The Boring PartsFederalLocal · USLocal · Canada
Roswell, GA

Roswell public meetings in 2024

159 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Wed Dec 18, 2024

Mayor and Council - Special Called Meeting

City Attorney recommends closing agenda to discuss real estate

The Roswell Mayor and Council will hold a special called meeting on Dec. 18, 2024. The agenda consists of a City Attorney’s Report that includes a recommendation to close the meeting in order to discuss real estate matters. No other items are listed for decision or discussion.

real-estatecity-attorneycouncilspecial-meeting
✓ Decided: Council votes to close meeting for real estate discussion

The Roswell Mayor and Council held a special called meeting on December 18, 2024, and took one substantive action: approving a recommendation to enter a closed session to discuss real estate. The motion passed unanimously with four members in favor and two excused. No other decisions were made, and the meeting adjourned shortly after.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Dec 18, 2024

Design Review Board - Special Called Meeting

DRB to hold initial public hearing on 89‑unit Riverwalk II townhome project

The Design Review Board will hear an initial application for an 89‑unit townhome development at 1200 Old Alabama Road, known as Riverwalk II. Staff recommends the board consider a variance to reduce ground‑floor transparency to 15% and require mayor‑council approval for any retaining wall over 6 feet. The board will also consider a playground addition and repaving at 9212 Nesbit Ferry Road and approve the October 1, 2024 DRB minutes.

zoninghousingdevelopmentdesign-reviewpublic-hearing
✓ Decided: Design Review Board approves playground and parking lot project at 9212 Nesbit Ferry Road

The Roswell Design Review Board held a special called meeting on December 18, 2024, and approved a playground addition and parking lot repaving at 9212 Nesbit Ferry Road, with a condition that all department comments be addressed at the permit stage. The board also heard an initial presentation for 1200 Old Alabama Road (Riverwalk II) with no vote needed, and approved the October 1, 2024 meeting minutes.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Dec 17, 2024

Planning Commission - Regular Meeting

Riverwalk II townhome development of 89 units at 1200 Old Alabama Road heard as initial

The Roswell Design Review Board will hold a public hearing on the Riverwalk II project, an 89‑unit townhome development at 1200 Old Alabama Road. Staff recommends hearing the item as an initial review and notes conditions such as a 5% transparency variance and mayor‑council approval for retaining walls over 6 feet. The board will also consider a playground addition and parking‑lot repaving at 9212 Nesbit Ferry Road.

zoninghousingdevelopmentdesign-reviewpublic-hearingroads
✓ Decided: Design Review Board approves playground and parking lot project at Nesbit Ferry Road

The Roswell Design Review Board held a special called meeting on December 18, 2024. They approved a playground addition and parking lot repaving at 9212 Nesbit Ferry Road with conditions, and approved the October 1, 2024 minutes. An initial review of 1200 Old Alabama Road (Riverwalk II) was heard with no vote needed.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Dec 10, 2024

Committees of Council - Regular Meeting

Council sets fees for 2025 municipal election and approves Big Creek Parkway contract

The Roswell Committees of Council will vote on setting qualifying fees for the November 4, 2025 municipal election and approve a construction contract for the Big Creek Parkway Phase 1 TSPLOST project.

electionstransportationroadsbudgettsplostcontract
✓ Decided: Council committees approve election fees, road contract, resurfacing list

The committees unanimously approved moving three items to the Mayor and Council: setting qualifying fees for the November 4, 2025 municipal election, approving a construction contract for the Big Creek Parkway Phase 1 TSPLOST project, and accepting the FY2025 Road Resurfacing List. The meeting was procedural, with no substantive decisions final; all items are scheduled for the January 13, 2025 Mayor and Council meeting.

City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Dec 9, 2024

Mayor and Council - Work Session

Council discusses proposed fee changes for multiple city departments

The Roswell Mayor and Council will review a fire response analysis presentation and discuss proposed fee structures for the Fire, Community Development, and Environmental/Public Works departments. They will also hold a discussion on the Parking Plan Analysis. No formal decisions are indicated in the agenda.

firefinancefeesparkingplanningpublic-workscommunity-development
✓ Decided: Council hears presentations on fire response, fees, parking

The Roswell Mayor and Council held a work session where staff presented on fire response analysis, proposed fees for Fire, Community Development, and Environmental/Public Works departments, and a parking plan analysis. All items were presented for discussion only; no formal votes or decisions were taken.

City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Dec 9, 2024

Mayor and Council - Regular Meeting

City Council approves FY 2025 budget of $197,025,114

The Roswell City Council will adopt the FY 2025 budget of $197,025,114 and adjust fees for the fiscal year. A $1,014,741.66 Local Maintenance & Improvement Grant will be accepted and funded. The council will also approve a contract with Temple, Inc. for traffic preemption up to $733,535.20 and a task order to Hussey Gay Bell for Fire Station #27 design up to $540,198. Additional items include a conditional use for a massage establishment at 875 Mansell Road and a road resurfacing agreement for Ebenezer Road.

budgetfinancetransportationpublic-safetydevelopmenthousing
✓ Decided: Roswell Council approves $197M FY2025 budget with $600K shift

The Roswell Mayor and Council unanimously approved the FY 2025 budget of $197,025,114 on second reading, with a $600,000 reduction in Economic Development and a corresponding increase in Operating Contingency. They also approved several resolutions, including a letter of intent for a Hill Street development project (5-1), a property purchase at 1080 Holcomb Bridge Road, and contracts for traffic preemption and Fire Station #27 design. A cell tower application at 11675 Wills Road was deferred to a future meeting at the applicant's request.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Dec 5, 2024

Alcoholic Beverage License Board - Public Hearing

Board will decide on new and renewed alcoholic beverage licenses for multiple venues

The Alcoholic Beverage License Board will hold a public hearing to review applications for new and existing liquor, beer, and wine licenses, including full pouring, limited pouring, and package permits, some with Sunday sales. The board will also approve the minutes from the previous meeting and consider renewals for 2025. Several establishments such as I Taquero Mucho, Eggs Up Grill, Chicken Bee, and others are listed for new or transferred licenses.

alcoholic-beveragelicensingrestaurantssunday-salespublic-hearing
✓ Decided: ABLB holds public hearing on 2025 alcohol license renewals

The Alcoholic Beverage License Board held a public hearing on December 5, 2024, to consider the renewal of alcoholic beverage licenses for 2025. The minutes list numerous establishments seeking renewal under various license types (full pouring, limited pouring, package, etc.). No individual decisions or votes are recorded in the minutes; the hearing appears to be a procedural step in the renewal process. Two establishments, Eggs Up Grill and Kroger #431, are noted as scheduled for a January 2 public hearing.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Dec 5, 2024

Roswell Recreation Commission - Regular Meeting

City proposes new fees for Fire, Community Development, and Environmental/Public Works departments

The Roswell Recreation Commission work session will include a Fire Response Analysis presentation and discussion of proposed fee structures for the Fire Department, Community Development Department, and Environmental/Public Works Department. The meeting will also review a Parking Plan Analysis presented by Seer World LLC, outlining a comprehensive parking business model and financing strategy. The commission will consider these proposals but no final fee decisions are indicated.

fire-departmentcommunity-developmentpublic-worksparkingfinancefees
✓ Decided: Council hears fire response, fee, parking presentations

The Mayor and Council work session on December 9, 2024, consisted solely of presentations and discussions, with no formal votes or decisions taken. Items presented included a fire response analysis, proposed fees for the Fire, Community Development, and Environmental/Public Works departments, and a parking plan analysis. The meeting adjourned at 7:00 PM.

Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Nov 26, 2024

Committees of Council - Regular Meeting

Roswell considers adding Johns Creek Police to North Fulton SWAT Team

The Committees of Council will discuss expanding the North Fulton SWAT Team MOU to include the Johns Creek Police Department. Other agenda items include transportation grants and a legal brief regarding the City of Milton.

policetransportationbudgetintergovernmental-agreementlegal
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Nov 26, 2024

Mayor and Council - Special Called Meeting

Alcoholic Beverage Board to hear 13 license applications for Sunday sales

The Alcoholic Beverage License Board will hold a public hearing to consider 13 applications for Sunday sales permits, including renewals for 2025. The items range from new liquor licenses for restaurants and grocery stores to transfers of ownership for existing establishments.

alcohollicensingpublic-hearingroswellbusinesssunday-sales
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Nov 25, 2024

Mayor and Council - Regular Meeting

Council approves $805,059 contract for radio tower and 911 center equipment relocation.

The Roswell Mayor and Council will vote on several major contracts, including a $805,059 agreement to build a radio tower and move equipment to the new 911 center. They will also consider stormwater construction funding, upgrades to the 911 phone and digital delivery systems, and a redevelopment plan establishing a Tax Allocation District. Additional items include a small‑tract variance request and a memorandum of understanding with the Georgia Department of Labor.

public-worksemergency-servicesfinancedevelopmentzoninglabor
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Nov 19, 2024

Planning Commission - Regular Meeting

Planning Commission to review Chaffin Road subdivision plat

The Roswell Planning Commission will consider a preliminary plat for a six-lot subdivision at 155 Chaffin Road. The body will also discuss a text amendment for the Hill Street Overlay and review meeting minutes from August and January.

planningzoningsubdivisionchaffin-roadhill-streettext-amendmentminutes
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Committees of Council - Special Called Meeting

Roswell City Council to vote on 90‑day moratorium on all murals

The Roswell City Council will vote on a resolution that imposes a temporary 90‑day moratorium on all murals in the city. The moratorium is intended to maintain the status quo until the Unified Development Code is amended to provide appropriate mural regulations. Council members cited concerns that murals may affect aesthetic beauty, economic development, and public safety. No financial impact is associated with the resolution.

zoningpublic-safetyartscity-councildevelopment-code
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Mayor and Council - Special Called Meeting

City of Roswell council to approve FY 2025 budget of $197 million

The Mayor and City Council will consider the first reading of the City of Roswell’s Fiscal Year 2025 budget. The ordinance proposes a total budget of $197,025,114, allocating funds across general, capital, and enterprise accounts. Council members will vote on the motion to approve the first reading of the budget.

budgetfinancetaxescapital-projectscity-government
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Planning Commission - Work Session

Planning Commission to consider Hill Street Overlay code amendment

The Roswell Planning Commission will discuss two preliminary plats for Chaffin Road and Scott Road, a withdrawn text amendment to the Unified Development Code, and a text and map amendment for the Hill Street Overlay. The commission will also adopt the 2025 meeting calendar. All items are for discussion in the work session.

planningzoningdevelopment-codeplatsmeetings
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Thu Nov 14, 2024

Board of Zoning Appeals - Regular Meeting

BZA to consider setback variance for garage addition at 170 Derby Forest Ct.

The Board of Zoning Appeals will review a request to reduce rear and side setbacks for a residential addition. The board will also determine the 2025 meeting calendar and review previous minutes.

zoningvariancesresidentialsetbacks
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Thu Nov 14, 2024

Mayor and Council - Special Called Meeting

Roswell presents FY 2025 proposed budget of $197 million

The Mayor and City Council will present the City of Roswell's FY 2025 proposed budget, totalling $197,025,114. The budget is reported as balanced with no increase to the property tax millage rate. Highlights include road resurfacing, new equipment purchases, and additional staffing for fire and concrete crews. The first budget reading is scheduled for November 18.

budgetfinanceinfrastructurepublic-safetystaffing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Nov 13, 2024

Historic Preservation Commission - Regular Meeting

Commission will consider a Certificate of Appropriateness for 120 Bulloch Ave renovations

The Roswell Historic Preservation Commission will hold a public hearing on a Certificate of Appropriateness for exterior renovations at 120 Bulloch Avenue. It will also discuss an appeal of an HPC minor for 77 Vickery Street, a withdrawn text amendment to the Unified Development Code, a text and map amendment for the Hill Street Overlay, and provide design guidance for the Taqueria Tsunami project at 982 Canton Street.

historic-preservationzoningdevelopment-codedesign-guidelinespermits
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Nov 12, 2024

Committees of Council - Regular Meeting

City to approve $805,059.72 radio tower contract for new 911 center

The Roswell Committees of Council will vote on several agenda items, including awarding a $244,748 stormwater construction task order to Chatfield Contracting for the Ramsdale Drive project. They will also consider a $805,059.72 contract to build a 150‑foot radio tower and relocate equipment to the new 911 Center. Additional items include funding the Carbyne APEX 911 phone system ($247,687.20), an ESInet digital IP delivery upgrade ($21,336.48), and a redevelopment plan for Tax Allocation District #1 (Roswell East‑West Connection TAD).

public-safetyinfrastructurebudgettelecommunicationsstormwatereconomic-development
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Nov 12, 2024

Mayor and Council - Regular Meeting

Council approves veterans proclamations and DDA appointments

The Mayor and Council will read proclamations honoring a local Marine veteran and Veterans Day. The body also plans to appoint members to the Downtown and Roswell Development Authorities and approve several administrative and construction contracts.

veteransappointmentsproclamationsconstructiondevelopmentcontractsbudget
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Nov 8, 2024

Mayor and Council - Workshop

Roswell considers $805,059 contract for new 911 center radio tower

The Mayor and Council will discuss several infrastructure and public safety upgrades, including equipment for a new 911 center and stormwater construction. The body will also consider a redevelopment plan for a new Tax Allocation District.

public-safety911stormwatereconomic-developmentinfrastructure
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Thu Nov 7, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider a new limited‑pour beer and wine license for Sushi Hut.

The Roswell Alcoholic Beverage License Board will hold a public hearing to review several new alcohol license applications. The agenda includes six applicants seeking limited pour, full pour, brewpub, and package licenses, all with Sunday sales. The board will also approve minutes from the previous meeting.

alcohol-licensingbusinesspublic-hearingroswellrestaurants
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Nov 7, 2024

Design Review Board - Regular Meeting

Meeting will cover routine procedural matters only

The Roswell Recreation Commission work session on November 7, 2024 will address standard procedural items such as call to order, agenda items, information items, and adjournment. No specific projects, contracts, or policy decisions are listed on the agenda.

recreationgovernanceprocedural
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Nov 7, 2024

Roswell Recreation Commission - Regular Meeting

Commission will approve October minutes and review the November capital project list

The Roswell Recreation Commission will vote to approve the 10.03.24 meeting minutes. It will share information about upcoming work session and regular meeting dates in December. The commission will also review the Capital Project List that outlines the status of numerous park and recreation projects.

minutescapital-projectsparksrecreationmeeting-schedule
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Nov 7, 2024

Roswell Recreation Commission - Work Session

Work session with no specific agenda items listed

The Roswell Recreation Commission held a work session on November 7, 2024. The agenda did not list any specific items for decision or discussion, indicating a routine meeting. The commission members and a possible quorum of the mayor and city council were noted. The meeting concluded with standard procedural items.

recreationwork-sessioncity-government
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Oct 29, 2024

Committees of Council - Regular Meeting

Roswell committees to discuss $2 million loan collateral and infrastructure projects

City committees are meeting to consider a modification to a $2,039,000 Section 108 loan application and various public works contracts. The body will also review agreements for the Hardscrabble Rd Multi-Use Trail and the Hill Street Redevelopment.

financetransportationpublic-workseconomic-developmenthousing
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Oct 28, 2024

Mayor and Council - Regular Meeting

Roswell Mayor and Council to consider $1.15 million property purchase

The Mayor and Council will discuss the purchase of property at 1028 Green Street and the functional use of Church Circle. The meeting also includes the swearing-in of Roswell Fire Department staff and a veteran's award proclamation.

real-estatetransportationfire-departmentpublic-safety
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Oct 17, 2024

Planning Commission - Regular Meeting

City approves $1.15 million purchase of 1028 Green Street

The Roswell Planning Commission will consider several agenda items, including approving the functional use of Church Circle and authorizing a $1,150,000 purchase of property at 1028 Green Street. The meeting also includes a proclamation honoring First Lieutenant Craig Smith and the swearing‑in of new Roswell Fire Department staff. Routine approval of the October 15, 2024 Mayor and Council meeting minutes is also on the agenda.

property-purchasefinancetransportationveteransfire-departmentcouncil-minutes
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 15, 2024

Mayor and Council - Regular Meeting

Council to approve $6 million Pine Grove Road budget increase

The Roswell Mayor and Council will consider several approvals, including a $6 million budget amendment for the Pine Grove Road project, raising its total budget to $20.8 million. They will also vote on a contract to replace artificial turf at Roswell Area Park Multisport Field 1 for $720,340 and a Liberty Square Park contract for $238,790.50. Additional items include a second‑reading ordinance to adopt a 4.949 millage rate for Tax Year 2024 and a text amendment to the Unified Development Code for the Hill Street Overlay.

parksroadsbudgetzoningcontracts
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 15, 2024

Committees of Council - Regular Meeting

Council will vote on a Unified Development Code amendment affecting sign permits

The Roswell City Council will approve the September 10 minutes, consider a text amendment to the Unified Development Code that updates sign‑permit tables and crowns sign limits, and vote on changing the functional use of Church Circle to a two‑way segment and a multi‑use trail. No financial impact is noted for the transportation proposal.

zoningsignagedevelopmenttransportationcity-council
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Wed Oct 9, 2024

Historic Preservation Commission - Regular Meeting

HPC reviews fence request for 1096 Alpharetta Street

The Historic Preservation Commission will hold public hearings regarding certificates of appropriateness for two properties. The body will also discuss park improvements at 127 Bulloch Avenue and the 2025 meeting calendar.

historic-preservationzoningpublic-hearingsfencing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 8, 2024

Mayor and Council - Possible Quorum of Mayor & Council

Historic Gateway Project update presented to Roswell Mayor and Council

The Roswell Mayor and Council will hear a presentation on the Historic Gateway Project from the City and GDOT. An open house for the project will be held at St. Andrew Catholic Church, 675 Riverside Road. No formal decisions are indicated on the agenda.

developmenttransportationcommunityhistoric-preservation
St. Andrew Catholic Church, 675 Riverside Road, Family Center, Roswell, GA 30075
Tue Oct 8, 2024

Board of Zoning Appeals - Regular Meeting

Historic Preservation Commission to review requests for 1096 Alpharetta St and 120 Bulloch Ave

The Historic Preservation Commission will hold public hearings to determine if proposed exterior changes at two properties meet historic guidelines. The commission will also discuss park improvements at 127 Bulloch Avenue and the 2025 meeting calendar.

historic-preservationzoningpublic-hearingsfencingrenovations
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Oct 7, 2024

Mayor and Council - Special Called Meeting

Roswell holds public hearing on 2024 millage rate

The Mayor and Council are holding a public hearing to discuss the millage rate for tax year 2024. The proposed rate of 4.949 represents no change in the current rate.

taxesmillage-ratebudget
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Oct 3, 2024

Roswell Recreation Commission - Work Session

Roswell Recreation Commission to discuss Friends of Roswell leadership and bylaws

The commission will hold a work session to discuss the appointment of a Vice Chair for Friends of Roswell. Members will also receive updates on Booster Club bylaw changes and a presentation regarding Founders Park.

recreationparksbylawscommunity-events
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Oct 3, 2024

Roswell Recreation Commission - Regular Meeting

Commission will vote to approve September 5, 2024 meeting minutes

The Roswell Recreation Commission will consider and vote on the approval of the September 5, 2024 meeting minutes. The agenda also includes a Director’s Report and an informational update on the October 3, 2024 capital project list. Notices of upcoming work sessions and commission meetings in November are also provided.

recreationminutescapital-projectsmeetingsparks
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Oct 3, 2024

Alcoholic Beverage License Board - Public Hearing

New alcohol licenses for Corella Spirits, Roswell Liquor Store, Sprouts Market, RaceTrac

The Alcoholic Beverage License Board will hold a public hearing to consider applications for new alcoholic beverage licenses. The agenda includes a new license for Corella Spirits (wholesale liquor, beer, wine, Sunday sales), a change of ownership for Roswell Liquor Store, and new licenses for Sprouts Farmer’s Market and RaceTrac, each for beer and wine with Sunday sales. The board will also review minutes from prior meetings and address any new business.

alcoholic-beveragelicensingbusinesssunday-salesroswell-ga
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 1, 2024

Design Review Board - Regular Meeting

Board to consider 102-unit multi-family building at 199 Grove Way

The Design Review Board will hold a public hearing for a final decision on a new 4-story multi-family building proposed by the Roswell Housing Authority. The project would replace a condemned building with 102 residences and associated amenities.

housingzoningmulti-familydesign-reviewpublic-hearing
✓ Decided: Roswell Housing Authority multi-family building at 199 Grove Way approved

The Design Review Board approved the Roswell Housing Authority's new multi-family building at 199 Grove Way with a condition that all staff comments be addressed at the permit stage. The board also approved the 2025 meeting calendar and the September 3, 2024 minutes. All votes were unanimous with one member absent.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Sep 30, 2024

Mayor and Council - Open Forum

Mayor reads proclamation honoring Sergeant Kevin Green as Esteemed Veteran

The Roswell Mayor and Council open forum will include Mayor Kurt Wilson reading a proclamation that names Sergeant First Class Kevin Green an Esteemed Veteran of Roswell. The City Attorney will present a recommendation to close the meeting to discuss personnel, litigation, and real estate matters. The agenda also contains a welcome, invocation, pledge of allegiance, and an open‑mic public comment period. No policy decisions are listed on the agenda.

mayor-reportcity-attorneyveteranspublic-commentmeeting
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Sep 27, 2024

Mayor and Council - Workshop

City Attorney recommends closing to discuss personnel, litigation, real estate

The council will hear a proclamation honoring United States Army Sergeant First Class Kevin Green as an Esteemed Veteran of Roswell. They will also consider the City Attorney’s recommendation to close the meeting to discuss personnel matters, ongoing litigation, and real‑estate issues. No decisions are recorded; the items are presented for discussion.

proclamationveteranscity-attorneypersonnellitigationreal-estate
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Tue Sep 24, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Committee to consider $20.8M Pine Grove Road improvement concept

The committee will approve the minutes from the August 27 meeting. It will vote on the Pine Grove Road improvement concept, which seeks to raise the project budget to $20.8 million. The body will also consider contracts to replace artificial turf at Roswell Area Park Multisport Field 1 for $720,340 (total budget $828,391) and to award Liberty Square Park work to Columbia Engineering for $238,790.50 (total budget $262,669.50). A resolution to apply for the FY 2024 Justice Assistance Grant from the U.S. Department of Justice will be considered.

transportationroadsinfrastructureparkscontractsbudgetgrants
✓ Decided: Committee advances Pine Grove Road concept, turf replacement, park contract

The Community Development and Transportation Committee unanimously approved moving the Pine Grove Road concept to Mayor and Council, and also advanced the 2025 meeting calendar, a $720,340 artificial turf replacement at Roswell Area Park, a $238,790.50 Liberty Square Park contract, and a Justice Assistance Grant application. All items will be considered by Mayor and Council on October 15, 2024.

City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Sep 23, 2024

Mayor and Council - Regular Meeting

Roswell considers 2024 millage rate and historic parks improvements

The Mayor and Council will discuss a 2024 millage rate and a contract for historic parks improvements. The body is also considering several amendments to the City Code regarding animal control and park activities.

taxesparksanimal-controlbudgetordinances
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Sep 17, 2024

Planning Commission - Regular Meeting

City recommends $460k CMAR contract and up to $3M ARPA funding for historic parks plan

The Roswell Planning Commission will consider several ordinance text amendments, including changes to animal control tethering rules, a prohibition on transient sales of dogs, cats and domestic rabbits, and activity restrictions in Old Mill Park. It will also adopt a millage rate of 4.949 for tax year 2024. A recommendation will be made to award CMAR services to Reeves Young, Inc. for up to $460,420 plus 4.5% of construction costs and up to $3.0 million in ARPA‑funded construction costs. Additional items include a resolution for the North Fulton Community Improvement District expansion and a discussion on personnel, litigation, and real estate matters.

animal-controlparksfinancemillagecontractspublic-safety
✓ Decided: Council approves 4.949 millage rate, dog tethering and sales bans

The Roswell Mayor and Council approved several ordinances on second reading, including restrictions on dog tethering and a ban on transient sales of dogs, cats, and rabbits. They also approved a millage rate of 4.949 for tax year 2024 on first reading, and awarded a construction manager at risk contract for historic parks improvements. All votes were unanimous except the Old Mill Park activity prohibition, which passed 5-1 with Councilmember Beeson opposed.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Sep 13, 2024

Mayor and Council - Possible Quorum of Mayor & Council

Mayor meets Roswell neighborhoods and HOAs at Roswell River Landing

The Mayor and Council members will hold a meet‑up with Roswell neighborhoods and homeowners associations. The gathering is scheduled for Friday, September 13, 2024, from 8:30 AM to 10:00 AM at Roswell River Landing, 245 Azalea Drive. No formal decisions are indicated; the session appears to be for discussion and community outreach.

community-engagementneighborhoodshomeowners-associationspublic-meeting
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Fri Sep 13, 2024

Alcoholic Beverage License Board - Special Called Public Hearing

Board reviews full pouring and Sunday sales request for Rodgers Catering

The Roswell Alcoholic Beverage License Board will hold a public hearing on a request for a full pouring license, including liquor, beer, wine, and Sunday sales, for Rodgers Catering & Events LLC. The request had been deferred at the September 5, 2024 hearing. The board will decide whether to grant the license at this meeting.

alcoholic-beveragelicensingbusinessroswell
✓ Decided: Full liquor license approved for Rodgers Catering at 11510 Woodstock Rd

The Alcoholic Beverage License Board unanimously approved a full pouring liquor, beer and wine license with Sunday sales for Christopher L. Rodgers / Rodgers Catering & Events LLC at 11510 Woodstock Road, Roswell. The item had been deferred from the September 5, 2024 public hearing. The motion was made by Lacy Smith-Castillo and seconded by Jackie Deibel, with all three board members voting in favor.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Sep 11, 2024

Historic Preservation Commission - Regular Meeting

Guidance on HPC design guidelines for the 982 Canton Street project

The Historic Preservation Commission will discuss direction and guidance on adhering to the HPC design guidelines for the upcoming project at 982 Canton Street. The commission will also consider and approve the minutes from the August 14, 2024 HPC meeting. No other decisions are listed on the agenda.

historic-preservationdesign-guidelinesminutesroswell
✓ Decided: Historic Preservation Commission approves August minutes, discusses Canton St. project

The Roswell Historic Preservation Commission held a regular meeting on September 11, 2024. The only formal decision was unanimous approval of the August 14, 2024 meeting minutes. The commission also held a courtesy review of a project at 982 Canton Street to discuss adherence to design guidelines, but no motions or votes were made on this item.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Committee will vote on awarding the Liberty Square Park design contract for $238,790.50

The Administration, Finance, Recreation and Parks Committee will consider awarding the design contract for Liberty Square Park to Columbia Engineering. The contract amount is $238,790.50 with a total budget authorization of up to $262,669.50, funded by a grant. The committee will also approve the minutes from the August 13, 2024 meeting.

parkscontractsfinancecity-councilgrantsdesign
✓ Decided: Liberty Square Park contract deferred to Sept. 24 committee meeting

The committee approved minutes from two August 13 meetings and deferred a contract award for Liberty Square Park to Columbia Engineering ($238,790.50, with $262,669.50 total budget authorization) to the next committee meeting on September 24, 2024. No other substantive decisions were made; administration and finance items were listed as no action items.

City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Roswell Public Facilities Authority (PFA) - Regular

Roswell Public Facilities Authority to elect Chairman

The Roswell Public Facilities Authority is meeting to conduct a single piece of business. The body will vote to elect a Chairman for the Authority.

governanceelectionpublic-facilities
✓ Decided: Allen Sells elected chairman of Roswell Public Facilities Authority

The Roswell Public Facilities Authority held a brief regular meeting on September 10, 2024, and took one substantive action: electing a chairman. Councilmember Allen Sells was nominated by Councilmember G. Lee Hills and unanimously approved as Chairman of the Public Facilities Authority. No other business was conducted.

City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Board of Zoning Appeals - Regular Meeting

HPC to discuss design‑guideline guidance for 982 Canton Street project

The Roswell Historic Preservation Commission will review direction and guidance on adherence to the HPC design guidelines for the upcoming project at 982 Canton Street. The commission will also consider and approve the minutes from its August 14, 2024 meeting.

historic-preservationdesign-guidelinesminutesroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Sep 9, 2024

Mayor and Council - Regular Meeting

City approves up to $25,000 for Woodstock Road Multi-use Trail right‑of‑way

The Roswell Mayor and Council will consider several ordinance amendments, including changes to animal control and park use. They will review multiple conditional use applications for properties on Woodstock Road. The council will also vote on a contract to spend up to $25,000 for right‑of‑way acquisition for Phase 1 of the Woodstock Road Multi‑use Trail TSPLOST project. Finally, the August 26 meeting minutes will be approved.

zoningtransportationanimal-controldevelopmenttrails
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Sep 5, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider two new full‑pour liquor licenses with Sunday sales

The Alcoholic Beverage License Board will hold a public hearing to review applications for full‑pour liquor, beer and wine licenses that include Sunday sales. The applications are from Rodgers Catering & Events LLC ("Recess in Roswell") at 11510 Woodstock Road and from NFHS Roswell LLC ("Roswell Junction") at 340 Atlanta Street. The board will discuss and may approve these new licenses.

alcoholic-beveragelicensingsunday-salesbusinessroswell
✓ Decided: Roswell approves new liquor license for Roswell Junction, defers Rodgers Catering

The Alcoholic Beverage License Board approved a full pouring/liquor, beer and wine license with Sunday sales for Roswell Junction (NFHS Roswell LLC) at 340 Atlanta Street. A similar license request for Rodgers Catering & Events LLC at 11510 Woodstock Road was deferred with no date set. The board also unanimously approved the minutes from the August 1, 2024 public hearing.

City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Sep 5, 2024

Roswell Recreation Commission - Work Session

Commission considers policy for dual roles with Friends of Roswell Parks

The Roswell Recreation Commission is meeting to consider a policy allowing members to simultaneously serve as officers for the 501(c)(3) Friends of Roswell Parks. The body will also discuss the 2024 Youth Day Parade Grand Marshal and booster club bylaws.

parksrecreationpolicybudgetnon-profit
✓ Decided: Recreation Commission approves dual roles policy for Friends of Roswell Parks

The Roswell Recreation Commission approved a policy addition allowing members to serve dual roles with Friends of the Roswell Parks. The commission also discussed the 2024 Youth Day Parade Grand Marshal and reviewed progress on the Booster Club bylaws, along with updates on the FY25 budget timeline and Liberty Square Park.

Hembree Park Community Room, 850 Hembree Road, Roswell, GA 30075
Thu Sep 5, 2024

Roswell Recreation Commission - Regular Meeting

Commission will vote on adding a dual‑role policy for Friends of the Roswell Parks.

The Roswell Recreation Commission will first approve the minutes from the August 1 meeting. It will then consider two approvals: a policy that allows commission members to serve in dual roles with Friends of the Roswell Parks, and the selection of the 2024 Youth Day Parade Grand Marshal. An informational capital project list will be presented, and upcoming meeting dates will be announced.

recreationparkspolicyyouth-paradecapital-projectsmeetings
✓ Decided: Recreation Commission approves dual roles policy and parade grand marshal

The Roswell Recreation Commission unanimously approved a policy addition allowing members to hold dual roles with Friends of the Roswell Parks, with edits. They also unanimously approved the 2024 Youth Day Parade Grand Marshal. The commission approved the August 1, 2024 minutes. No other substantive decisions were made; the rest of the meeting consisted of reports and information items.

Hembree Park Community Room, 850 Hembree Road, Roswell, GA 30075
Tue Sep 3, 2024

Design Review Board - Regular Meeting

Design Review Board to consider new 102-unit building at 199 Grove Way

The Design Review Board is reviewing an initial application from the Roswell Housing Authority to build a 4-story multi-family building. The project would replace a condemned 40-unit building on a 2.97-acre site. The proposal includes 102 residences, a rooftop deck, and a new 8.5-foot sidewalk along Grove Way.

housingzoningmulti-familylandscapingpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 27, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Roswell committee to consider Woodstock Road trail funding and animal ordinances

The Community Development and Transportation Committee will discuss right-of-way acquisitions for a multi-use trail and proposed changes to city ordinances regarding the tethering and sale of animals. The body will also hold discussions on millage rates and Old Mill Park.

transportationanimal-controlordinancesbudgettrails
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Aug 26, 2024

Mayor and Council - Regular Meeting

City Council to approve purchase of two new police K‑9 dogs

The Roswell Mayor and Council will consider a proclamation for Lieutenant Commander Greg Roecker, approve the appointment and oath of Joseph Cusack to the Roswell Development Authority, and vote on the consent agenda. They will also approve the purchase of two new police K‑9 dogs using the Confiscated Assets Fund, accept a FY25 Cultural Facilities Grant from the Georgia Council for the Arts, and review a conditional use request for a massage establishment at 885 Woodstock Road, Suite 300. Two text amendments to the Unified Development Code will be considered: one to Article 13, Section 13.4.3 (Second Reading) and another to Article 5, Section 5.2.1 (First Reading).

policegrantzoningdevelopment-codemassagecultural-facilities
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Aug 26, 2024

Roswell Public Facilities Authority (PFA) - Regular

City seeks $25,000 blanket approval for Woodstock Road Trail right‑of‑way acquisition

The committee will vote on a blanket approval to perform right‑of‑way acquisition services for the Woodstock Road Multi‑use Trail Phase 1 TSPLOST project, limited to $25,000. It will also consider text amendments to the city code adding Section 8.1.10.1 on dog tethering and a new Section 8.1.25 prohibiting transient sales of dogs, cats, and domestic rabbits. Additional items include a modification to the draft Section 108 loan application, a discussion of the millage rate, and a discussion of Old Mill Park.

transportationright-of-waytrailsanimal-controlfinancetaxesparks
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 20, 2024

Planning Commission - Regular Meeting

Planning Commission considers special events center permit

The Roswell Planning Commission will consider a conditional use permit for a special events facility at 11510 Woodstock Road. The applicant, Building Kidz School, proposes using the gym and playground for private events after daycare hours.

planningzoningspecial-eventsrecreationdowntowntext-amendment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Aug 14, 2024

Historic Preservation Commission - Regular Meeting

Commission reviews new home construction request for 69 Maple Street

The Historic Preservation Commission will consider a Certificate of Appropriateness for a new single-family home on a vacant lot. The body will also discuss a text amendment to the Unified Development Code regarding Downtown Historic Districts applicability.

zoninghistoric-preservationhousingunified-development-code
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Committee will vote on applying for a $25,000 cultural grant with city match

The Administration, Finance, Recreation and Parks Committee will first approve the minutes from its July 9, 2024 meeting. It will then consider applying for and accepting the FY25 Cultural Facilities Grant from the Georgia Council for the Arts, which seeks $25,000 in grant funds and a $25,000 city match to purchase a video projection system for the Roswell Cultural Arts Center Mainstage. The committee will vote on the grant application.

grantsartsculturefinancecity-council
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Roswell committee to approve retiring police dog and buying two new K-9s

The Roswell Public Safety and Public Works Committee will consider a $1 sales agreement to retire police dog Ivar and a $48,000 contract to purchase two new K-9 dogs from Valhall K-9.

policek-9public-safetywaterlinebudgetcontractsroswell
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Board of Zoning Appeals - Regular Meeting

Commission to review new home construction at 69 Maple Street

The Historic Preservation Commission will hold a public hearing regarding a request for a Certificate of Appropriateness to build a single-family home on a vacant lot. The body will also discuss a text amendment to the Unified Development Code concerning Downtown Historic Districts.

zoninghistoric-preservationhousingunified-development-code
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Aug 12, 2024

Mayor and Council - Regular Meeting

Council to approve $3.95 M settlement for Alpharetta St. property, preserve building

The Roswell City Council will vote on a resolution to settle litigation over 1054 and 1056 Alpharetta Street, authorizing up to $3,950,000 and preserving the historic structure on the site. Other agenda items include approving a $382,452 bridge repair contract, several right‑of‑way agreements for sidewalk improvements, and a $953,550 budget amendment for the Big Creek Parkway Phase 1 project. The meeting also covers grant applications for charging infrastructure and the 2024 Community Development Block Grant.

transportationfinancehistoric-preservationinfrastructuregrantsdevelopment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 6, 2024

Design Review Board - Regular Meeting

Council to approve $3.95 M settlement of Alpharetta St. litigation

The Roswell City Council will vote on a resolution to settle eminent‑domain litigation involving 1054 and 1056 Alpharetta Street for up to $3,950,000 and to preserve the historic structure on the site as an open‑air pavilion. Other agenda items include a bridge‑repair contract for $382,452, an intergovernmental agreement for the Big Creek Parkway Phase 1 project with a $953,550 budget amendment, and right‑of‑way acquisition services for the Riverside Road TSPLOST project up to $350,000. The meeting also covers a conditional use request for a massage establishment at 45 West Crossville Road and a text amendment to the Unified Development Code.

litigationhistoric-preservationtransportationfinancedevelopment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Aug 1, 2024

Roswell Recreation Commission - Work Session

Commission discusses dual roles for Friends of the Roswell Parks board

The Roswell Recreation Commission is discussing a policy update to allow commission members to concurrently serve as board members for the nonprofit Friends of the Roswell Parks. This arrangement would align officer roles between the two bodies and streamline the oversight of supplemental funding for parks and recreation programs.

parksrecreationnonprofitgovernancepolicy
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Aug 1, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider a new wholesale alcohol license for DVD Cocktails LLC

The Roswell Alcoholic Beverage License Board will hold a public hearing on a new wholesale license application from DVD Cocktails LLC. It will also review an existing business application for limited pouring, beer and wine, and Sunday sales at The Great Greek Mediterranean Grill, 2000 Holcomb Bridge Road, Suite 140. The meeting includes routine agenda items such as approval of minutes and adjournment.

alcoholic-beveragelicensingwholesalerestaurantsroswell-ga
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Aug 1, 2024

Roswell Recreation Commission - Regular Meeting

Commission votes to approve dual‑role policy for Friends of Roswell Parks

The Roswell Recreation Commission will consider updating its policy to allow members to serve simultaneously on the Friends of the Roswell Parks board. The meeting also includes approval of the June 6 minutes, a review of the capital project list, and scheduling of future work sessions and commission meetings.

recreationparkspolicygovernancemeetingscapital-projects
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Mon Jul 29, 2024

Mayor and Council - Special Called Meeting

Roswell Mayor and Council hold special meeting on economic development

The Mayor and Council are reviewing an economic development update and discussing real estate acquisition. The meeting includes recognitions for a local veteran and a police detective.

economic-developmentreal-estatecontractspoliceawards
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jul 29, 2024

Mayor and Council - Open Forum

Council to consider closing discussion on personnel, litigation, and real estate

The Mayor and Council will hold an open forum for public comment. They will consider a City Attorney recommendation to close the agenda item that would discuss personnel matters, litigation issues, and real estate concerns. If adopted, the discussion on those topics would be postponed. The meeting will conclude with adjournment.

public-commentcity-attorneypersonnellitigationreal-estate
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 23, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

City to approve $382,452 bridge repair contract

The Community Development and Transportation Committee will vote on several transportation items, including accepting right‑of‑way agreements for sidewalk improvements at 415 and 419 Westside Drive and 922 Myrtle Street, which have no financial impact on the city. It will also consider authorizing a $382,452 contract with ED Contracting for bridge repairs on Riverside Road, Oxbo Road, Roxburgh Road culvert and Grimes Bridge Road. Additional items include a blanket right‑of‑way acquisition approval up to $350,000 for the Riverside Road TSPLOST project, signing an intergovernmental agreement for the Big Creek Parkway Phase 1 project, and a resolution to apply for a DOT charging‑infrastructure discretionary grant.

transportationbridgesright-of-waycontractsgrantroads
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Jul 22, 2024

Mayor and Council - Regular Meeting

City approves up to $614,565 waterline replacement contract on Maxwell Rd/Rocky Creek Ln

The Roswell Mayor and Council will vote on a contract with Wade Coots Company, Inc. for the Maxwell Road/Rocky Creek Lane waterline replacement project, limited to $614,565. They will also consider applications to accept $92,000 from the GEFA Lead and Service Line Loan Program and to receive the FY2025 National Endowment for the Arts grant for arts projects. Additional agenda items include conditional use requests for massage businesses, a resolution permitting scarecrows in the right‑of‑way, and several community‑development actions such as a small tract request, a site‑plan revision, and adoption of a capital improvement element.

waterline-replacementcontractgrantartszoningdevelopmentpublic-works
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 16, 2024

Planning Commission - Regular Meeting

Planning Commission to vote on UDC text amendment for parcels along GA 9/GA 140

The Roswell Planning Commission will consider a text amendment to the Unified Development Code, Article 13, Section 13.4.3, Letter E. The amendment would require any parcel bordering Georgia State Highway 9 or GA 140 east of GA 9 (or Highway 92) to have 51% of its square footage dedicated to non‑residential uses. The commission will also approve the minutes from the June 18, 2024 meeting.

zoningdevelopment-codeplanningland-usetransportation
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jul 11, 2024

Alcoholic Beverage License Board - Public Hearing

Roswell board to review multiple alcoholic beverage license applications

The Alcoholic Beverage License Board will hold a public hearing to consider several applications for liquor, beer, and wine licenses. These items include new business requests and changes in ownership or licensees for various Roswell establishments.

alcohollicensingbusinesspublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Jul 10, 2024

Historic Preservation Commission - Regular Meeting

Proposed exterior changes and additions for 605 Atlanta Street

The Historic Preservation Commission will review several requests for building modifications. This includes a public hearing regarding a new deck, storefront entrance, and elevator tower at 605 Atlanta Street. The commission will also consider additions to 114 Bulloch Avenue and new construction at 77 Maple Street.

historic-preservationzoningconstructionroswellpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 9, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Roswell committee considers HUD loan for housing and parking business model

The Administration, Finance, Recreation and Parks Committee is reviewing a Section 108 loan application to HUD for up to $2,039,150 to support housing redevelopment. The meeting also includes discussions on a parking business model contract and an arts grant application.

housingparkingartsfinancezoningeconomic-development
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jul 9, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Roswell considers $614,565 contract for Maxwell Road waterline replacement

The Public Safety and Public Works Committee is reviewing a contract for the Maxwell Road/Rocky Creek Lane Waterline Replacement project. The committee is also considering accepting a $92,000 GEFA loan to reimburse expenses related to lead service line inventory.

waterinfrastructurepublic-worksbudgetutilities
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jul 9, 2024

Board of Zoning Appeals - Regular Meeting

Variance requested to reduce side setbacks at 13085 Overlook Pass

The Board of Zoning Appeals will consider a request to reduce side setbacks at 13085 Overlook Pass to allow for a garage addition. The applicant seeks to change the setback from 25 feet to 15 feet due to lot topography and an existing septic field. The board will also review a lot coverage variance for 330 Shelli Lane.

zoningvarianceresidentialsetbackslot-coverage
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jul 8, 2024

Mayor and Council - Regular Meeting

Roswell Council to discuss new Public Facilities Authority and local zoning changes

The Mayor and Council will consider a resolution to establish a City of Roswell Public Facilities Authority. The agenda includes first readings for text amendments to the Unified Development Code and reviews of site plan revisions and conditional use requests. The council will also recognize an esteemed veteran and swear in a re-appointed member to the Housing Authority.

zoninghousinggovernmentdevelopmentpublic-facilities
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jul 4, 2024

Roswell Recreation Commission - Regular Meeting

Roswell Council to consider building height changes and new development plans

The Roswell Mayor and Council will review several community development requests, including a fourth-story addition for Mill Creek Place. The meeting also includes discussions on establishing a Public Facilities Authority and re-appointing a member to the Housing Authority.

zoningdevelopmenthousinggovernmentpublic-facilities
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Jul 2, 2024

Design Review Board - Regular Meeting

New 6,000 square foot Safelite automotive center at 10855 Houze Road

The Design Review Board is holding a final public hearing for a new automotive service center building at Roswell Marketplace. The proposal includes a 6,000 square foot facility with updated landscaping intended to provide screening for adjacent townhomes. The board will also consider approving the minutes from the June 4, 2024 meeting.

zoningconstructionlandscapingautomotiveroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jun 25, 2024

Community Development and Transportation Committee - Com. Dev. and Transportation Regular Meeting

Design Review Board considers new Safelite center at 10855 Houze Road

The Design Review Board is holding a final public hearing for a new 6,000 square foot automotive service center at 10855 Houze Road. The proposal includes 23 parking spaces and updated landscaping plans. Staff recommends approval provided that taller shrubs are used to screen adjacent townhomes.

zoningdevelopmentautomotivelandscaping
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Jun 24, 2024

Mayor and Council - Regular Meeting

Roswell considers creating the Crabapple Road Restaurant District

The Roswell Mayor and Council will consider establishing the Crabapple Road Restaurant District and approving an end-of-year budget amendment for fiscal year 2024. The agenda also includes a service-level agreement with American Medical Response and re-appointments to the Board of Zoning Appeals.

zoningbudgetadministrationrestaurantsappointments
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jun 20, 2024

Historic Preservation Commission - Work Session

Discussion regarding 605 Atlanta Street

The Historic Preservation Commission will hold a work session to discuss case HPC20235123 for 605 Atlanta Street. The agenda does not provide further details on the nature of this discussion.

historic-preservationroswell
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jun 18, 2024

Planning Commission - Regular Meeting

Roswell Planning Commission reviews carriage house request and plat renewal

The Planning Commission will consider a conditional use request for an 875 sq. ft. carriage house at 200 Sussex Court. The commission will also review the re-approval of an expired preliminary plat for the Colecrest development at 800 Willeo Road. Additionally, text amendments to the Unified Development Code are on the agenda.

zoninghousingdevelopmentland-useordinance
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Jun 12, 2024

Historic Preservation Commission - Regular Meeting

Proposed exterior changes at 605 Atlanta Street

The Roswell Historic Preservation Commission will consider a request for front and rear exterior changes to an existing structure at 605 Atlanta Street. The commission will also hold a discussion regarding 114 Bulloch Avenue and review minutes from the May 8, 2024 meeting.

historic-preservationzoningroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jun 11, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

New restaurant district and end-of-year budget amendments under consideration

The Administration, Finance, and Recreation and Parks Committee is reviewing a resolution to establish the Crabapple Road Restaurant District. The committee will also consider an amendment to the FY 2024 end-of-year budget. There are no action items for the Recreation and Parks department at this meeting.

zoningbudgetfinanceadministration
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jun 11, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Committee considers ambulance service agreement with American Medical Response

The Public Safety and Public Works Committee is reviewing a Service-Level Agreement with American Medical Response (AMR) to establish emergency medical response standards. The proposed agreement sets specific response times for serious and minor calls and outlines staffing requirements. Roswell's portion of the first-year subsidy for this regional agreement is $502,527.84.

ambulancefirepublic-safetycontractemergency-services
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jun 11, 2024

Board of Zoning Appeals - Regular Meeting

Historic Preservation Commission to review exterior changes at 605 Atlanta Street

The Historic Preservation Commission will consider certificates of appropriateness for two properties. This includes requested exterior modifications for 605 Atlanta Street and 114 Bulloch Avenue. The commission will also review minutes from the May 8, 2024 meeting.

historic-preservationzoningroswellexterior-modifications
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jun 10, 2024

Mayor and Council - Regular Meeting

Roswell Mayor and Council to consider $115 million six-month budget

The City of Roswell Mayor and Council will hold a second reading for the FY 2024 6-Month Budget totaling $115,019,438. The agenda includes a resolution to adjust stormwater and sanitation rates. Council members will also review road resurfacing contracts and various site plan revisions.

budgetutilitiesroadszoningcontractspublic-works
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Jun 7, 2024

Mayor and Council - Workshop

Discussion of personnel, litigation, and real estate in a closed session

The Roswell Mayor and Council will hold a workshop for ongoing planning and strategy. The agenda includes a recommendation to meet in a closed session regarding personnel, litigation, and real estate.

planningpersonnellitigationreal-estateworkshop
Old Mill Machine Shop (Next to Covered Bridge), 95 Mill Street, Roswell, GA 30075
Thu Jun 6, 2024

Roswell Recreation Commission - Work Session

Roswell Recreation Commission reviews trail art and policy revisions

The Roswell Recreation Commission is reviewing several updates to park programs and department policies. This includes considering temporary animal sculptures for Leita Thompson and Big Creek Trails and increasing annual scholarship amounts. The commission will also discuss new waitlist procedures and theme options for 2024 Youth Day.

recreationparkspolicyscholarshipsartyouth
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Jun 6, 2024

Alcoholic Beverage License Board - Public Hearing

Public hearing for several alcoholic beverage license applications

The Alcoholic Beverage License Board will hold a public hearing to consider various liquor license requests. This includes changes to existing business locations and ownership, as well as new licenses for beer and wine sales.

alcoholic-beveragelicensingpublic-hearingroswellbusiness
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jun 6, 2024

Roswell Recreation Commission - Regular Meeting

Roswell Recreation Commission to consider new policies and temporary art installation

The commission will review proposals for 'Where We Wander' temporary art and signage. Members will also consider updates to waitlist enrollment, fee waiver, and refund policies. An update on the capital project list is also scheduled.

recreationpolicypublic-artparksyouth-programs
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Jun 4, 2024

Design Review Board - Regular Meeting

Site renovation of Crabapple Office Park into a retail and restaurant center

The Design Review Board is considering a final request to renovate several buildings at 10925-10935 Crabapple Road. The project aims to convert the existing office park into a new retail and restaurant center with updated landscaping and pedestrian features.

zoningretailrestaurantlandscapingdevelopmentroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue May 28, 2024

Mayor and Council - Regular Meeting

Council to consider $115M 6-month budget, worker's comp contract

The Roswell Mayor and Council will hold a regular meeting with a first reading of the $115,019,438 FY 2024 6-month budget, which shifts the city's fiscal year to a calendar year. The consent agenda includes a two-year workers' compensation reinsurance contract with Midwest Employers Casualty at an annual premium of $174,965.00, and a contract with Seegreen Services for the Roswell Transfer Station's operation and maintenance. The regular agenda features a Design Review Board appeal for Cochran Farms, a small tract development at 55 West Crossville Road, and a resolution to apply for a Bulletproof Vest Partnership grant.

budgetcontractszoningpublic-safetyadministration
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri May 17, 2024

Mayor and Council - Workshop

Roswell Mayor and Council workshop covers planning, strategy, and closed session items

The Roswell Mayor and Council are holding a workshop to discuss ongoing planning and strategy. The agenda also includes a recommendation to close the meeting to discuss personnel, litigation, and real estate matters. No specific decisions or proposals are listed in the agenda.

planningstrategypersonnellitigationreal-estate
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Tue May 14, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Council to vote on workers' comp reinsurance contract and UDC text amendment

The Administration, Finance, Recreation and Parks Committee will consider approving a two-year workers' compensation reinsurance contract with Midwest Employers Casualty at an annual premium of $174,965.00, and a text amendment to the Unified Development Code regarding who can submit applications. The committee will also approve minutes from the April 9, 2024 meeting.

insuranceworkers-compensationzoningunified-development-codeadministrationfinance
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue May 14, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Council committee to consider awarding transfer station contract to Seegreen Services

The Public Safety and Public Works Committee will vote on awarding a seven-year contract to Seegreen Services for operation and maintenance of the Roswell Transfer Station, starting July 1, 2025. The contract would be at a fixed price of $44.25 per ton. The committee will also approve minutes from the April 9 meeting. No other action items are listed for public safety fire or police.

public-workscontractssolid-wastetransfer-stationprocurement
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue May 14, 2024

Board of Zoning Appeals - Regular Meeting

Roswell workshop to discuss planning, personnel, litigation, real estate

This is a Mayor and Council workshop, not a regular voting meeting. The agenda lists two items: ongoing planning and strategy, and a recommendation to close the meeting to discuss personnel, litigation, and real estate. No specific decisions or proposals are detailed in the agenda.

planningpersonnellitigationreal-estateworkshop
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed May 8, 2024

Historic Preservation Commission - Regular Meeting

Historic Preservation Commission to review five certificates of appropriateness

The Roswell Historic Preservation Commission will hold a public hearing on five Certificate of Appropriateness applications for changes to historic properties, including additions and expansions. The commission will also discuss Mill Village Parking and approve the February 14, 2024 minutes. Staff recommends approval for most items, with conditions on some.

historic-preservationcertificate-of-appropriatenesspublic-hearingzoningdevelopment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu May 2, 2024

Roswell Recreation Commission - Work Session

Commission to vote on manhole cover art project on Riverside Drive

The Roswell Recreation Commission will consider approving the Manhole Cover Art Project on Riverside Drive. Three artists were selected through an open call and a selection panel to create designs for 2-4 manhole risers each, incorporating water stewardship themes. The project is funded by the PUB program.

public-artrecreationstormwaterriverside-drive
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu May 2, 2024

Roswell Recreation Commission - Regular Meeting

Commission to vote on manhole cover art project on Riverside Drive

The Roswell Recreation Commission will vote on approving the Manhole Cover Art Project on Riverside Drive, which involves three artists creating designs on 2-4 manhole risers each, themed around water stewardship. The commission will also hear informational items on the Recreation & Parks End of Year Survey results and the City of Roswell Fiscal Budget, and review the capital project list.

public-artparksbudgetcapital-projectsrecreation
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Mon Apr 29, 2024

Mayor and Council - Open Forum

Council to honor veteran and fire academy graduates at open forum

The Roswell Mayor and Council are holding an open forum meeting with no legislative items. The agenda includes a proclamation naming U.S. Army First Lieutenant John M. Sikes Jr. as an 'Esteemed Veteran of Roswell' and recognition of the 2024 Citizen's Fire Academy graduates. Public comment is open with a five-minute limit per speaker.

proclamationveteransfire-departmentpublic-commentrecognition
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Apr 24, 2024

Board of Zoning Appeals - Special Called

Board to hear appeal over denied sign permit at 30 E. Crossville Road

The Roswell Board of Zoning Appeals will hold a public hearing on an appeal by Victory Media Group, LLC, contesting the city's refusal to issue a sign permit for 30 East Crossville Road. The applicant argues the city missed a 45-business-day deadline, which under the Unified Development Code deems the permit approved. Staff recommends upholding the denial. The board will also consider minutes from its April 4, 2024 special called meeting.

zoningsign-permitappealpublic-hearingadministrative-decision
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Apr 23, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Committee to consider recycling contract, UDC amendments, capital plan

The Community Development and Transportation Committee will vote on several items, including a contract award for residential curbside recycling and yard waste collection, two text amendments to the Unified Development Code, and a resolution to transmit the annual Capital Improvement Element and Community Work Program. The meeting also includes approval of the previous meeting's minutes.

zoningrecyclingcapital-improvementstransportationunified-development-code
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Apr 22, 2024

Mayor and Council - Regular Meeting

Council to approve $471K stormwater pipe lining and $2M design services contracts

The Roswell Mayor and Council will vote on several contracts and budget amendments, including a $471,040 stormwater pipe lining project, a $2 million per year design services contract for public safety facilities, and a $350,000 mobile command vehicle purchase. They will also consider a $1.34 million insurance package and a $2 million economic development consulting contract. The meeting includes proclamations, appointments, and a closed session for personnel, litigation, and real estate.

contractsbudgetpublic-safetystormwaterinsuranceeconomic-development
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Apr 18, 2024

Historic Preservation Commission - Work Session

Historic Preservation Commission to discuss 964 Alpharetta Street

The Roswell Historic Preservation Commission is holding a work session to discuss a single item: HPC20240436, concerning 964 Alpharetta Street. The agenda is otherwise procedural, with no other substantive items listed.

historic-preservationwork-sessionroswell
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Apr 16, 2024

Mayor and Council - Special Called Meeting

Council to hold closed session on personnel, litigation, real estate

This is a special called meeting of the Roswell Mayor and Council. The only substantive item is a recommendation to close the meeting to discuss personnel, litigation, and real estate matters. No other business is listed.

personnellitigationreal-estateclosed-session
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Apr 16, 2024

Planning Commission - Regular Meeting

Planning Commission to hear six-townhome proposal with variances in Historic District

The Roswell Planning Commission will hold a public hearing on a conditional use request for six townhomes at 400 Vickery Falls Drive, including two variances for rear setback and parking/driveway area. The item was deferred from a previous meeting, and staff recommends approval. The commission will also consider a rezoning request for 710 Grimes Bridge Road and approve the March 19, 2024 minutes.

zoningtownhomeshistoric-districtvariancespublic-hearingrezoning
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Apr 12, 2024

Mayor and Council - Workshop

Roswell Mayor and Council workshop to discuss planning, personnel, litigation, real estate

The Roswell Mayor and Council will hold a workshop to discuss ongoing planning and strategy. The agenda also includes a recommendation to close the meeting to discuss personnel, litigation, and real estate matters.

planningpersonnellitigationreal-estateworkshop
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Thu Apr 11, 2024

Design Review Board - Regular Meeting

Roswell Recreation Commission work session, possible council quorum

This is a work session of the Roswell Recreation Commission with a possible quorum of the Mayor and City Council. The agenda contains only procedural items: call to order and adjournment, with no substantive discussion or decisions listed.

recreationcommissionwork-sessionprocedural
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Apr 11, 2024

Roswell Recreation Commission - Work Session

Recreation Commission work session with possible council quorum

The Roswell Recreation Commission is holding a work session with a possible quorum of Mayor and City Council present. The agenda contains only a call to order and adjournment, with no listed discussion or action items.

recreationcommissionwork-sessionroswell
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Apr 11, 2024

Roswell Recreation Commission - Regular Meeting

Recreation Commission to review FY25 budget, Crabapple Middle School purchase, USL partnership

The Roswell Recreation Commission will hold a regular meeting on April 11, 2024, to approve the March 7 minutes and receive informational updates on the City of Roswell Fiscal Year Budget, the Crabapple Middle School purchase and programmatic planning, and a USL partnership with the city. The commission will also review the capital project list and upcoming meetings. No votes are scheduled on these informational items.

budgetschoolssportsparkscapital-projects
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Apr 9, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Council committees to consider $1.34M insurance contract and $2M/yr economic development consulting deal

The Administration and Finance and Recreation and Parks Committees will vote on several contracts, including a $1,338,044 insurance package with GIRMA and a five-year economic development consulting contract with Seer World LLC (up to $2,000,000 per year). They will also consider two Mimosa Hall improvement projects and a tree planting partnership with Elkins Pointe Middle School. The meeting includes approval of the prior meeting's minutes.

insuranceeconomic-developmentcontractsparkspublic-works
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Apr 9, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Council to consider $471K stormwater pipe lining contract and $350K used command vehicle purchase

The Public Safety and Public Works Committee will vote on three action items: approving the previous meeting's minutes, purchasing a used 2015 Spartan mobile command vehicle for $350,000, and awarding a $471,040 contract for the Branch Valley stormwater pipe lining project. The committee will also consider a $2,000,000 per year design services contract for public safety facilities.

policepublic-worksstormwatercontractsbudgetpublic-safety
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Apr 9, 2024

Board of Zoning Appeals - Regular Meeting

BZA to hear variance request for Safelite build-to-zone at 10855 Houze Road

The Board of Zoning Appeals will hold a public hearing on a request for two variances to the build-to-zone requirements for a proposed 6,000-square-foot Safelite auto glass building at 10800 Alpharetta Hwy (10855 Houze Road). The applicant seeks to increase the maximum setback from 20 to 46.91 feet and reduce the required building frontage percentage from 75% to 40.7%, citing the lot's size, shape, and topography. Staff recommends approval. The board will also consider the minutes from its March 12, 2024 meeting.

zoningvariancebuild-to-zonecommercialpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Apr 8, 2024

Mayor and Council - Regular Meeting

Roswell Council to vote on rezoning, land purchases, and eminent domain

The Roswell Mayor and Council will hold a regular meeting with several significant items, including a rezoning request, approval of a final plat, a budget amendment for land purchase, and resolutions authorizing property acquisitions and potential eminent domain. The council will also consider changing the city's fiscal year and discuss a text amendment to the emergency management services code.

zoningland-useeminent-domainbudgettransportationpublic-safety
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Apr 4, 2024

Alcoholic Beverage License Board - Public Hearing

Roswell zoning board hears 10 appeals of administrative decisions

The Roswell Board of Zoning Appeals will hold a public hearing on ten appeals of administrative decisions, all submitted by Victory Media Group LLC. Staff recommends upholding the original decisions in each case. The board will vote on whether to uphold or overturn these decisions.

zoningappealspublic-hearingalcoholroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Apr 4, 2024

Board of Zoning Appeals - Special Called

Board hears 10 appeals of administrative decisions on April 4

The Roswell Board of Zoning Appeals will hold a special called meeting on April 4, 2024, to hear ten appeals of administrative decisions, all listed as public hearings. Each item involves an applicant appealing a staff decision, with staff recommending the board uphold the original decision. The agenda provides limited detail on the nature of each appeal, but the board will decide whether to uphold or overturn each administrative ruling.

zoningappealspublic-hearingadministrative-decision
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Mar 26, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Roswell committee to consider $1.23M GDOT road funding, street policy updates

The Community Development and Transportation Committee will vote on several transportation items, including accepting $1,234,007.25 in state road funding, updating the public-to-private streets policy, and minor traffic calming program changes. The committee will also consider a permanent easement for a traffic signal pole and approve revisions to construction specifications.

transportationstreetsfundingeasementtraffic-calmingconstruction-specifications
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Mar 19, 2024

Planning Commission - Regular Meeting

Planning Commission to consider 8 townhomes at 400 Vickery Falls Drive

The Roswell Planning Commission will hold a public hearing on a conditional use request for eight townhomes at 400 Vickery Falls Drive in the Historic District, along with two variances. Staff recommends approval. The commission will also consider a rezoning of 630 Colonial Park Drive from OP to CX and approve the February 20, 2024 minutes.

zoningtownhomeshistoric-districtvariancesrezoning
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Mar 13, 2024

Historic Preservation Commission - Regular Meeting

Planning Commission to weigh 8 townhomes at 400 Vickery Falls Drive

The Roswell Planning Commission will hold a public hearing on a conditional use request for eight townhomes at 400 Vickery Falls Drive in the Historic District, including two variances. Staff recommends approval. The commission will also consider a rezoning of 630 Colonial Park Drive from OP to CX and approve the February 20, 2024 minutes.

zoningtownhomeshistoric-districtvariancesrezoning
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Mar 12, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Roswell committee to vote on removing and redesigning RosWall mosaic

The Administration, Finance, and Recreation and Parks Committee will consider approving the deaccession and redesign of the RosWall, a mosaic retaining wall along Forrest Street. The proposal would remove the deteriorating 2008 mosaic, install thin brick, and add new plantings using existing funds. The committee will also approve the minutes from its February 13, 2024 meeting.

public-artparksadministrationfinancerosWall
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Mar 12, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Roswell committee to consider $599,785 Riverside Park design contract and emergency code update

The Public Safety and Public Works Committee will vote on several items, including a text amendment to the city's emergency management ordinance, multiple mutual aid agreements, and two design contracts for parks. The committee is also set to approve minutes from its February 13 meeting. All items are recommendations that will move to the full Mayor and Council for final approval.

public-safetypublic-worksemergency-managementpoliceparkscontractsgrants
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Mar 12, 2024

Board of Zoning Appeals - Regular Meeting

BZA to hear stream buffer variance for 180 Thompson Place

The Roswell Board of Zoning Appeals will hold a public hearing on a request by property owner Robert Myers for a variance to encroach into the 100-foot undisturbed stream buffer and 150-foot city impervious setback at 180 Thompson Place. Staff recommends approval, noting the proposed house would reduce encroachment by about 5% compared to existing conditions. The board will also consider the minutes from the January 9, 2024 meeting.

zoningvariancestream-bufferpublic-hearingroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Mar 11, 2024

Mayor and Council - Regular Meeting

Council to consider parking deck, Green Street plan, property purchases

The Roswell Mayor and Council will vote on several items, including approving a parking deck location and Green Street Activation Plan, authorizing property acquisition, and entering a purchase agreement for 11261 Alpharetta Street. They will also consider a second reading of a massage establishment ordinance amendment and an appeal of a denied massage license.

zoningparkingmassage-establishmentsproperty-purchasecontracts
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Mar 7, 2024

Roswell Recreation Commission - Regular Meeting

Recreation Commission to review FY25 budget, park activity bans, and Crabapple Middle School property

The Roswell Recreation Commission is holding a regular meeting with informational items on the FY25 department budget, a proposed policy amendment on activities prohibited in parks, and the Crabapple Middle School property. The commission will also vote on approving the minutes from the February 1, 2024 meeting.

budgetparkspolicyschool-propertyminutes
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Mar 7, 2024

Alcoholic Beverage License Board - Public Hearing

Board to hear 4 alcohol license requests, incl. new Fiesta Bar y Parrilla

The Roswell Alcoholic Beverage License Board will hold a public hearing to consider four alcohol license applications: a new owner for Loquom Lounge, a new location for San Miguel #3, a new business Fiesta Bar y Parrilla, and a new licensee for Morningbirds the Brunch Place. The board will also approve minutes from its February 1, 2024 meeting.

alcohol-licensespublic-hearingbusiness-licensesrosell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Mar 7, 2024

Roswell Recreation Commission - Work Session

Recreation Commission work session: call to order, adjournment only

This is a procedural work session agenda for the Roswell Recreation Commission. The only listed items are a call to order and adjournment, with no discussion or decision items specified.

recreationcommissionprocedural
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Mar 5, 2024

Design Review Board - Regular Meeting

Roswell DRB to vote on St. Michael's Church expansion, 14,000 sq ft sanctuary

The Design Review Board will hold a public hearing and vote on a final approval for St. Michael's Catholic Church's expansion at 715 Hardscrabble Road, which includes a new 14,000-square-foot sanctuary, parking expansion, and a second entrance off Coleman Drive. The board will also discuss a rezoning request at 630 Colonial Park Drive and elect its 2024 chair and vice chair.

design-reviewchurch-expansionrezoningparkingpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Feb 27, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Council to consider $250K safety plan contract and Maple Street road work agreement

The Community Development and Transportation Committee will vote on several items, including approving minutes, replacing retaining walls at Champions Green, authorizing a developer agreement for concrete work on Maple Street, awarding a $250,000 contract for a citywide safety action plan, and increasing CIP program management capacity. The meeting includes both decisions and discussions, with no public hearings listed.

zoningtransportationcontractssafetytrailspublic-worksbudget
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Feb 26, 2024

Mayor and Council - Regular Meeting

Council to vote on $6.5M Crabapple Middle School purchase and other land buys

The Roswell Mayor and Council will consider several significant real estate purchases, including a $6.5 million agreement with Fulton County Schools for Crabapple Middle School and an option on Independence High School, plus properties on Green Street and Alpharetta Street. They will also vote on a $3.5 million federal grant to hire 30 firefighters, a stormwater pipe lining contract, and a text amendment on massage establishments.

real-estateschoolsfire-departmentstormwaterbudgetzoning
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Feb 20, 2024

Mayor and Council - Retreat

Roswell Mayor and Council hold multi-day retreat at Barnsley Resort

The Roswell Mayor and City Council are holding a retreat from February 20 to 23, 2024, at Barnsley Resort in Adairsville, Georgia. The agenda lists attendees but no specific discussion items, indicating this is a planning or team-building session rather than a regular business meeting.

retreatmayor-and-councilroswellmeeting
Barnsley Resort, 597 Barnsley Gardens Road, Adairsville, GA 30103
Tue Feb 20, 2024

Planning Commission - Regular Meeting

Planning Commission to review revised plat for The Groves at Myrtle Street townhomes

The Roswell Planning Commission will hold a public hearing on a revision to the preliminary plat for The Groves at Myrtle Street, a townhome development at 913 Myrtle Street. The revision reduces the number of townhomes from 30 to 27 and lowers the retaining wall height from 14 feet to 5 feet 9 inches. Staff recommends approval. The commission will also consider approving the minutes from the January 16, 2024 meeting.

planning-commissionpublic-hearingpreliminary-plattownhomeszoningroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Feb 14, 2024

Historic Preservation Commission - Regular Meeting

HPC to decide on new 2-story office building at 801 Atlanta Street

The Historic Preservation Commission will hold a public hearing on a certificate of appropriateness for a new two-story office building at 801 Atlanta Street, which staff recommends approving with conditions. The commission will also elect a chair and vice chair and approve the January 10, 2024 minutes.

historic-preservationcertificate-of-appropriatenessconstructionofficeelectionsminutes
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Feb 13, 2024

Board of Zoning Appeals - Regular Meeting

Historic Preservation Commission to decide on new office building at 801 Atlanta Street

The Roswell Historic Preservation Commission will hold a public hearing on a certificate of appropriateness for a new two-story office building at 801 Atlanta Street. The Community Development Department recommends approval with conditions. The commission will also elect a chair and vice chair and approve the January 10, 2024 minutes.

historic-preservationcertificate-of-appropriatenesszoningpublic-hearingelections
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Feb 13, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Roswell committee to weigh $4.5M land purchase, retirement plan switch

The Administration, Finance, and Recreation and Parks Committee will consider several administrative and financial items, including a $4.5 million land purchase, a change in retirement plan providers, and an amendment to the city administrator's authority. The committee will also review a proposed extension of an agreement with the Fulton County School District for construction permitting and inspection fees.

budgetland-purchaseretirementcity-administratorschool-districtcdbg
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Feb 13, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Council to consider $3.5M SAFER grant to hire 30 firefighters

The Public Safety and Public Works Committee will vote on a resolution to apply for and accept a 2023 SAFER grant of up to $3,500,000 to hire 30 full-time firefighters, with no local match required. The committee will also consider awarding a contract for the Cold Harbor Stormwater Pipe Lining Project and approving the 2024 Stormwater Utility Master Plan. The meeting includes approval of the January 9, 2024 minutes.

firegrantsstormwaterpublic-safetypublic-works
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Feb 12, 2024

Mayor and Council - Regular Meeting

Council to vote on massage parlor rules, road work, and appointments

The Roswell Mayor and Council will hold a regular meeting with several appointments, appeals, and ordinance changes. Key items include appeals of denied massage establishment licenses, a text amendment regulating massage establishments, approval of the FY2024 road resurfacing list, and a traffic change on Horton Drive. The agenda also includes routine appointments to boards and commissions.

zoningmassage-establishmentsroadsappointmentsordinancetraffic
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Feb 1, 2024

Alcoholic Beverage License Board - Public Hearing

Roswell liquor board hears 5 alcohol license requests

The Roswell Alcoholic Beverage License Board will hold a public hearing to consider five alcohol license applications, including new businesses, ownership changes, and a new licensee. All requests are for full pouring licenses covering liquor, beer, and wine, with Sunday sales where noted.

alcohol-licensespublic-hearingbusinessroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Feb 1, 2024

Roswell Recreation Commission - Work Session

Recreation Commission to align park policies with city ordinance

The Roswell Recreation Commission will consider amending eight recreation policies so their wording matches the City Ordinance, splitting policy 1114 into two, rescinding policy 1124 on enforcement, and adding a new policy 1129 for future ordinance updates. The changes are informational and have no financial impact.

recreationparksordinancepoliciescommission
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Feb 1, 2024

Roswell Recreation Commission - Regular Meeting

Recreation Commission to align policies with city ordinance

The Roswell Recreation Commission will vote on several policy amendments to align its Recreation and Parks Policies and Procedure Manual with the City Ordinance, including splitting Policy 1114 into two policies and rescinding Policy 1124. The commission will also receive a capital project list and discuss upcoming meetings.

recreationparkspoliciesordinancecommission
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Mon Jan 29, 2024

Mayor and Council - Open Forum

Council to consider final plat for 74 townhomes at East Village

The Roswell Mayor and Council will hold an open forum following a special called meeting. The main business item is a recommendation to approve the final plat for East Village, a 74-unit townhome development at 2600 Holcomb Bridge Road. The meeting also includes a veteran proclamation, a report on upcoming city events, and a recommendation to close the meeting for discussions on personnel, litigation, and real estate.

zoningdevelopmentveteranspublic-safetycity-council
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jan 29, 2024

Mayor and Council - Special Called Meeting

Council hears three appeals of denied massage establishment licenses

The Roswell Mayor and Council will hold a special called meeting to hear three appeals of denied massage establishment licenses at specific addresses. The appeals are presented by the Chief of Police. No other business is listed on the agenda.

licensesappealspublic-safetybusiness-regulations
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Jan 26, 2024

Planning Commission - Special Called Meeting

Planning Commission to review final plat for 74-townhome East Village

The Roswell Planning Commission is holding a special called meeting to consider a single agenda item: the final plat for East Village, a 74-unit townhome development at 2600 Holcomb Bridge Road. Staff recommends approval, and the commission's recommendation will go to the Mayor and City Council.

planning-commissionfinal-plattownhomeseast-villageholcomb-bridge-road
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jan 23, 2024

Historic Preservation Commission - Work Session

Historic Preservation Commission to discuss 801 Atlanta Street project

The Roswell Historic Preservation Commission is holding a work session to discuss a single item: HPC20234445, concerning 801 Atlanta Street. The agenda is otherwise procedural, with no other substantive items listed.

historic-preservationwork-sessionroswell
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jan 23, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Roswell committee to weigh Horton Drive access change, traffic calming update, road list

The Community Development and Transportation Committee will consider three transportation items: converting a portion of Horton Drive to a one-way entrance from SR-9, updating the Traffic Calming Program policy to allow vertical deflection treatments like speed humps, and accepting the FY2024 Road Resurfacing List. The meeting also includes approval of the previous meeting's minutes. No community development action items are on the agenda.

transportationtraffic-calmingroad-resurfacingpublic-safetyzoning
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Jan 22, 2024

Mayor and Council - Regular Meeting

Council to vote on $244K facilities assessment and $479K stormwater lining contracts

The Roswell Mayor and Council will consider two significant contracts: a $244,000.25 facilities condition assessment with Bureau Veritas Technical Services, LLC, and a $479,880 stormwater lining project with Vortex Services, LLC. They will also hold first readings on text amendments regarding massage/spa establishments and water conservation, and consider a final plat for East Village at 2600 Holcomb Bridge Road. Several proclamations and recognitions are scheduled, and the meeting includes a closed session for personnel, litigation, and real estate.

contractszoningwaterparkspublic-works
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Jan 17, 2024

Historic Preservation Commission - Work Session

Historic Preservation Commission work session scheduled for January 17

The Historic Preservation Commission will hold a work session with members and city staff. The agenda consists of general discussion and contains no specific project or legislative items.

historic-preservationwork-sessiongovernment-procedure
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jan 16, 2024

Planning Commission - Regular Meeting

Roswell Planning Commission to review preliminary plat for St. Michael's Church property

The Roswell Planning Commission will hold a public hearing on a preliminary plat for 715 Hardscrabble Road, the site of St. Michael's Catholic Church, to combine two lots into one 6.02-acre lot and dedicate right-of-way along Coleman Drive. The commission will also consider two text amendments to the Unified Development Code, including one that would give the Environmental/Public Works Director sole authority over stormwater management regulations. Additionally, the commission will elect its 2024 chair and vice chair and approve the minutes from a December 2023 special called meeting.

zoningplatstormwatertext-amendmentpublic-hearingelection
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Jan 10, 2024

Historic Preservation Commission - Regular Meeting

New two-story office building proposed for 801 Atlanta Street

The Historic Preservation Commission is considering a request for a certificate of appropriateness to construct a new two-story office building. The project includes a first-floor parking deck and a second floor with offices and an outdoor balcony. Community Development staff recommends approval of the project with specific conditions.

zoninghistoric-preservationcommercial-developmentoffice-spaceroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jan 9, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Roswell committee to consider moving Youth Day to first Saturday in October

The Administration, Finance, and Recreation and Parks Committee will consider two action items: resending the 1952 Youth Day proclamation to change the celebration date to the first Saturday in October, and amending city code to prohibit open fires in river parks. The meeting also includes approval of the December 12, 2023 minutes.

youth-dayparksfire-safetymunicipal-codeproclamation
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jan 9, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Council to consider $244K facilities assessment and $479,880 stormwater lining contracts

The Public Safety and Public Works Committee will vote on awarding two contracts: a $244,000.25 Facilities Condition Assessment to Bureau Veritas Technical Services, LLC, and up to $479,880 for three Stormwater Lining projects to Vortex Services, LLC. The committee will also consider amending city ordinances on plumbing/water conservation and lawn irrigation. The meeting includes approval of prior minutes; no action items are listed for fire or police.

public-safetypublic-workscontractsfacilities-assessmentstormwaterordinancewater-conservation
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Jan 9, 2024

Board of Zoning Appeals - Regular Meeting

BZA to hear stream buffer variance for garage at 270 Park Bridge Lane

The Board of Zoning Appeals will hold a public hearing on a request by Bernard McHugh for two variances at 270 Park Bridge Lane to build a detached garage and breezeway. The variances would allow encroachment into the 100-foot undisturbed stream buffer and 150-foot impervious setback. Staff recommends approval with conditions. The board will also consider minutes from the October 12, 2023 meeting.

zoningvariancestream-buffergaragepublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jan 8, 2024

Mayor and Council - Regular Meeting

Council to approve $4.5M purchase of 1340 Woodstock Road property

The Roswell Mayor and Council will hold a regular meeting on January 8, 2024, featuring the swearing-in of councilmembers and a proclamation. Key business includes approving a resolution to close on the purchase of the property at 1340 Woodstock Road for $4.5 million, and considering a final plat for East Village at 2600 Holcomb Bridge Road. The council will also discuss a text amendment to the Unified Development Code regarding massage and spa establishments, and may enter a closed session for personnel, litigation, and real estate matters.

real-estatezoningland-usecity-councilmeeting
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jan 4, 2024

Alcoholic Beverage License Board - Public Hearing

Board to hear new alcohol license requests for Computer Museum and CVS

The Roswell Alcoholic Beverage License Board will hold a public hearing to consider new alcohol license applications, including a full pouring license for the Computer Museum of America and a package beer and wine license for a CVS Pharmacy. The board will also approve additional license renewals for 2024 and review minutes from the previous meeting.

alcohol-licensespublic-hearingbusiness-licensesroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jan 4, 2024

Roswell Recreation Commission - Work Session

Roswell Recreation Commission work session with possible council quorum

This is a work session of the Roswell Recreation Commission. The agenda contains only a call to order and adjournment, with no listed discussion items. A possible quorum of the Mayor and City Council may be present.

recreationcommissionwork-sessionroswell
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Jan 4, 2024

Roswell Recreation Commission - Regular Meeting

Recreation Commission to discuss new registration system and capital projects

The Roswell Recreation Commission will hold a regular meeting to approve the October 5, 2023 minutes, discuss the newly selected registration system, review the capital project list, and set upcoming meeting dates. The agenda is largely procedural, with no major decisions or public hearings scheduled.

recreationregistration-systemcapital-projectsmeeting-minutescommission
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Jan 2, 2024

Design Review Board - Regular Meeting

Board hears liquor license requests for Computer Museum and CVS

The Alcoholic Beverage License Board holds a public hearing to consider new alcohol license applications, including a full pouring license for the Computer Museum of America and a package beer and wine license for a CVS Pharmacy. The board will also approve additional license renewals for 2024 and review minutes from the previous meeting.

alcohol-licensespublic-hearingbusiness-licenses
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075