforce Development, and Information Technology, as well as a contract with Cornerstone OnDemand for an online training portal. It also approved three motions, including one to integrate labor agreement terms into the payroll system, and noted and filed two reports. Two items were continued, and one was continued without action.

Room 401
Notable items
Fri Mar 14, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee will consider a June 2026 ballot measure for a fire station bond

The Rules, Elections and Intergovernmental Relations Committee will discuss a series of motions and resolutions, including a proposed June 2026 ballot measure to fund fire station maintenance and new construction. Other items include updates on charter reform, revisions to residency requirements for Harbor Commissioners, and several state legislative program support resolutions. The meeting also includes a public comment period.

budgetpublic-safetycharter-reformhousingcannabislocal-legislation
✓ Decided: Committee approves Harbor Commissioner residency change, port access plan

The Rules, Elections and Intergovernmental Relations Committee approved a City Attorney draft ordinance to revise residency requirements for Harbor Commissioners, and a motion proposing a new Charter section for a Port of Los Angeles Public Access Investment Plan. It also approved several resolutions and motions related to the City's 2025-26 State Legislative Program, including support for a fire station bond measure and a resolution on the Local Solutions Fund methodology. All items were approved with 4 yes votes and 0 no votes, with Councilmember Lee absent.

Fri Mar 14, 2025 · 10:00 AM

City Council Meeting

Council to consider $55 M revenue bond for 238‑unit Miramar Street housing project

The City Council will vote on a motion and accompanying resolution to issue up to $55 million in revenue bonds or notes to finance and refinance the acquisition, rehabilitation, improvement, renovation, furnishing, and equipping of a 238‑unit multifamily rental project at 1501 Miramar Street in District One. The Council will also consider a categorical exemption and amendment to the memorandum of agreement with the Friends of Cabrillo Marine Aquarium, allowing the aquarium to sell beverages and packaged snacks in its gift shop and an adjacent coffee cart. Both items are subject to mayoral approval after Council action.

housingbondsfinanceenvironmentpublic-commentcity-council
✓ Decided: Council approves $55M bond for 238-unit housing project

The Council approved a resolution allowing the California Municipal Finance Authority to issue up to $55 million in revenue bonds to finance the acquisition and rehabilitation of a 238-unit multifamily rental housing project at 1501 Miramar Street. The item was continued to March 18, 2025, subject to mayoral approval. The Council also approved several other items, including contracts, leases, and donations.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
61 yea · 2 nay
Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Harris­Dawson yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Hernandez nay · Harris­Dawson yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Hernandez nay · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Friday - March 14, 2025 - PAGE 17 Adopted Item
7 yea · 1 nay
Harris­Dawson yea · Jurado yea · Hutt yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Hernandez nay
that the Council member of the District be authorized to execute any such documents on behalf of the City. Friday - March 14, 2025 - PAGE 34 3. AUTHORIZE the City Clerk to make any technical…
8 yea · 1 nay
Harris­Dawson yea · Hernandez yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Jurado nay
The other 21 items passed by unanimous or near-unanimous consent.
Mon Mar 10, 2025 · 06:00 PM

Los Angeles City Health Commission

Health Commission to review LAFD EMS staffing

The Los Angeles City Health Commission will meet to approve minutes from the previous month and hear a presentation on the Los Angeles Fire Department's Emergency Medical Services Division staffing and needs. The meeting will also include public comment and Neighborhood Council reports.

healthemslafdstaffingpublic-commentminutes
Fri Mar 7, 2025 · 10:00 AM

City Council Meeting

Council to consider nuisance abatement liens for four properties

The City Council will hold public hearings to consider protests, appeals, or objections regarding proposed liens for nuisance abatement and code violations. The body will decide whether to confirm these liens for specific properties based on reports from the Department of Building and Safety.

nuisance-abatementcode-violationspublic-hearingsliens
✓ Decided: Council adopts temporary ban on evictions for substantial remodeling

The Los Angeles City Council adopted a motion to temporarily prohibit residential evictions for substantial remodeling of residential real property through June 1, 2025, with an urgency clause requiring 12 votes. The motion also requests the City Attorney to amend the ordinance to extend the termination date to August 1, 2025, remove the permit exemption, apply protections retroactively to pending eviction proceedings, and extend paid and secured permits by six months. The vote was 12-0, with three members absent.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (URGENCY CLAUSE ­ 12 VOTES REQUIRED) (Continued from Council meeting of March 5, 2025) Adopted Motion (Blumenfield – Soto­Martinez) -SEE ATTACHED
20 yea
Blu menfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Raman yea · Rodriguez yea · Soto­Martinez yea · Blu menfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Padilla yea · Raman yea · Rodriguez yea · Soto­Martinez yea
Fri Mar 7, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging and Disability Committee

Committee considers request to accept MIPPA grant funds for aging services

The Civil Rights, Equity, Immigration, Aging and Disability Committee will discuss six agenda items. These include a Department of Aging report seeking authority to accept Medicare Improvement for Patients and Providers Act (MIPPA) grant funds and execute related agreements. Additional items cover workplace immigration‑enforcement information, stop‑gap funding for Esperanza Immigrant Rights programs, immigration‑rights outreach, a proposal to prohibit city resources for immigration enforcement, and a report on closing the digital divide with equitable broadband access.

agingimmigrationbroadbandbudgetcivil-rightsequity
✓ Decided: Committee approves five immigration and aging items, continues broadband

The committee approved five items, including accepting Medicare grant funds for the Department of Aging, and four motions related to immigration rights and enforcement. One item on digital divide and broadband access was continued to a future date. All approvals were by a 3-0 vote with two members absent.

Notable items
Wed Mar 5, 2025 · 08:30 AM

Public Works Committee

Committee to discuss truck traffic diversion and bridge project impacts

The Public Works Committee will meet to consider a report on a public alley offer and two motions regarding transportation infrastructure. These include a potential study for a grade separation to divert truck traffic and the impacts of a bridge deck replacement project.

roadstruck-trafficinfrastructurebridgeszoning
✓ Decided: Committee approves alley rejection, truck study, bridge impact motion

The Public Works Committee unanimously approved three items: rejecting an offer to dedicate a future alley at 6900 Van Noord Avenue as public, commissioning a study on a grade separation between Alameda Street and Lomita Boulevard to divert truck traffic, and a motion on the Vincent Thomas Bridge Deck Replacement Project impacts. All votes were 3-0.

Notable items
Wed Mar 5, 2025 · 10:00 AM

City Council Meeting

Council to fund continued crossing guard services for the school year

The City Council will consider a budget recommendation to transfer funds from the Unappropriated Balance to the Los Angeles Department of Transportation to maintain existing crossing guard services through the end of the school year. The Council will also receive committee reports on three state assembly bills (AB 742, AB 1306, AB 1082) and will take note and file resolutions supporting the city’s positions on those bills. Additional agenda items include roll call, approval of minutes, commendatory resolutions, and public comment periods.

budgettransportationpublic-safetylegislationcity-council
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Mar 5, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee discusses homeless funding and interim housing projects

The Housing and Homelessness Committee is reviewing funding recommendations for Measure A and the Homelessness Emergency Declaration quarterly report. Members are considering motions to establish new funds and transfer money for interim housing rehabilitation.

homelessnesshousingbudgethealthcareinterim-housing
Notable items
Wed Mar 5, 2025 · 03:30 PM

Public Safety Committee

Public Safety Committee reviews police programs and library safety measures

The Public Safety Committee will review reports on police cadet programs and library safety, and consider accepting emergency management and port security grants. The committee will also discuss fire hydrant inspection workflows.

policefire-departmentlibrary-safetygrantspublic-safetysan-pedroemergency-management
Tue Mar 4, 2025 · 08:30 AM

Government Operations Committee

Committee reviews IT contracts and multiple city-owned property leases

The Government Operations Committee will discuss updated contracts for information technology services. The body is also considering several lease agreements for city-owned spaces, including office space and nonprofit sites for community programs.

contractsit-servicesreal-estatenonprofitscommunity-gardens
✓ Decided: Committee approves IT contracts and four property leases

The Government Operations Committee approved all five agenda items. It approved as amended a report on amended contracts with 12 IT contractors, and approved four lease agreements: a successor lease with Metro for office space on East Temple Street, a nonprofit lease with Alcott Center for space on East 1st Street, a no-cost lease with Canopy Roots for space on North Cherokee Avenue, and a lease with the Los Angeles Neighborhood Land Trust for a vacant lot on Sharp Avenue for a community garden. Councilmember Jurado was absent for all votes.

Room 401
Notable items
Tue Mar 4, 2025 · 10:00 AM

City Council Meeting

City Council to set hearing dates for three street lighting districts

The City Council is considering ordinances of intention to establish hearing dates for the maintenance of three street lighting districts. If adopted, these measures will create dedicated maintenance assessment accounts for the specified areas.

street-lightinginfrastructurepublic-hearingsfinance
✓ Decided: Council approves fire-related eviction protections and street lighting districts

The Los Angeles City Council approved multiple items, including ordinances to set public hearing dates for seven street lighting maintenance districts, and continued an item on fire-related eviction protections. It also granted two liquor license applications, denied one, and approved a resolution supporting zero-emission standards for furnaces and water heaters. The council received and filed the appeal regarding the removal of former Fire Chief Kristin Crowley.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (Continued from Council meeting of February 25, 2025) Adopted Item
10 yea · 1 nay
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Rodriguez yea · Soto­Mart​ínez yea · Hutt nay
The other 26 items passed by unanimous or near-unanimous consent.
Tue Mar 4, 2025 · 02:00 PM

Budget and Finance Committee

Committee to consider a plan for modernizing the city's online budget tools

The Budget and Finance Committee will hear a motion directing the City Administrative Officer to inventory existing online budget engagement tools and propose a modernization plan. It will also consider motions on a biennial budget cycle analysis, a funding plan for Super Scoopers, and grant acceptance reports for various safety and community programs. Public comment will be taken in person only.

budgetfinancegrantspublic-safetytechnology
✓ Decided: Committee approves mid-year financial report and 5 budget motions

The Budget and Finance Committee approved the City Administrative Officer's Mid-Year Financial Status Report as amended, along with five motions related to budget modernization, a biennial budget cycle study, Super Scooper acquisition funding, West Caribou Lane repairs, and city vacancy rates. The committee also concurred with other committees' actions on several grant acceptances and approved outside counsel contracts. All votes were unanimous except one grant item (4-1) and one outside counsel item (4-0 with one absence).

Notable items
Tue Mar 4, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee considers exclusive deal for 5867 S. Los Angeles St property

The Economic Development and Jobs Committee will review a Municipal Facilities Committee report authorizing the City to negotiate and execute an exclusive agreement for the disposition and development of the property at 5867 South Los Angeles Street. It will also hear reports on a new Pacific Avenue Corridor Jobs and Economic Development Incentive (JEDI) Zone, a request for information to find an operator for the Watts Coffee House at 1827 East 103rd Street, and a motion to coordinate with LA28 on local workforce employment opportunities. Several draft ordinances and reports on business improvement districts and the Tourism and Marketing District will be presented for consideration.

economic-developmentjobszoningpropertybusiness-improvement-districtworkforce
✓ Decided: Committee approves 16 economic development items, including JEDI Zone and Fair Work Week extension

The Economic Development and Jobs Committee approved all 16 agenda items, including establishing the Pacific Avenue Corridor Jobs and Economic Development Incentive (JEDI) Zone, authorizing negotiations for development at 5867 South Los Angeles Street, and requesting an ordinance to extend Fair Work Week protections to fast food employees. All votes were 4-0 with Councilmember Nazarian absent.

Notable items
Tue Mar 4, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers Navajo generator agreement and water lab project

The Energy and Environment Committee will discuss an ordinance for the Navajo Q255 Large Generator Interconnection Agreement and a contract for the Water Quality Laboratory Project. The body will also review reports on power outages at the Port of Los Angeles and pilot library cooling centers for 2025.

energywater-qualitypower-gridair-qualityclimate-resiliencepublic-safety
Notable items
Fri Feb 28, 2025 · 08:30 AM

Personnel and Hiring Committee

Personnel Committee to set salaries for new city jobs

The Personnel and Hiring Committee will discuss setting pay for two new city classifications and consider exempting several staff positions from civil service rules. The meeting also includes a report on Police Department staffing and motions regarding city employment practices.

personnelhiringsalariescivil-servicepolicestaffing
✓ Decided: Committee approves salary classifications and civil service exemptions

The Personnel and Hiring Committee approved all seven agenda items, including new salary classifications for Principal Clean Water Manager and Zoo Curator of Animal Wellbeing, exemptions for CAO and EWDD positions, amendments to the DWP MOU, a motion on charter reform employment practices, and a motion on vacancy rates. All votes were 2-0 with Councilmember Rodriguez absent. The committee also noted and filed a report on LAPD Communications Division staffing.

Van Nuys City Hall
Fri Feb 28, 2025 · 10:00 AM

City Council Meeting

City Council approves $2.4M for Lankershim Arts Center repairs

The City Council will consider a Government Operations Committee report to approve a $2.4 million construction change order for the Lankershim Arts Center Rehabilitation. The report also recommends transferring $1.6 million in Municipal Improvement Corporation of Los Angeles (MICLA) funds to the Department of General Services and $700,000 to the Bureau of Engineering for the project.

budgetartsconstructioncouncilfundinginfrastructurecity-hall
✓ Decided: Council advances 2028 Olympics zoning exemption ordinance

The Los Angeles City Council voted 11-1 to direct the Department of City Planning to draft an ordinance exempting 2028 Olympic and Paralympic venues and related infrastructure from most zoning and planning approvals, subject to Mayor approval. The item was adopted with multiple amendments, including one ensuring the draft ordinance won't be considered until a report is prepared and another excluding large-scale permanent cable-guided transit projects. The council also approved funding transfers for the Lankershim Arts Center rehabilitation and several other routine items.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
ordinance is prepared. Fiscal Impact Statement: Neither the CAO nor the CLA has completed a financial analysis of this report. Community Impact Statement: Yes For: North Westwood Neighborhood Council…
11 yea · 3 absent · 1 nay
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman absent · Rodriguez absent · Harris-Dawson yea · Soto-Mart ínez yea · Padilla nay · Yaroslavsky absent
The other 6 items passed by unanimous or near-unanimous consent.
Wed Feb 26, 2025 · 08:30 AM

Transportation Committee and Special Joint Meeting with Public Works Committee

LA Committees to discuss Measure HLA and street safety initiatives

The Transportation and Public Works Committees are meeting to discuss the implementation of Measure HLA and the Los Angeles Safe Streets for All Initiative. The body will also consider a proposal to reduce wait times for transportation infrastructure projects and a motion regarding traffic signs at South Sycamore Avenue and Obama Boulevard.

transportationpublic-worksroad-safetyinfrastructureair-quality
✓ Decided: Committee approves Measure HLA ordinance and traffic sign motions

The Transportation Committee, in a joint meeting with Public Works, approved a motion to post traffic restriction signs at South Sycamore Avenue and Obama Boulevard, and another to study a city air quality program. It also approved an amended draft ordinance implementing Measure HLA and Mobility Plan 2035 community engagement policies, and received/filed a budget recommendation for a Measure HLA implementation plan. A report on streamlining transportation infrastructure projects was noted and filed.

Notable items
Wed Feb 26, 2025 · 10:00 AM

City Council Meeting

Council considers wildfire recovery costs and legislative priorities

The City Council will review initial cost estimates for the January 2025 wildfires and consider supporting state legislation to prevent monopolistic homeownership in fire-damaged areas. The body will also discuss a grant extension for the Venice Pier Improvement Project.

wildfirebudgethousinglegislationveniceparksrecovery
✓ Decided: Council approves $900K settlement in Bird scooter bankruptcy case

The City Council approved a $900,000 settlement in the Bird Global, Inc. bankruptcy case, authorizing the City Attorney to expend funds for the settlement. The council also adopted a resolution supporting state legislation (SB 701) to criminalize Wi-Fi jammers and signal scramblers, and instructed the City Administrative Officer to provide quarterly reports on fiscal recovery from the January 2025 wildfires. Multiple personal injury and employment lawsuit settlements were approved in closed session.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (15 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item as Amended by Motion 18A (McOsker - Hernandez) - SEE ATTACHED
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] Community Impact Statement: None submitted
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
RESOLUTION relative to establishing the City's position on legislation that results in amendments to the State Density Bonus Law to ensure that evacuation routes within High Fire - February 26, 2025…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a fall incident on October 27, 2021, incident at 437 North Vermont Avenue, in Los Angeles.) (Budget and Finance Committee considered this matter on February 4…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a March 1, 2023, incident wherein a City tree branch fell on a pedestrian at 22024 Martinez Street in Woodland Hills, California, causing injury.) (Budget and…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a tree fall over incident occurring on November 3, 2021, in parking lot "H" of the Greek Theater.) (Budget and Finance Committee considered this matter on February…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident on June 21, 2020, on the sidewalk located near 6920 Coldwater Canyon Avenue, in the City of Los Angeles.) (Budget and Finance Committee…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall incident which occurred on December 28, 2021, near 300 South Willaman Drive, in Los Angeles.) (Budget and Finance Committee considered this matter…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a trip and fall accident that occurred on May 28, 2020, on Cypress Avenue near Silver Street, in Los Angeles.) (Budget and Finance Committee considered this matter…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a fall - February 26, 2025 - PAGE 28 incident on January 8, 2022, at the intersection of Sunset Boulevard and North Highland Avenue, in Los Angeles.) (Budget and…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from an automobile incident that occurred on October 26, 2023 on the southbound Interstate 5 (1-5) Freeway about 500 feet south of Glendale Boulevard, in the City of Los…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] 1983), whistleblower retaliation under California Labor Code Section 1102.5 and retaliation in violation of the California Fair Employment and Housing Act against the City.) (Budget and…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] and (10) Failure to prevent discrimination.] (Budget and Finance Committee considered this matter on February 18, 2025.) Adopted Motion (Yaroslavsky- Blumenfield) in Open Session - SEE…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] (This matter arises from a November of 2021 failure to promote claim.) (Budget and Finance Committee considered this matter on February 18, 2025.) Adopted Motion (Yaroslavsky- Blumenfield)…
13 yea
Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea
[context] Adopted Findings Forthwith
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Soto-Martinez yea · Yaroslavsky yea
Tue Feb 25, 2025 · 08:45 AM

Arts, Park, Libraries, and Community Enrichment Committee

Committee to discuss youth seats on Neighborhood Councils and library safety

The Arts, Park, Libraries, and Community Enrichment Committee will review reports on park improvements, animal services, and library safety. The body is also considering amendments to Neighborhood Council bylaws to ensure youth participation.

parkslibrariesyouthanimal-servicespublic-safetyneighborhood-councils
✓ Decided: Committee approves youth seat on every Neighborhood Council

The Arts, Parks, Libraries, and Community Enrichment Committee approved a motion to amend Neighborhood Council bylaws to ensure youth participation, including designating a youth seat on each council and creating term limits. The motion passed 3-0. The committee also approved several other items, including agreements for park improvements, a library safety motion, and a naloxone distribution pilot program.

Notable items
Tue Feb 25, 2025 · 10:00 AM

City Council Meeting

Council to decide street lighting district ordinances and liquor license

The Los Angeles City Council will consider continued items on street lighting districts for Onteora and Kerwin Places, 112th Street with Compton Avenue, and 112th Street with Central Avenue, and will vote on the associated ordinances. It will also review an application to grant a liquor license to Super King Market at 16107 West Victory Boulevard. Routine business such as roll call, approval of minutes, commendatory resolutions, and public comment will also be addressed.

street-lightingordinanceliquor-licensepublic-hearingcouncil
✓ Decided: Council ratifies wildfire emergency, approves $9M in recovery grants

The Los Angeles City Council ratified the Mayor's local emergency declaration for the January 2025 wildfires and approved up to $9 million in state and federal grants for temporary wildfire cleanup jobs. The council also approved a $1.5 million settlement for a police bomb squad incident, denied a rent-gouging protection bill, and designated seven locations in CD 5 for enforcement against sitting or sleeping in public spaces.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Adopted Item
98 yea · 3 nay
Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Hernandez nay · Jurado nay · Raman nay · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Failed of Adoption
7 yea · 4 nay · 2 absent
Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Raman yea · Blumenfield nay · Lee nay · Park nay · Rodriguez nay · Padilla absent · File the matter absent · Soto­Mart​ínez yea
The other 38 items passed by unanimous or near-unanimous consent.
Tue Feb 25, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to consider motel use discontinuation and storage container standards

The Planning and Land Use Management Committee will consider an appeal to stop transient motel use at the Hi Lite Motel and related properties. The body will also discuss creating development standards for equestrian equipment storage containers and a sign district for Figueroa and Olympic boulevards.

zoninghousingmotelenvironmental-justicesignsbudgetplanning
✓ Decided: Committee denies Hi Lite Motel appeal, sustains zoning enforcement

The Planning and Land Use Management Committee denied an appeal by LA Hi Lite Property, Inc. and others, sustaining the Zoning Administrator's decision to discontinue transient motel use at the Hi Lite Motel on South Broadway. The committee also adopted several motions, including one to release Westwood Presbyterian Church from a 1982 covenant and another to study storage container use for equestrian equipment in 'K' Overlay Zones. Additionally, it approved $85,000 for Environmental Justice Policy Program outreach and held a report on affordable housing on commercial infill sites for further revisions.

Notable items
Tue Feb 25, 2025 · 02:00 PM

Trade, Travel and Tourism Committee

Committee to approve 20‑year solar power agreements at Van Nuys Airport

The Trade, Travel and Tourism Committee will consider several reports from the Board of Airport Commissioners, including approvals of long‑term operating agreements for rooftop and parking‑canopy solar projects at Van Nuys Airport. It will also review amendments to media concession contracts at LAX and authority for aeronautical permits. Additional items include a quarterly update from the Port of Los Angeles and various contract and policy reports.

airportssolaradvertisingpermitscontractsportharborenvironment
Notable items
Fri Feb 21, 2025 · 08:30 AM

Government Efficiency, Innovation, and Audits Committee

Committee reviews street lighting repair process and audits city service duplication

The Government Efficiency, Innovation, and Audits Committee will hear a verbal presentation from the President of the Innovation and Performance Commission. It will consider Motion 25‑0125 to examine the current process, timeline, and bottlenecks for repairing damaged street and pedestrian lighting and compare it with other major cities. It will also consider Motion 25‑0107 to audit key functions of City departments to identify duplication of services in non‑Charter mandated areas. No community impact statements were submitted for either motion.

government-efficiencyinnovationauditsstreet-lightingcity-servicespublic-comment
401
Fri Feb 21, 2025 · 10:00 AM

City Council Meeting

Council to consider feasibility of joining 30x30 conservation campaign

The Los Angeles City Council will discuss several committee reports, including a recommendation to study converting Wilton Place at Pico Boulevard into a parklet. It will also consider a request for the Fire Department to assess equipment and training needed to mitigate electric‑vehicle fires. Additional items include filing a report on Red Flag streets in Very High Fire Hazard zones and evaluating the city’s participation in the 30x30 land‑conservation initiative.

parkletpublic-safetyelectric-vehiclesfireconservationenvironmentcity-planning
✓ Decided: Council approves $9.5M settlement in LAFD lawsuit

The City Council authorized a $9.5 million settlement in the Daniel Gonzalez v. City of Los Angeles case, subject to mayoral approval. The council also adopted several other items, including directing reports on EV fire equipment, a parklet at Wilton Place, and a 30x30 conservation feasibility study. The Olympic venue zoning exemption was continued to February 28, 2025.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item Friday - February 21, 2025 - PAGE 0
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: Yes For: Westside Neighborhood Council Adopted Item
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: Yes For: Bel Air­Beverly Crest Neighborhood Adopted Item
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
ordinance is prepared. Fiscal Impact Statement: Neither the CAO nor the CLA has completed a financial analysis of this report. Community Impact Statement: Yes For: North Westwood Neighborhood Council…
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Friday - February 21, 2025 - PAGE 6 Adopted Item
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Item
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Adopted Item as Amended by Motion 8A (McOsker – Park) Forthwith - SEE ATTACHED
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart ínez yea
[context] (This matter arises from an incident involving the Los Angeles Fire Department.) (Budget and Finance Committee to consider this matter on February 18, 2025.) Adopted Motion (Yaroslavsky –…
8 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Mart ínez yea
Wed Feb 19, 2025 · 10:00 AM

City Council Meeting

Council considers $3 million for South LA Historic Neighborhood Markers

The City Council is reviewing a proposal to initiate the South LA Historic Neighborhood Markers project. This includes the creation of monument structures at four specific intersections and the development of an interactive historical storymap.

arts-and-culturesouth-lapublic-worksbudget
✓ Decided: Council approves $3M for South LA historic neighborhood markers

The Los Angeles City Council approved a $3 million project to install historic neighborhood markers and gateways in South Los Angeles, funded by the 2023 State Budget Act. The council also approved a $49 million stormwater capture parks agreement, a $50,000 reward payment, and several airport and harbor permits. All items passed unanimously with 12-0 votes, except where noted.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (18 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item
42 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Motion (Yaroslavsky – Blumenfield) - SEE ATTACHED
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
that the LADWP will fund the program implementation services costs, up to a maximum of $297,700,000. Community Impact Statement: None submitted Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
that the above recommendations comply with the City’s Financial Policies. Community Impact Statement: None submitted Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ FEBRUARY 27, 2025 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 26, 2025) Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ MARCH 6, 2025 (LAST DAY FOR COUNCIL ACTION ­ MARCH 5, 2025) Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
that the approval of the proposed First Amendment to Lease No. LAA­ 9127 with Jacobsen | Daniels Associates LLC. will have no impact on the City’s General Fund. Revenues in the amount of $71,192 over…
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ MARCH 25, 2025 (LAST DAY FOR COUNCIL ACTION ­ MARCH 25, 2025) Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided,) (Please visit www.lacouncilfile.com for background documents.) Community Impact Statement…
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ APRIL 1, 2025 (LAST DAY FOR COUNCIL ACTION ­ APRIL 1, 2025) Adopted Item
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
Resolution No. 28103 will authorize 51 Multiple Award Task Order contracts for as­needed design­build and construction services at LAX for a five­year term and two, one­year, renewal options and an…
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted Adopted Item Wednesday - February 19, 2025 - PAGE 17
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Adopted Item
33 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Wednesday - February 19, 2025 - PAGE 19 Adopted Item
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
to accept grant funding for the Donald C. Tillman Water Reclamation Plant Advanced Water Purification Facility Project. Recommendation for Council action, SUBJECT TO THE APPROVAL OF THE MAYOR: ADOPT…
11 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Adopted Motion (Padilla – Soto­Martinez) to Continue to February 26, 2025 - SEE ATTACHED
9 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Raman yea · Soto­Mart ínez yea
[context] Wednesday - February 19, 2025 - PAGE 22 Community Impact Statement: None submitted (Planning and Land Use Management Committee waived consideration of the above matter) Adopted Item…
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Adopted Item to Continue to February 26, 2025
8 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea
Wed Feb 19, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers temporary ban on evictions for residential remodeling

The Housing and Homelessness Committee will discuss an ordinance to prohibit residential evictions for substantial remodeling through June 1, 2025. The body will also consider reallocating funds to provide emergency rental assistance for residents impacted by the 2025 Los Angeles wildfires.

housingevictionsrental-assistancewildfireshomelessness
✓ Decided: Committee approves temporary ban on evictions for remodeling through June 1

The Housing and Homelessness Committee approved two items. First, it approved a City Attorney report and ordinance to temporarily prohibit residential evictions for substantial remodeling through June 1, 2025. Second, it approved as amended a motion to reallocate funds from the United to House LA Fund Administration to the Emergency Rental Assistance (ERA) Program for wildfire-impacted Angelenos, and to request reports on additional expenditure categories and program administration options.

Notable items
Wed Feb 19, 2025 · 03:30 PM

Public Safety Committee

Committee to consider funding plan for permanent Super Scooper acquisition

The Public Safety Committee will hear reports and motions on fire department staffing, police equipment donations, and grant acceptance packets. It will consider a motion to fund the permanent acquisition of one or more Super Scoopers to replace leased units. Additional items include motions on Red Flag day staffing and a review of firefighter standards of cover.

firepolicebudgetgrantsstaffingequipment
Tue Feb 18, 2025 · 08:30 AM

Government Operations Committee

Committee considers funding for Lankershim Arts Center and housing leases

The Government Operations Committee will discuss several lease agreements for housing and office use. The body is also reviewing a fund transfer for the Lankershim Arts Center Project and a motion regarding tobacco retailer permits.

housingarts-and-cultureleasespublic-healthbudget
✓ Decided: Committee approves transitional housing lease in Venice

The Government Operations Committee approved all seven agenda items unanimously (3-0). Key approvals include a ground lease with Venice Community Housing Corporation for a transitional housing site at 650 Westminster Avenue, a lease for office space at 1910 West Sunset Boulevard for the Housing Department, and a $1.6 million fund transfer for the Lankershim Arts Center Project. The committee also approved a license agreement for the City Hall Farmer's Market and a motion to send cease-and-desist letters to tobacco retailers selling mislabeled hemp products.

Room 401
Notable items
Tue Feb 18, 2025 · 10:00 AM

City Council Meeting

Council considers liquor licenses and street lighting district abandonment

The City Council will hold public hearings regarding two liquor license applications. The body is also considering an ordinance to abandon proceedings for a street lighting maintenance district due to majority protests.

liquor-licensespublic-hearingsstreet-lightingordinances
✓ Decided: Council approves liquor license for Tujunga store and brush clearance program

The Los Angeles City Council approved a liquor license for Liquor and More at 6670 Foothill Boulevard, Tujunga, determining it serves public convenience. It also adopted a motion to create a semi-annual brush clearance program to mitigate wildfire risk, with LAFD and CAO to report on resources. Both items passed with votes as recorded.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Item as Amended by Motion 22A (Rodriguez - Hutt) - SEE ATTACHED
11 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Rodriguez yea · Yaroslavsky yea
Tue Feb 18, 2025 · 02:00 PM

Budget and Finance Committee

Budget Committee to review wildfire recovery costs and disaster grants

The Budget and Finance Committee will discuss financial reports on homelessness and public safety grants. The body is also reviewing cost estimates and recovery strategies for the January 2025 fire and windstorm events. Additionally, the committee may enter closed sessions to discuss various legal cases against the city.

budgetwildfire-recoverygrantshomelessnesspublic-safetytransportation
Notable items
Fri Feb 14, 2025 · 09:00 AM

Rules, Elections and Intergovernmental Relations Committee

Committee considers $15.5 billion climate resilience bond proposal

The Rules, Elections and Intergovernmental Relations Committee will review a series of resolutions and motions that support the City’s 2023‑24 and 2024‑25 State Legislative Programs. Items include a $15.5 billion climate resilience bond, an expansion of the Film and Television Tax Credit cap, zero‑emission furnace and water‑heater standards, and a rent‑freeze measure during emergencies. The Committee will also consider a procedural amendment for Council President appointments to the Innovation and Performance Commission.

climate-resiliencebondstax-creditair-qualityhousingcouncil-procedures
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
Fri Feb 14, 2025 · 10:00 AM

City Council Meeting

Council considers $17.25 million in bonds for The Journey housing project

The City Council is considering the issuance of Multifamily Housing Revenue bonds for a 40-unit development. The body is also hearing protests and objections regarding nuisance abatement liens for three properties.

housingbondsnuisance-abatementliens
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Feb 12, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers extending Prop HHH funding for six housing projects

The Housing and Homelessness Committee will hear a verbal update on Measure A goals, a mayoral communication appointing Kristal Romero to a citizen oversight committee, and several administrative reports. It will also consider extending Prop HHH funding for four Permanent Supportive Housing Loan projects and two Housing Challenge projects. The meeting includes discussion items only and reports with fiscal impact statements.

housinghomelessnessprop-hhhfundingreportsmeasure-a
✓ Decided: Committee approves Prop HHH funding extensions for six housing projects

The Housing and Homelessness Committee approved extending Prop HHH funding commitments for four Permanent Supportive Housing Loan Program projects and two Housing Challenge projects, as recommended in a February 7, 2025 report. The committee also approved the mayor's appointment of Kristal Romero to the United to House LA Citizen Oversight Committee and approved the 23rd Homelessness Emergency Account status report as amended. Several other reports were noted and filed, including the Alliance Settlement Agreement progress and the State Shelter Crisis Declaration status. No action was taken on the Measure A update discussion item.

Notable items
Wed Feb 12, 2025 · 03:30 PM

Public Works Committee

Public Works Committee to consider street closures and renaming intersections

The Public Works Committee will consider closing a section of Blinn Avenue to traffic and restricting access to Drumm Avenue, as well as temporarily closing a street and walkway in Harbor City for public safety. The meeting also includes items to rename several intersections and amend contracts for waste disposal services.

public-safetystreet-closurezoningwaste-managementtransportationharbor-city
✓ Decided: Committee approves 9 items including street closures and intersection designations

The Public Works Committee unanimously approved all nine agenda items, including motions to designate intersections as honorary squares, close streets for public safety, and amend recycling contracts. No items were denied or tabled.

Notable items
Wed Feb 12, 2025 · 08:30 AM

Transportation Committee and Special Joint Meeting with Public Works Committee

Committee to consider draft ordinance implementing Measure HLA and Safe Streets

The Transportation Committee and Public Works Committee will discuss several motions, including the status of the transit vehicle advertising contract and a Measure M project plan for District 15. They will review a draft ordinance amending the Administrative and Municipal Codes to implement Measure HLA, the Safe Streets for All Initiative, and Mobility Plan 2035. Budget recommendations will be considered for a Healthy Streets LA implementation plan and for creating a traffic‑calming unit within the Department of Transportation. A DOT report on speeding up transportation infrastructure projects and an update on the 2028 Olympic transportation plan will also be presented.

transportationbudgethousingmeasure-hlasafe-streetsmobility-planmeasure-mpublic-works
✓ Decided: LA transportation committee approves transit ad contract review and CD15 Measure M plan

The Transportation Committee approved three motions: one to review the transit vehicle advertising contract and 2023 RFP, one for a CD15 annual project plan for Measure M funding, and one to study affordable housing and a mobility hub on Parking Lots 701/731. It also received and filed a budget recommendation to create a traffic calming unit in LADOT. Several items, including the Measure HLA ordinance and 2028 Olympics transportation plan, were continued to a later date.

Room 401
Notable items
Wed Feb 12, 2025 · 10:00 AM

City Council Meeting

City Council to authorize $65M bond for CD2 school facilities

The Los Angeles City Council will consider authorizing up to $65 million in bonds to finance educational facilities at 4533 Laurel Canyon Boulevard in Council District Two. The body will also discuss a lease for a Little Tokyo memorial site and a report on allowing existing medical marijuana dispensaries to continue operations.

budgeteducationzoningcannabiscity-councilbondpublic-works
✓ Decided: Council adopts ordinance to temporarily ban wildfire-displacement evictions

The Los Angeles City Council adopted an ordinance on first reading that temporarily prohibits residential evictions solely based on housing persons or pets displaced by the January 2025 wildfires. The council also approved a $65 million bond issuance for educational facilities in Council District 2, and directed reports on revenue generation, cannabis regulations, and other items. All items were adopted unanimously or with the recorded vote tallies.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Adopted Motion (Harris­Dawson – Yaroslavsky) to refer Amending Motion 8A - SEE ATTACHED (Rodriguez, Park – Padilla) to the Rules, Elections, and…
9 yea · 4 nay · 1 absent
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Jurado yea · Hutt yea · Nazarian yea · Price Jr yea · Soto­Mart ínez yea · Lee nay · Padilla nay · Park nay · Raman nay · Elections absent · Rodriguez yea
The other 9 items passed by unanimous or near-unanimous consent.
Wed Feb 12, 2025 · 01:00 PM

Personnel and Hiring Committee - SPECIAL MEETING - REVISED

City to consider wage increase for Water and Power staff classifications

The Personnel and Hiring Committee will hear a report on Los Angeles Fire Department payroll issues related to the Workday system and consider funding options for a new staff scheduling system. It will also review the Fiscal Year 2024‑25 departmental personnel ordinances and several mayoral exemptions of civil‑service positions. Finally, the committee will consider an ordinance to amend Schedule B and raise base wages for certain classifications in the Department of Water and Power.

personnelpayrollfire-departmentwageswater-powercivil-service
Room 401
Tue Feb 11, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to review Olympic venue exemptions and several major development projects

The Planning and Land Use Management Committee will discuss zoning changes for new residential and commercial buildings. The body is also considering an ordinance to exempt 2028 Olympic and Paralympic facilities from certain city planning and zoning regulations.

zoninghousingolympicshistoric-preservationcommercial-development
✓ Decided: Committee approves multiple land use items, denies two appeals

The Planning and Land Use Management Committee approved several items, including historic monument designations for Clinton Manor Courtyard Apartments and The Barn, a zone and height district change for a storage facility on North Seward Street, a mixed-use hotel and apartment project on West 8th Street, and a report on advertising in private parking lots. It also adopted a resolution on COVID-19 small business relief and a motion to draft an ordinance exempting Olympic venues from certain planning approvals. The committee denied appeals against a residential project on South Berendo Street and a restaurant with alcohol sales on Santa Monica Boulevard, and continued a Runyon Canyon project to March 25, 2025.

Notable items
Tue Feb 11, 2025 · 02:00 PM

Trade, Travel, and Tourism Committee

Committee to review LAX construction contracts and harbor facility permits

The Trade, Travel, and Tourism Committee will discuss several airport infrastructure and maintenance contracts. The body will also consider permits for sulfur processing facilities at the harbor.

aviationportscontractsinfrastructurelax
✓ Decided: Committee approves 51 LAX design-build contracts

The Trade, Travel, and Tourism Committee unanimously approved all six agenda items, including authorizing 51 task order contracts for LAX capital improvements, amendments to airport contracts with Motorola Solutions and Integrated Security Solutions, a lease amendment with Jacobsen|Daniels Associates, and two sulfur facility permits at the Port of Los Angeles. All votes were 3-0.

Notable items
Tue Feb 11, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee reviews Measure A grant extension for Venice Pier Improvement Project

The Arts, Parks, Libraries, and Community Enrichment Committee will hear six reports, including a recommendation to extend the Measure A grant performance period for the Venice Pier Improvement Project. Other items include a park assessment update, library publishing agreements, a garden boundary amendment, and L.A. for Kids program updates.

parkslibrariesgrantmeasure-acommunity-gardenyouth-programs
✓ Decided: Committee approves Venice Pier Measure A grant extension and other park/library items

The Arts, Parks, Libraries, and Community Enrichment Committee approved five items unanimously (3-0), including extending the Measure A grant performance period for the Venice Pier Improvement Project, authorizing four publishing agreements for the Library's Angel City Press, amending an agreement with the Los Angeles Community Garden Council for the Solano Canyon Community Garden, and approving Proposition K program reconciliation and the infeasibility of the Ardmore Recreation Center Project. The committee also continued a verbal report on the park assessment to a date to be determined.

Notable items
Tue Feb 11, 2025 · 10:00 AM

City Council Meeting

City Council to hear protests on four street lighting districts

The Los Angeles City Council will hold public hearings to hear protests regarding the proposed improvement and maintenance of four specific street lighting districts. These hearings are conducted in accordance with the Los Angeles Administrative Code and Proposition 218.

street-lightingpublic-hearingsinfrastructureproposition-218
✓ Decided: Council approves $17M and $18M bonds for two affordable housing projects

The Los Angeles City Council approved issuing up to $17 million in Multifamily Housing Revenue Bonds for the 52-unit Rousseau Residences at 316 North Juanita Avenue and up to $18 million for the 53-unit Montesquieu Manor at 318 North Juanita Avenue, both in Council District 13. The council also approved several LAX-related contracts, including a $13.8 million increase for the Central Terminal Area Curbside Improvement Program and a $52.4 million increase for the Baggage Optimization Project Phase 2. Additionally, the council adopted a motion to instruct LADOT to report on the LA RiverWay Phase IV project and approved a motion to establish a Civil Rights Trust Fund.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
Ordinance will take place at Council on March 18, 2025.) Adopted Item
104 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Tuesday - February yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Ordinance will take place at Council on March 18, 2025.) Adopted Item to Continue to February 25, 2025
16 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Soto­ Mart​ínez yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Soto­ Mart​ínez yea
[context] Adopted Item
26 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ MARCH 17, 2025 (LAST DAY FOR COUNCIL ACTION ­ MARCH 14, 2025) Adopted Item Tuesday - February 11, 2025 - PAGE 8
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ FEBRUARY 28, 2025 Tuesday - February 11, 2025 - PAGE 9 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 28, 2025) Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ MARCH 17, 2025 (LAST DAY FOR COUNCIL ACTION ­ MARCH 14, 2025) Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ FEBRUARY 13, 2025 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 12, 2025) Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Motion (Nazarian – Hernandez) - SEE ATTACHED
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
ordinance to establish the Civil Rights Trust Fund. Fiscal Impact Statement: Neither the CAO nor the CLA has completed a financial analysis of this report. Community Impact Statement: None submitted…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
Ordinance to amend Los Angeles Municipal Code Section 21.51a(4) to specifically exclude the State excise tax from the definition of gross receipts. Fiscal Impact Statement: None submitted by the…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
to accept and expend the 2024 FCB CDG of $200,000 to assist more low­income homebuyers and apply for the 2025 FCB CDG of $200,000. Community Impact Statement: None submitted Adopted Item
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
that the Mayor’s correction to the term expiration of the appointment to the Metropolitan Water District of Southern California Board of Directors of Carl Douglas from June 30, 2026 to December 31…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] If public hearing is not held in Committee, an opportunity for public comment will be provided.) (Please visit www.lacouncilfiun.com for background documents.) Community Impact Statement…
9 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted (URGENCY CLAUSE ­ 12 VOTES REQUIRED ON SECOND READING) Adopted Motion (Yaroslavsky – Hernandez) - SEE ATTACHED
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Soto­Mart​ínez yea
RESOLUTION removing the property at 2016 South Bedford Street (Case No. 809541), Assessor I.D. No. 4302­023­004, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
RESOLUTION removing the property at 2103 South 3rd Avenue (Case No. 830265), Assessor I.D. No. 5060­028­001, from the REAP. Fiscal Impact Statement: None submitted by the LAHD. Neither the City…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Mon Feb 10, 2025 · 06:00 PM

Los Angeles City Health Commission Meeting

Commission to review LAFD Emergency Medical Services staffing, budget, and programs

The Los Angeles City Health Commission will consider a presentation by Dr. Marc Cohen, Medical Director of the Los Angeles Fire Department, on oversight of the LAFD Emergency Medical Services Division, including staffing, budget, strategic planning, diversion programs, and mental‑health treatment approaches. The Commission may take action based on the presentation. The meeting also includes routine items such as approval of minutes, Neighborhood Council comments, and a public comment period.

healthemergency-medical-servicesbudgetstaffingmental-healthpublic-commentcity-health-commission
Room 340
Fri Feb 7, 2025 · 10:15 AM

City Council Meeting

Council considers lease for parcels under Santa Fe Avenue Overpass

The City Council is meeting to discuss a proposed lease for three remnant parcels under the Santa Fe Avenue Overpass and a contract amendment for LADWP network services. The body is deciding whether to direct the Bureau of Engineering to negotiate a lease with the owner of 2426 Washington Boulevard.

real-estateinfrastructurecontractsladwputilities
✓ Decided: Council adopts housing ordinances and wildfire relief measures

The Los Angeles City Council adopted several items, including ordinances to implement the Housing Element rezoning program, the Housing Element Sites and Minimum Density Ordinance, and the Resident Protections Ordinance, all with 14-0 votes. The council also approved wildfire-related relief, including a tax relief ordinance for businesses impacted by the January 2025 wildfires (referred to committee for further consideration) and a motion to fund a temporary relief fund for CD 7 workers in burned areas. Additionally, the council approved LADWP contract amendments and extensions, and continued consideration of a lease for parcels under the Santa Fe Avenue Overpass to March 11, 2025.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
that the Council action of February 22, 2022 relative to the vacation of the alley southerly of Washington Boulevard from the alley easterly of Santa Fe Avenue to its easterly terminus (Council file…
8 yea
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea
[context] Community Impact Statement: None submitted Adopted Item
12 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ FEBRUARY 14, 2025 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 14, 2025) Adopted Item
27 yea · 9 absent
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent · Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent · Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent
[context] January 17, 2025 Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
9 yea · 3 absent
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent
[context] Adopted Item
21 yea · 3 absent
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Ad Hoc Committee for LA Recovery Report - SEE ATTACHED
9 yea · 3 absent
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent
[context] Friday - February 7, 2025 - PAGE 10 Community Impact Statement: None submitted Adopted Economic Development and Jobs Committee Report and Ad Hoc Committee for LA Recovery Report - SEE…
9 yea · 3 absent
Blumenfield yea · Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Hernandez absent · Nazarian absent · Park absent
[context] (Continued from Council meeting of January 7, 2025) Adopted to Continue Item to February 25, 2025
10 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Fiscal Impact Statement: Not applicable Community Impact Statement: None submitted Adopted Item
24 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted URGENCY CLAUSE – 12 VOTES REQUIRED (Planning and Land Use Management Committee waived consideration of the above matter) Adopted Item
36 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Rodriguez yea · Soto­Mart​ínez yea
Fri Feb 7, 2025 · 01:00 PM

Budget and Finance Committee

Committee discusses tax relief for businesses hit by January 2025 wildfires

The Budget and Finance Committee is meeting to discuss tax relief for local businesses impacted by recent wildfires. The body will also consider fund transfers for crossing guard services and fire department salaries, and hold closed sessions regarding legal litigation.

tax-reliefwildfiresbudgetpublic-safetylitigation
Fri Feb 7, 2025 · 02:00 PM

Civil Rights, Equity, Immigration, Aging and Disability Committee

Draft ordinance to define Office of Race and Equity considered by committee

The Civil Rights, Equity, Immigration, Aging and Disability Committee will meet on February 7, 2025 to consider several agenda items. Items include a mayoral communication appointing Thela Thatch, a draft ordinance amending Section 22.1223 to define the Office of Race and Equity, and a report on the 50th program year of the Housing and Community Development Administrative Funds. The committee will also discuss a motion to develop a city land acknowledgement policy, authorizations for grant awards to the Community Investment for Families Department, and a request for a memorandum of understanding for a Domestic Violence Restraining Order Enforcement Task Force. Public comment will be accepted in person only, with no teleconference.

equityhousinggrantspublic-safetyagingdisabilityordinance
✓ Decided: Committee approves all 7 items, including land acknowledgment policy motion

The Civil Rights, Equity, Immigration, Aging and Disability Committee unanimously approved all seven agenda items, including a motion to develop a city land acknowledgment policy, an ordinance to strengthen the Office of Race and Equity, and several grant acceptances. All votes were 5-0.

Thu Feb 6, 2025 · 10:00 AM

Ad Hoc Committee for LA Recovery

Committee considers reallocating funds to Emergency Rental Assistance program

The Ad Hoc Committee for LA Recovery will receive agency updates on wildfire insurance, debris removal, water quality, staffing needs, and long‑term recovery plans. It will consider several motions and a city‑attorney ordinance, including a motion to shift United to House LA Fund money to the Emergency Rental Assistance (ERA) Program. Other items include proposals for a Climate Resilience District, fee waivers for fire‑damaged rebuilds, and additional parking permits for displaced residents.

wildfire-recoverybudgethousingpermitszoningpublic-worksclimate-resilience
✓ Decided: Committee approves wildfire recovery measures including tax relief and rental assistance

The Ad Hoc Committee for LA Recovery approved a series of wildfire recovery measures, including tax relief for impacted businesses, emergency rental assistance funding, and a resolution supporting legislation to prevent investor concentration in fire-damaged areas. The committee also approved motions on debris flow protection, reemploying retired workers, and additional parking permits for those sheltering displaced residents. Several items were discussion-only with no action taken, and one insurance update was continued to a future date.

Notable items
Wed Feb 5, 2025 · 10:00 AM

City Council Meeting

City Council to hear protests on nuisance abatement liens

The City Council will hold public hearings to hear protests, appeals, or objections regarding proposed liens for nuisance abatement and code violations. The body will decide whether to confirm these liens for four specific properties.

nuisance-abatementcode-violationspublic-hearingsliens
✓ Decided: Council approves $32.5M inspectors union contract, denies Sunset Blvd appeal

The Los Angeles City Council approved a 2024-2029 Memorandum of Understanding with the Municipal Construction Inspectors Association, Inc. (MCIA) for the Inspectors Representation Unit (MOU 05), with an annual ongoing cost of $32.5 million. The Council also denied a CEQA appeal filed by SAFER, sustaining the Planning Commission's approval of a five-story, 121-unit mixed-use building at 2511-2517 West Sunset Boulevard. Additionally, the Council confirmed numerous nuisance abatement liens on properties across the city and adopted several motions related to parking restrictions, street lighting, and sidewalk vending.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Wednesday - February 5, 2025 - PAGE 30 Adopted Motion (Hutt – Padilla) - SEE ATTACHED
10 yea · 2 nay
Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay
[context] Community Impact Statement: None submitted Adopted Motion (Hutt – Padilla) - SEE ATTACHED
20 yea · 4 nay
Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay · Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay
[context] (This matter arises from an in­custody death that occurred on April 8, 2019 and involved Los Angeles Police Department officers that encountered a man sitting in the driveway of a 76 Gas…
9 yea · 2 nay
Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Park yea · Price Jr yea · Raman yea · Soto­Martínez yea · Hernandez nay · Jurado nay
The other 32 items passed by unanimous or near-unanimous consent.
Wed Feb 5, 2025 · 02:30 PM

Housing and Homelessness Committee

Committee considers rent pause and eviction protections following January 2025 fires

The Housing and Homelessness Committee will discuss ordinances to prohibit certain evictions for tenants facing hardship from the January 2025 fires and a rent increase pause for all residential units. The body will also consider a license agreement extension for bridge housing and a contract for temporary paralegals.

housingevictionsrent-controlhomelessnessemergency-relief
✓ Decided: Committee approves fire-related tenant protections and rent pause

The Housing and Homelessness Committee approved a motion to draft ordinances that would prohibit certain evictions for tenants facing economic or medical hardship from the January 2025 fires, pause rent increases for all residential units, and suspend LAMC Section 151.06(G) through January 31, 2026. The motion also authorizes the LAHD to execute a sole source contract with Partners in Diversity for temporary paralegals. The vote was 3 yes, 1 no (Blumenfield), 1 absent (Price). A separate item on a license agreement extension for El Puente Bridge Housing was continued to a date to be determined.

Notable items
Wed Feb 5, 2025 · 03:30 PM

Public Safety Committee

Police receive $202,000 ALPR camera donation from foundation

The Public Safety Committee will review reports and motions on several safety topics, including a non‑monetary donation of Automated License Plate Recognition equipment valued at $202,000 to the LAPD West Division. Other items include a motion to assess equipment and training for electric‑vehicle fire mitigation, grant funding for an impaired‑driving prosecution program, and a reward payment for information on a homicide. The committee will also hear a report on firework buy‑back locations and a survey of Red Flag streets in high‑hazard fire zones.

public-safetypolicegrantsequipmentfire-prevention
Notable items
Tue Feb 4, 2025 · 02:00 PM

Budget and Finance Committee

Committee considers tax relief for businesses impacted by January 2025 wildfires

The Budget and Finance Committee will discuss various city reports, grant applications, and funding reallocations. The body is also reviewing a draft ordinance for wildfire-related tax relief and several legal settlements in closed session.

taxeswildfiresgrantslegal-servicesbudgetpublic-safety
Notable items
Tue Feb 4, 2025 · 08:30 AM

Government Operations Committee

Committee reviews fire safety training contract and multiple city policy motions

The Government Operations Committee will hear a report on a proposed supplemental agreement with Building Safety Solutions for fire and life‑safety training for city employees. It will also consider reports on unauthorized cannabis activity, a housing project at 12901 West Venice Boulevard, and several council‑district motions on library renovations, land lease for a memorial, medical marijuana dispensary licensing, cannabis social‑equity program, and a nonprofit lease for crisis response services.

government-operationstrainingcannabishousinglibraryleasemarijuanasocial-equity
✓ Decided: Committee approves fire safety training contract and cannabis-related motions

The Government Operations Committee approved a supplemental agreement with Building Safety Solutions for fire/life safety training services for City employees, and approved several motions including one on the status of Benjamin Franklin Library renovations, a lease for the Go For Broke Memorial site, a motion on the Social Equity Business program, and a nonprofit lease with Sycamores. The committee also noted and filed a report on unauthorized cannabis activity and continued a discussion on a proposed project at 12901 West Venice Boulevard.

Room 401
Notable items
Tue Feb 4, 2025 · 10:00 AM

City Council Meeting

Council to consider nuisance abatement liens on five properties

The City Council will hear protests, appeals, or objections and decide whether to confirm proposed liens for nuisance abatement and code‑violation costs on five separate properties. Each item includes a specific lien amount. The Council will vote on each recommendation after public comment.

budgethousingcode-enforcementpublic-hearingsliens
✓ Decided: Council confirms 11 nuisance abatement liens, continues 6 others

The Los Angeles City Council voted unanimously to confirm 11 nuisance abatement liens for unpaid code enforcement costs, receive and file 3 liens (two paid, one owner-occupied), and continue 6 lien items to future dates. The council also approved a $50,000 LA2050 grant for the Department of Neighborhood Empowerment, a resolution supporting City Hall's nomination to the National Register of Historic Places, and a motion to reject a settlement in a fireworks incident lawsuit.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) Adopted to C ontinue Item to October 7, 2025
14 yea · 1 nay
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martinez yea · Yaroslavsky yea · Tuesday -February nay
The other 19 items passed by unanimous or near-unanimous consent.
Tue Feb 4, 2025 · 02:00 PM

Economic Development and Jobs Committee

Committee to appropriate $105,588 from CRA/LA bond proceeds for La Guadalupe project

The Economic Development and Jobs Committee will review several reports on workforce planning and Business Improvement Districts. It will consider a motion to amend a prior council action for the Neighborhood Enhanced Network Project. The committee will decide on appropriating up to $102,841 plus $2,747 interest (total $105,588) from CRA/LA Excess Non‑Housing Bond proceeds for the La Guadalupe Commercial Improvement Project. A motion on a Memorandum of Understanding for the Small Business Relief Fund and Worker Relief Fund will also be discussed.

budgeteconomic-developmentbondsbusiness-improvement-districtsredevelopmentsmall-businesscommunity-funding
✓ Decided: Committee approves LA Convention Center expansion status report

The Economic Development and Jobs Committee approved the status report on the Los Angeles Convention Center Expansion, as amended, and noted and filed the Department of Convention and Tourism Development report. The committee also approved motions for small business and worker relief funds related to windstorms and wildfires, and approved annual planning reports for several property-based business improvement districts. Two items were continued to a date to be determined.

Room 401
Notable items
Tue Feb 4, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers joining the 30x30 Conservation campaign to protect city land

The Energy and Environment Committee will hear a motion on the feasibility of Los Angeles independently joining the 30x30 Conservation campaign, which aims to conserve 30 percent of city land for open space. The meeting also includes reports on the Watts Civic Center Serenity Greenway project, integrating climate considerations into the city budget, and the Building Decarbonization Workplan.

environmentclimateconservationbudgetdecarbonizationpublic-comment
Notable items
Fri Jan 31, 2025 · 08:30 AM

Personnel and Hiring Committee

Committee will consider a motion on LAFD payroll issues with Workday system

The Personnel and Hiring Committee will discuss Motion 25-0073, a proposal by Councilmember McOsker and Hernandez addressing payroll problems at the Los Angeles Fire Department linked to the Workday payroll system. No community impact statement was submitted. Public comment is permitted in person only, with no teleconference option.

payrollfire-departmentpersonnelhiringworkdayla-city
✓ Decided: LA committee continues discussion of LAFD payroll issues

The Personnel and Hiring Committee met on January 31, 2025, and considered a motion regarding payroll issues at the Los Angeles Fire Department related to the Workday payroll system. The item was continued, meaning no final action was taken. No other substantive decisions were made.

Van Nuys City Hall
Fri Jan 31, 2025 · 10:00 AM

City Council Meeting

Council to consider $815,317 developer payment for NoHo Sign District

The Los Angeles City Council will act on two Government Operations Committee reports: one on installing baby changing stations in public restrooms and another updating the records disposition schedules for the Department of Building and Safety. The council will also consider a motion to accept a $815,317 payment from the developer of the District NoHo Sign District, to be deposited in a new CD 2 Real Property Trust Fund, subject to mayoral approval.

accessibilityrecords-managementfinancedevelopmentpublic-restroomscity-government
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Wed Jan 29, 2025 · 10:00 AM

City Council Meeting

Council considers $5 million digital inclusion services contract

The Los Angeles City Council is meeting to decide on a personal services contract for digital inclusion and a nuisance abatement lien. The body will also consider an appeal regarding a 327-unit housing development project.

digital-inclusioncontractshousingnuisance-abatementzoning
✓ Decided: Council approves 327-unit Sunset Blvd housing project, denies appeal

The City Council approved a 327-unit mixed-use housing development on Sunset Boulevard, including 41 very low-income units, and denied an appeal from the Supporters Alliance for Environmental Responsibility (SAFER). The council also approved a $5 million personal services contract with Human-I-T for digital inclusion services, and referred a motion on tenant protections related to the January 2025 fires to committee. Several properties were removed from the Rent Escrow Account Program (REAP).

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted Motion (Yaroslavsky – Harris-Dawson) Called Item to Question – Failed of Adoption
8 yea · 4 nay · 1 absent
Blumenfield yea · Harris-Dawson yea · Hutt yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Lee nay · Soto-Martínez nay · Price Jr absent
[context] Amending Motion 15 D & 15E – SEE ATTACHED
9 yea · 3 nay
Blumenfield yea · Harris-Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Raman yea · Yaroslavsky yea · Hernandez nay · Jurado nay · Soto-Martínez nay
The other 14 items passed by unanimous or near-unanimous consent.
Wed Jan 29, 2025 · 02:30 PM

Housing and Homelessness Committee

Housing Dept. proposes technical amendments to rent stabilization and eviction ordinances

The committee will hear updates on rent‑gouging, homelessness funding, and several city reports. The only item involving a proposed ordinance is a draft to standardize tenant notification requirements in the Rent Stabilization Ordinance and the Just Cause for Eviction Ordinance. No votes or actions are scheduled; all items are discussion‑only updates.

housingrent-stabilizationevictionhomelessnesscity-reports
✓ Decided: Committee approves tenant notification standardization report

The Housing and Homelessness Committee approved a Los Angeles Housing Department report on drafting an ordinance to standardize tenant notification requirements in the Rent Stabilization Ordinance and Just Cause for Eviction Ordinance. The vote was 3 yes, with Councilmembers Price and Nazarian absent. All other agenda items were discussion-only or continued to a later date.

Notable items
Tue Jan 28, 2025 · 08:45 AM

Arts, Parks, Libraries, and Community Enrichment Committee

Committee to discuss park hours, fire safety, and grant funding

The Arts, Parks, Libraries, and Community Enrichment Committee will consider motions regarding park operating hours, fire safety closures, and grant funding for traffic safety programs. The body will also discuss a proposal to microchip pets and a plan to create historic markers in South Los Angeles.

parkszoningpublic-safetygrantstrafficanimal-servicescouncil-committee
✓ Decided: Committee approves five motions, continues two items

The Arts, Parks, Libraries, and Community Enrichment Committee approved five motions and continued two items. Approved motions include operating hours for Amistad Pocket Park, a grant application for the 'Connecting Neighbors and Empowering LA!' initiative, the 'South LA Historic Neighborhood Markers' project, a study to convert Wilton Place closure into a parklet, and adding West Lakeside Street Park to the list of parks with specific hours. The committee continued the microchipping feasibility report and the park closure ordinance for Red Flag Days to a date to be determined. No action was taken on the grant awards for child passenger and pedestrian/bicycle safety programs.

Notable items
Tue Jan 28, 2025 · 10:00 AM

City Council Meeting

Council considers transferring $219.3 million from LADWP to City Reserve Fund

The Los Angeles City Council is meeting to discuss several administrative and financial matters. Key items include a large surplus fund transfer and a public hearing regarding a property lien.

budgetladwpinfrastructureappointmentsnuisance-abatement
✓ Decided: Council approves $219M LADWP surplus transfer to city reserve fund

The Los Angeles City Council approved a series of routine items, including the transfer of $219,312,000 from the LADWP Power Revenue Fund to the city's Reserve Fund for FY 2024-25. The council also authorized contract amendments for DASH transit services, approved several district-specific funding motions, and adopted multiple legal settlements from closed session. All votes were unanimous (15-0).

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (26 roll-call votes)
Named votes as recorded in the official record.
[context] (Lien: $1,276.56) (Continued from Council meeting of January 14, 2025) Tuesday - January 28, 2025 - PAGE 1 Adopted Item to Continue to February 4, 2025
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the Mayor’s appointment of Angelic Perez to the Community Forest Advisory Committee, at the request of Councilmember Eunisses Hernandez, as the Council District One primary representative, is…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Resolution No. 025­112, which approves the transfer of $219,312,000 from the Power Revenue Fund of the LADWP to the Reserve Fund of the City during FY 2024­25. 2. PRESENT and ADOPT the accompanying…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted Adopted Item
39 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
ORDINANCE FIRST CONSIDERATION relative to amending the Los Angeles Municipal Code (LAMC) regarding the administration of the Board of Review. Recommendation for Council action, SUBJECT TO THE…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the City’s financial obligation is limited to funds budgeted for this purpose, and future expenditures are limited to appropriation of funds provided in the budget. TIME LIMIT FILE ­ MARCH 17…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Tuesday - January yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the City’s financial obligation is limited to funds budgeted for this purpose and future expenditures are limited to appropriation of funds provided in the budget. TIME LIMIT FILE ­ MARCH 17…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Adopted Item
52 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Resolution No. 23­10195 authorizing approval of the proposed Sixth Seventh Amendment to Amended and Restated Agreement No. 17­3425­A between the POLA and Wabtec Transportation Systems, LLC, to…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] *Journal Correction Adopted Item
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (Budget and Finance Committee considered this matter on January 21, 2025.) Community Impact Statement: None submitted Adopted Motion (Yaroslavsky – Blumenfield), in Open Session - SEE…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from the June 30, 2021, incident in which the Los Angeles Police Department Bomb Squad detonated explosive material.) (Budget and Finance Committee considered this…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter concerns property damage that occurred when a parkway tree fell on a residence located at 3623 West 63rd Street, in Los Angeles.) (Budget and Finance Committee considered this…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a motor vehicle accident that occurred on January 6, 2023, at the intersection of 248th Street and Baypoint Avenue, in Los Angeles.) (Budget and Finance Committee…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a vehicle versus vehicle traffic collision on April 5, 2021, at the intersection of Pacific Coast Highway and Driftwood Drive.) (Budget and Finance Committee…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a fall Tuesday - January 28, 2025 - PAGE 15 incident on April 19, 2021, near 1111 Wilshire Boulevard, in the City of Los Angeles.) (Budget and Finance Committee…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a vehicle versus vehicle traffic accident on March 1, 2022, on Topanga Canyon Boulevard at its intersection with Roscoe Boulevard, in the City of Los Angeles.)…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a trip and fall incident on September 4, 2023, at 1663 Butler Avenue, in Los Angeles.) (Budget and Finance Committee considered this matter on January 21, 2025.)…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a vehicle versus vehicle traffic accident on May 9, 2021, at Broadway and 67th Street, in Los Angeles.) (Budget and Finance Committee considered this matter on…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (This matter arises from a trip and fall incident on November 1, 2019, at 2600 Wilshire Boulevard, Los Angeles, California 90057.) (Budget and Finance Committee considered this matter on…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Tue Jan 28, 2025 · 02:00 PM

Planning and Land Use Management Committee

Committee to review EV charging permits and mixed-use housing appeals

The Planning and Land Use Management Committee will discuss streamlining permits for electric vehicle charging stations and designating two sites as Historic-Cultural Monuments. The body will also hear appeals regarding two mixed-use residential developments on West Sunset Boulevard.

zoningelectric-vehicleshousinghistoric-preservationpermitsland-use
✓ Decided: Committee denies appeals, sustains approvals for two Sunset Blvd housing projects

The Planning and Land Use Management Committee denied appeals by SAFER and sustained the City Planning Commission's approvals for two mixed-use housing developments on Sunset Boulevard: a 327-unit project with 41 very low-income units and a 121-unit project with 13 extremely low-income units. The committee also approved several motions and reports, including streamlining EV charging station permits and adding historic monuments.

Notable items
Tue Jan 28, 2025 · 02:00 PM

Trade, Travel, and Tourism Committee

Amendments to LAX in-terminal concession agreements and SOP adoption

The Trade, Travel, and Tourism Committee will consider seven agenda items, each a report from the Airport Commissioners and a related board resolution. Items include amendments to LAX concession agreements, funding for LAX roadway and utilities work, design contracts for curbside and baggage projects, a parking sublease at Van Nuys Airport, a consulting contract with Deloitte, and a lease amendment for a Korean Air passenger lounge. All items have fiscal impact statements and categorical CEQA exemptions. The committee may also hear general public comment.

airportconcessionscontractsinfrastructurefinanceceqaparking
✓ Decided: Committee approves all 7 LAX/Van Nuys airport items

The Trade, Travel, and Tourism Committee approved all seven agenda items, each related to airport concessions, contracts, or leases at LAX or Van Nuys Airport. All approvals were unanimous (2-0) with Councilmember Rodriguez absent. The items include amendments to concession agreements, contract replenishments, and new agreements, all with CEQA exemptions.

Notable items
Fri Jan 24, 2025 · 08:30 AM

Personnel and Hiring Committee

Mayor announces reappointment of Guy Lipa to Civil Service Commission

The Personnel and Hiring Committee will hear a mayoral communication about the reappointment of Guy Lipa to the Board of Civil Service Commissioners through June 30, 2029. Several reports and ordinances will be considered, mainly involving LADWP salary and duties adjustments and CAO memoranda of understanding. The committee will also consider a motion on city personnel emergency assistance programs.

personnelcivil-servicesalaryordinanceemergency-assistance
✓ Decided: Committee approves Guy Lipa reappointment to Civil Service Commission

The Personnel and Hiring Committee approved all agenda items, including the reappointment of Guy Lipa to the Board of Civil Service Commissioners, several salary and classification changes, and a new MOU for inspectors. Items were approved with 2 yes votes and 1 absence (Rodriguez).

Room 401
Fri Jan 24, 2025 · 08:45 AM

Personnel and Hiring Committee - SPECIAL MEETING

Committee to discuss LAFD payroll issues

The Personnel and Hiring Committee will hold a special meeting to receive a verbal update regarding payroll issues at the Los Angeles Fire Department. Representatives from the LAFD, Information Technology Agency, Controller, Personnel Department, and City Administrative Officer will provide the update.

payrolllafdpersonnelcity-administration
Room 401
Fri Jan 24, 2025 · 10:00 AM

City Council Meeting

Council considers $4.1 million for homelessness services in District 1

The Los Angeles City Council will discuss transferring funds for outreach and housing services in Council District 1. The body will also hear protests regarding a street lighting district.

homelessnessbudgethousingstreet-lightingpublic-hearing
✓ Decided: Council seeks wildfire tax relief for destroyed businesses

The City Council adopted a motion requesting the City Attorney, with the Office of Finance, to prepare an urgency ordinance providing gross receipts tax relief for businesses destroyed by wildfires or impacted for 60+ consecutive days in 2025. The motion passed unanimously with 14 ayes and no nays. No other substantive decisions were recorded.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
[context] Adopted Motion (Park — Yaroslavsky) Forthwith - SEE ATTACHED
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · HSutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea
Ordinance to provide relief from the payment of the gross receipts tax for the 2025 tax year for businesses within the City of Los Angeles that have been destroyed by the wildfires, or that have been…
14 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Yaroslavsky yea · pay’ Price Jr yea
Wed Jan 22, 2025 · 08:30 AM

Transportation Committee

Committee will consider a third amendment to the Downtown DASH contract.

The Transportation Committee will review City Administrative Officer reports on third amendments to contracts with MV Transportation for Downtown, Mid‑City and Central DASH services and LAnow Transit Bus service. It will also hear a Board of Public Works report on revising the Streets of Significance for the Purple Line Extension Project. Additional items include motions and resolutions on traffic signage, overnight parking enforcement, tow‑away restrictions, and a study of DASH fare‑free operation costs.

transportationdashcontractsparkingsignagepurple-linepublic-works
✓ Decided: Transportation Committee approves DASH contract amendments and fare-free study

The Transportation Committee approved two contract amendments with MV Transportation for DASH services, a report on Purple Line Extension streets, and a motion to study DASH fare-free operations. Three resolutions were submitted without recommendation, and one motion was continued.

Room 401
Notable items
Wed Jan 22, 2025 · 10:00 AM

City Council Meeting

Council to approve $660,000 youth program grant for parks

The Los Angeles City Council will consider three main actions. It will adopt a draft ordinance that updates the method for annual park fee adjustments. It will confirm the mayor’s appointment of Navdeep "Duncan" Sachdeva to the Central Los Angeles Area Planning Commission. It will authorize the Department of Recreation and Parks to receive a $660,000 grant for the Clean and Safe Spaces Parks Youth Employment Internship Program.

park-feesordinanceappointmentyouth-programgrantcouncil
✓ Decided: Council establishes Ad Hoc Windstorm and Wildfire Recovery Committee

The Los Angeles City Council unanimously approved establishing an Ad Hoc Windstorm and Wildfire Recovery Committee to oversee state and federal aid, city department responses, and recovery policy related to the January 2025 fires. The council also approved several other items, including a park fee ordinance revision, a planning commission appointment, a youth employment grant, a Walk of Fame star for Jim Nantz, and multiple funding allocations. All votes were unanimous with no opposition.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
[context] Community Impact Statement: None submitted (Scheduled pursuant to Government Code Sections 66018 and 6062a) (Neighborhoods and Community Enrichment Committee waived consideration of this…
12 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
that the Mayor’s appointment of Navdeep "Duncan" Sachdeva to the CLAAPC for the term ending June 30, 2027, is APPROVED and CONFIRMED. Appointee currently resides in Council District 4. (Current…
10 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
that the JJCPA Grant is administered on a reimbursement basis from the County to allow the RAP the ability to negotiate services in a timely manner. Acceptance of this Grant has no fiscal impact on…
10 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted Adopted Item
24 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Adopted Item
36 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
[context] Community Impact Statement: None submitted (Rules, Elections, and Intergovernmental Relations Committee waived consideration of this matter) Adopted item as Amended by Amending Motion 9A…
12 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea
Wed Jan 22, 2025 · 02:30 PM

Housing and Homelessness Committee

City discusses rent gouging and interim housing projects

The Housing and Homelessness Committee will receive updates on efforts to combat rent gouging and the use of shelters during extreme weather. The body is also considering several funding transfers, appointments to oversight commissions, and the viability of specific properties for interim or supportive housing.

housinghomelessnessrent-controlbudgetzoning
✓ Decided: Committee approves $4.1M homeless services contract for CD 1

The Housing and Homelessness Committee approved multiple items, including a $4,124,400 transfer and contract for homeless outreach in Council District 1, and a motion to study banning algorithm-based rent-setting software. Several other actions were approved, including appointments, fund transfers, and a property sale. One item was continued, and one was noted and filed.

Notable items
Wed Jan 22, 2025 · 03:30 PM

Public Works Committee

Public Works Committee to review streetlight outages and sidewalk vending programs

The Public Works Committee will discuss streetlight outages, sidewalk vending enforcement, and a proposed sign for a historic ramen shop. The committee will also consider a motion regarding Grammy Awards city services.

streetlightssidewalk-vendingpublic-worksdowntowngrammy-awardscare-programcity-services
✓ Decided: Public Works Committee approves all seven agenda items unanimously

The Los Angeles Public Works Committee met on January 22, 2025, and approved all seven items on its agenda by unanimous votes of 3-0. These included reports and motions related to sidewalk vending, streetlight outages, solar conversions, a historical sign, CARE/CARE+ scheduling, sidewalk vendor listening sessions, and Grammy Awards city services payment. No items were denied or tabled.

Tue Jan 21, 2025 · 08:30 AM

Government Operations Committee

Committee discusses cannabis licensing and city facility leases

The Government Operations Committee is reviewing proposed contracts for digital services and facility leases for the LAPD and an asphalt plant. The body is also discussing regulatory frameworks for cannabis taxes and event licenses, as well as public restroom improvements.

cannabisleasingdigital-inclusionlapdpublic-facilities
✓ Decided: Committee approves all 7 items including cannabis tax alignment and LAPD lease

The Government Operations Committee unanimously approved all seven agenda items, including a contract for digital inclusion services, two property leases (one for LAPD vehicle storage and one for a recycled asphalt plant), updated records schedules for Building and Safety, a report aligning the city's gross receipts tax with SB 1059 for cannabis businesses, a motion to develop a regulatory framework for temporary cannabis event and consumption lounge licenses, and a motion to install baby changing stations in public restrooms. All votes were 3-0 in favor.

Room 401
Notable items
Tue Jan 21, 2025 · 10:00 AM

City Council Meeting

Council to consider street vacation on Roy and Aldama Streets and CVS alcohol sale request

The Los Angeles City Council meeting on Jan 21, 2025 will review several agenda items. Council members will vote on a request to vacate a portion of Roy Street and Aldama Street, including findings on environmental exemption and a petitioner fee of $14,980. They will also hear comments on an application by CVS Health for off‑site alcoholic beverage sales at 9040 North Balboa Boulevard. Additional items include routine approvals and public comment periods.

street-vacationalcohol-salespublic-hearingzoninglighting
✓ Decided: Council approves Hilton Universal City hotel expansion project

The Los Angeles City Council approved a major hotel expansion project at 555 East Universal Hollywood Drive, including a zone and height district change, after certifying the project's Environmental Impact Report. The council also granted a liquor license to a CVS in Northridge, approved a street vacation in Boyle Heights, and authorized a $9.4 million lease-purchase for new cardiac monitors for the fire department. Several items were continued, including a citywide transportation equity framework and a motion related to wildfire recovery.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (23 roll-call votes)
Named votes as recorded in the official record.
[context] Applicant: CVS Health Representative: Margaret Taylor ­ APEX LA TIME LIMIT FILE ­ FEBRUARY 24, 2025 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 21, 2025) (Motion required for Findings and…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the petitioner has paid a fee of $14,980 for the investigation of this request pursuant to Section 7.42 of the Los Angeles Administrative Code (LAAC). Any deficit fee to recover the cost…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Ordinance will take place at Council on February 18, 2025.) Adopted Item
130 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Tuesday - January yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Ordinance will take place at Council on February 18, 2025.) Tuesday - January 21, 2025 - PAGE 6 Adopted Item
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] (Lien: $2,340.00) (Continued from Council meeting of January 14, 2025) Adopted Amending Motion 14A (Harris­Dawson – Padilla) - SEE ATTACHED
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart ínez yea
Resolution rejecting the portion of future alley as public alley to the BOE RED for processing. Fiscal Impact Statement: The City Engineer reports that a fee of $7,075.91 was paid for processing this…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the report be completed and returned to any committee in no more than 60 days. Fiscal Impact Statement: None submitted by the Board of Fire Commissioners. Neither the CAO nor the CLA has…
11 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Tuesday - January 21, 2025 - PAGE 13 Community Impact Statement: None submitted (Continued from Council meeting of January 14, 2025) Adopted to Continue Item to January 29, 2025
10 yea
Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Tuesday - January 21, 2025 - PAGE 16 Community Impact Statement: None submitted TIME LIMIT FILE ­ FEBRUARY 2, 2025 (LAST DAY FOR COUNCIL ACTION ­ JANUARY 31, 2025) Adopted Item
11 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
RESOLUTION dated December 30, 2024, attached to the Council file, and the amendments stated into the record by the DCP and recommended by the PLUM Committee on January 14, 2025, to incorporate…
11 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Tuesday - January yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Adopted Government Operations Committee Report - SEE ATTACHED
11 yea
Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart ínez yea
[context] TIME LIMIT FILE ­ FEBRUARY 15, 2025 Tuesday - January 21, 2025 - PAGE 18 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 14, 2025) Adopted Government Operations Committee Report - SEE ATTACHED
10 yea
Harris­Dawson yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart ínez yea
[context] Adopted Item
65 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea · Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] 006020; Operating Supplies & Expense: $10,080 Adopted Item
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted (Budget and Finance Committee waived consideration of the above matter) Adopted Item
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the Mayor’s appointment of Stephanie Graves to the LAHSA Commission for the term ending June 30, 2027, is APPROVED and CONFIRMED. Appointee will fill the vacancy created by the departure of…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] TIME LIMIT FILE ­ FEBRUARY 4, 2025 (LAST DAY FOR COUNCIL ACTION ­ FEBRUARY 4, 2025) (Public Safety Committee and Budget and Finance Committee waived consideration of the above matter)…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the Chief Legislative Analyst, in coordination Tuesday - January 21, 2025 - PAGE 27 with the City Attorney and the Emergency Management Department, to report in 30 days on other changes to the…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
[context] Community Impact Statement: None submitted TIME LIMIT FILE ­ JANUARY 26, 2024 (LAST DAY FOR COUNCIL ACTION ­ JANUARY 24, 2024) (Trade, Travel and Tourism Committee waived consideration of…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
that the Mayor’s appointment of Hector Ochoa to the Disabled Access Appeals Commission for the term ending June 30, 2029, to fill the vacancy created by the departure of Ricardo Berg, is APPROVED and…
13 yea
Blumenfield yea · Harris­Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto­Mart​ínez yea
Tue Jan 21, 2025 · 02:00 PM

Planning and Land Use Management Committee

PLUM Committee to consider housing and zoning appeals

The Planning and Land Use Management Committee will meet to consider requests to continue three agenda items to January 28, 2025. The items include a housing development appeal, a motel use discontinuance appeal, and an urban infill development appeal.

planningzoninghousingappealscouncil-committeesunset-boulevardbroadway
✓ Decided: Committee continues three land-use appeals to later dates

The Planning and Land Use Management Committee voted to continue all three agenda items to future meetings without substantive discussion or decisions. Item 1 (Sunset Blvd mixed-use project appeal) and Item 3 (Sunset Blvd grocery store redevelopment appeal) were continued to January 28, 2025. Item 2 (Hi Lite Motel discontinuance appeal) was continued to February 25, 2025. No approvals, denials, or other actions were taken.

Notable items
Tue Jan 21, 2025 · 02:15 PM

Budget and Finance Committee

Committee considers $428,606.16 escheatment from Parking Violation Trust Fund

The Budget and Finance Committee will review a City Attorney draft ordinance amending sections of the Municipal Code governing the Board of Review. It will vote on an escheatment of $428,606.16 from Parking Violation Trust Fund 853 to the City General Fund. The committee will also consider motions directing the CAO to study revenue‑generation opportunities, to transfer funds for the Mayan Corridor streetscape improvements, and to establish a Civil Rights Trust Fund. Additional items include a report on interfund borrowing for future judgment‑obligation bond issuance and a transportation report on Bus Lane Violation Enforcement pilot revenue.

budgetfinancerevenueescheatmentcivil-rightsstreetscapetransportationlegal
Notable items
Tue Jan 21, 2025 · 03:30 PM

Energy and Environment Committee

Committee considers multiple utility agreements and easement sales

The Energy and Environment Committee will hear a verbal report on recent windstorm and wildfire impacts, and will consider ten items involving the Department of Water and Power. Most items are reports, exemptions, or ordinances that require council action by February 14, 2025, and have fiscal impact statements. Several items involve agreements or sales of easements and property interests.

water-and-powerutility-agreementseasementsfiscal-impactinfrastructure
Notable items
Wed Jan 15, 2025 · 10:00 AM

City Council Meeting

City Council to consider ordinance clarifying short-term rental rules

The Los Angeles City Council will consider an ordinance clarifying that the city's zoning code prohibited short-term rentals since 1992. The council will also review proposed agreements for playground equipment and park court use.

zoninghousingparksrecreationcontractsordinance
✓ Decided: Council approves $113.9M LAPD transit contract amendment

The Los Angeles City Council approved a $113.9 million increase to the LAPD's contract with the county transit authority for law enforcement services, extending it through June 2025. It also directed the City Attorney to draft an ordinance clarifying that short-term rentals were prohibited before the Home Sharing Ordinance, and approved several park equipment contracts and housing-related resolutions.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
that the City will be reimbursed for services provided, based on the full cost of operations. Community Impact Statement: None submitted TIME LIMIT FILE ­ JANUARY 17, 2025 (LAST DAY FOR COUNCIL…
10 yea · 2 nay
Blumenfield yea · Harris­Dawson yea · Hutt yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Hernandez nay · Jurado nay
The other 19 items passed by unanimous or near-unanimous consent.
Tue Jan 14, 2025 · 10:00 AM

City Council Meeting

City Council considers street lighting assessment districts

The Los Angeles City Council will consider four street lighting maintenance assessment districts. The body will vote on whether to uphold or reject protests against the proposed assessments. The decisions affect lighting districts on Vineland Avenue, Wilshire Boulevard, Violet Street, and Sunset Boulevard.

city-councilstreet-lightingassessment-districtsproposition-218public-hearingwilshire-boulevardsunset-boulevard
✓ Decided: Council ratifies wildfire emergency, orders independent review of response

The Los Angeles City Council ratified the Mayor's January 7, 2025 declaration of local emergency due to extreme fire weather, and adopted a series of wildfire-related motions. These include procuring an independent After Action Report of the emergency response, establishing protocols for water infrastructure updates, and directing reports on recovery and rebuilding. The Council also approved numerous routine items including street lighting district assessments, liquor licenses, and several property liens.

John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012
Notable items
🗳️ How they voted (56 roll-call votes)
Named votes as recorded in the official record.
that the streetlights are not installed or are removed from service if previously installed. (Continued from Council meeting of December 3, 2024) Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting district, in accordance with Sections 6.95-6.127 of the Los Angeles Administrative Code and Government Code…
78 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting district, in accordance with Sections 6.95-6.127 of the Los Angeles Administrative Code and Government Code…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
ORDINANCE levying the assessments and ordering the maintenance of the above lighting district, in accordance with Sections 6.95-6.127 of the Los Angeles Administrative Code and Government Code…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Applicant: Magdaleno Zavala Representative: Magdaleno Zavala (Motion required for Findings and Council recommendations for the above application) Adopted Motion 11A (Rodriguez –…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $1,276.56) (Continued from Council meeting of January 7, 2025) Adopted Item to Continue to January 28, 2025
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $1,276.56) Tuesday - January 14, 2025 - PAGE 10 (Continued from Council meeting of January 10, 2025) Adopted Item to Continue to February 14, 2025
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $1,276.56) (Continued from Council meeting of January 10, 2025) Adopted Item to Continue to February 14, 2025
26 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $3,239.52) (Continued from Council meeting of January 10, 2025) Adopted Motion (Rodriguez – Harris-Dawson) - SEE ATTACHED
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $2,340.00) Adopted Item to Continue to January 21, 2025
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Lien: $1,276.56) (Continued from Council meeting of January 10, 2025) Adopted Motion (McOsker – Nazarian) - SEE ATTACHED
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Community Impact Statement: None submitted Tuesday - January 14, 2025 - PAGE 14 (Planning and Land Use Management Committee waived consideration of the above matter) (Continued from Council…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
that the Mayor’s reappointment of Delfino De La Cruz to the HACLA Board of Commissioners for the term ending June 30, 2028 is APPROVED and CONFIRMED. Appointee resides in Council District Seven…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Community Impact Statement: None submitted (Continued from Council meeting of January 8, 2025) Adopted Item
117 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Community Impact Statement: None submitted (Continued from Council meeting of January 8, 2025) Adopted Item as Amended
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] (Continued from Council meeting of January 8, 2025) Adopted Item
39 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea · Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
that the report be completed and returned to any committee in no more than 60 days. Fiscal Impact Statement: None submitted by the Board of Fire Commissioners. Neither the CAO nor the CLA has…
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Community Impact Statement: None submitted (Continued from Council meeting of January 8, 2025) Tuesday - January 14, 2025 - PAGE 25 Adopted Item
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
[context] Community Impact Statement: None submitted (Continued from Council meeting of January 8, 2025) Adopted Item Tuesday - January 14, 2025 - PAGE 26
13 yea
Blumenfield yea · Harris-Dawson yea · Hernandez yea · Hutt yea · Jurado yea · Lee yea · Nazarian yea · Padilla yea · Park yea · Price Jr yea · Raman yea · Rodriguez yea · Soto-Martínez yea
Tue Jan 14, 2025 · 02:00 PM

Planning and Land Use Management Committee

City to consider zoning and height changes for Hilton Universal Hotel expansion

The committee will review the Environmental Impact Report (EIR No. ENV‑2017‑5424‑EIR) and a draft ordinance that would change the vesting zone and height district for the Hilton Universal Project at 555 East Universal Hollywood Drive. The project adds an 18‑story, 300,000‑square‑foot hotel expansion, increasing the total to 890 guest rooms and 696,609 square feet of floor area. Additional items include the mayor’s appointment of Navdeep “Duncan” Sachdeva to the Central Los Angeles Area Planning Commission, a corrected resolution fixing typographical errors in Article 5 of the New Zoning Code, and a report on advertising in private parking lots.

zoningdevelopmentenvironmentplanning-commissionparking
✓ Decided: Committee approves Hilton Universal City hotel expansion project

The Planning and Land Use Management Committee approved the Hilton Universal City Project, which includes an 18-story, 300,000-square-foot hotel expansion with 395 guestrooms, a spa, restaurants, bars, pools, and parking garage expansion. The committee also approved the appointment of Navdeep 'Duncan' Sachdeva to the Central Los Angeles Area Planning Commission and approved a corrected resolution fixing typographical errors in the New Zoning Code. A report on advertising in private parking lots was continued to February 11, 2025.

Notable items
Tue Jan 7, 2025 · 10:00 AM

City Council Meeting

City Council to consider annual fee for rental units under Just Cause eviction ordinance

The Los Angeles City Council will consider an ordinance to establish an annual enforcement fee for rental units subject to the Just Cause for Eviction Ordinance. The measure is subject to the approval of the Mayor and requires 12 votes on second reading.

housingevictionordinancerental-feeliquor-licensenuisancecouncil
John Ferraro Council Chamber Room 340, City Hall 200 North Spring Street, Los Angeles, CA 90012