The Boring PartsFederalLocal · USLocal · Canada
Hyattsville, MD

Hyattsville public meetings in 2022

172 substantive meetings from 2022, with official agendas or minutes and plain-English summaries.

Thu Dec 29, 2022 · 19:00

Compensation Review Committee

Committee discusses potential compensation recommendations due January 5th

The Compensation Review Committee will review survey results and receive updates on interviews with former officials. The committee will also hold an open discussion regarding potential recommendations due January 5th.

compensationhyattsvillegovernment-reviewinterviewssurvey
✓ Decided: Compensation Committee discusses city official pay and plans resident survey

The committee reviewed current salary levels for the Mayor and Council members and heard testimony from former council member Shani Warner. Members scheduled interviews with former council members and set a deadline for a resident survey.

Tue Dec 27, 2022 · 16:00

Race and Equity Task Force

Committee reviews stipend program and plan presentation timeline

The Race and Equity Task Force will review the Committee Stipend Program and receive updates from the Equity Officer. The committee will also discuss the timeline for presenting a task force plan to the Council.

race-and-equitystipend-programequity-officercommittee-updates
✓ Decided: Race and Equity Task Force approves 2023 meeting calendar

The Task Force approved the 2023 meeting calendar and the minutes from the October meeting. Members discussed the FY24 budget process, the committee stipend pilot program, and the timeline for upcoming Council presentations.

Mon Dec 19, 2022 · 19:00

City Council

Public hearing regarding adjustments to Hyattsville ward boundaries

The City Council is conducting a public hearing for Charter Amendment 2022-02. This session includes a presentation and a period for public input concerning the adjustment of the city's five ward boundaries.

ward-boundariescharter-amendmentpublic-hearing
✓ Decided: City Council held public hearing on adjusting ward boundaries

The City Council conducted a virtual public hearing to receive resident input on Charter Amendment 2022-02 regarding the adjustment of the city's five ward boundaries. No formal vote was taken on the amendment during this session.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Councilmember Simasek, seconded by Councilmember Sandino, that meeting be a djourned. The motion carried by the following vote:
8 absent
Croslin absent · Schaible absent · Denes absent · Waszczak absent · Strab absent · Sandino absent · Solomon absent · Peabody absent
Mon Dec 19, 2022 · 19:00

City Council

Hyattsville Council to adopt resolution adjusting city ward boundaries

The City Council will vote on a resolution to adjust ward boundaries based on recent census data. The meeting also includes first readings for ordinances regarding 5G permits and ethics code updates. Additionally, the council will discuss a proposal to regulate plastic bag use in retail and food service establishments.

ward-boundariesethics5genvironmentpublic-workspolice
✓ Decided: City Council adjusts ward boundaries and introduces 5G and ethics ordinances

The City Council adopted a resolution to adjust the five ward boundaries based on census data. Council also introduced updates to the ethics code and a new 5G permit ordinance. Several police and public works contracts were approved via the consent agenda.

Thu Dec 15, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

The committee will finalize recommendations for the Thrive Grant.

The Health, Wellness, and Recreation Advisory Committee will discuss community health initiatives and program updates. This includes finalizing recommendations for the Thrive Grant and discussing suggested programs related to the opioid settlement. The meeting also covers planning for a Bike Rodeo and potential speaker series programs for FY23.

healthwellnessrecreationgrantscommunity-programs
✓ Decided: Committee recommends $300 funding increase for Thrive Grant applicants

The committee unanimously approved a recommendation to grant each Thrive Grant applicant an additional $300. Members also discussed the status of the Mental Health First Aid training and the ongoing community survey on Hello Hyattsville.

Thu Dec 15, 2022 · 19:00

Compensation Review Committee

Compensation Review Committee discusses outreach and upcoming recommendation deadline

The committee is discussing community survey drafts and outreach to former elected officials. Members will also review the stipend program for meeting attendance. A deadline of January 30 has been set for the final recommendation memo.

compensationoutreachgovernmentsalary
✓ Decided: Compensation Review Committee discusses council and mayoral pay

The committee heard testimony from former council member Shani Warner regarding salary levels and candidate diversity. No formal votes were taken on compensation changes during this meeting.

Tue Dec 13, 2022 · 16:00

Hyattsville Environment Committee

Discussion of plastic bag ordinance and invasive species management

The Hyattsville Environment Committee will consider a proposed letter of support for expanding invasive vine removal with CCAN. The agenda also includes discussions regarding a plastic bag ordinance, ARPA funding for energy projects, and the Nine Pond Project.

plastic-bagsinvasive-speciesenergywastehyattsville
Tue Dec 13, 2022 · 16:00

Ethics Commission

Hyattsville Ethics Commission to review campaign finance reports and ordinances

The Hyattsville Ethics Commission will review third campaign finance reports, annual campaign finance reports, and report revisions. The agenda also includes a discussion regarding a candidate ethics video and an ordinance review.

ethicscampaign-financeordinance
✓ Decided: Ethics Commission approves updates to campaign finance reporting forms

The commission approved revisions to campaign finance cover sheets and workbooks to be used in the 2023 elections. The body also reviewed campaign and annual reports, identifying deficiencies in some filings and accepting others.

Thu Dec 8, 2022 · 19:30

Redistricting Commission

Hyattsville Redistricting Committee discusses upcoming public hearing presentation

The committee is preparing a presentation for the December 19, 2022, public hearing. This includes reviewing selected maps compared to current maps and discussing impacts on residents moved to new wards.

redistrictingwardshyattsvillepublic-hearing
✓ Decided: Redistricting Committee meeting cancelled due to lack of quorum

The meeting was unable to conduct official business because a quorum was not achieved. The committee will finalize the presentation for the December 19 public meeting via email.

Wed Dec 7, 2022 · 16:00

Shade Tree Board

Proposed revisions to Chapter 112

The Shade Tree Board will review the November 2022 minutes and establish a meeting calendar for 2023. The board will also receive a report on permits, denials, and illegal removals and discuss proposed revisions to Chapter 112.

shade-treespermitsordinances
✓ Decided: Shade Tree Board approves tree replacement language and 2023 meeting dates

The Board approved specific language for tree-for-tree replacements and a $200 fee for planting trees elsewhere in the city. The 2023 meeting calendar was unanimously approved. The Board also reviewed board member stipends and officer term limits.

Tue Dec 6, 2022 · 16:00

Board of Supervisors of Election

Review of May election calendar and voting logistics

The Board of Supervisors of Elections will review the May election calendar and discuss recommendations for Vote by Mail (VBM). The meeting also includes discussion regarding polling site logistics, candidate information videos, and outreach.

electionsvotinghyattsville
Mon Dec 5, 2022 · 19:00

City Council

Hyattsville Council considers $500,000 increase for Small Business Emergency Relief

The Hyattsville City Council is meeting to vote on several funding increases and infrastructure projects. Key items include a $500,000 boost for small business relief and new contracts for traffic calming designs. The council will also review zoning requests and committee appointments.

small-businesszoninginfrastructurebudgetpublic-worksanimal-welfare
✓ Decided: City Council requests denial of Suffrage Point Detailed Site Plan 21001

The City Council voted to request the denial of the Suffrage Point DSP 21001 while providing conditional requirements if approved. Other actions included increasing small business relief funding and approving several transportation and infrastructure contracts.

🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
A motion was made by Council President Solomon, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
1 yea · 1 nay
Strab yea · Peabody nay
The other 7 items passed by unanimous or near-unanimous consent.
Thu Dec 1, 2022 · 19:00

Compensation Review Committee

Committee to elect Chair and review salary survey

The Compensation Review Committee will elect a new Chair and review a salary survey with HR staff. The committee also plans to review previous outreach resources and may hear from City Treasurer Ron Brooks.

compensationsalaryhuman-resourceshyattsville
✓ Decided: Compensation Review Committee discusses metrics for mayor and council pay

The committee reviewed city budget forecasts and a salary survey of similar jurisdictions. Members discussed potential remuneration options, including health insurance subsidies and public engagement methods for resident feedback.

Tue Nov 29, 2022 · 16:00

Ethics Commission

Review of campaign finance reports and ordinance review

The Hyattsville Ethics Commission will review third, annual, and revised campaign finance reports. The meeting also includes a discussion regarding a candidate ethics video and an ordinance review.

ethicscampaign-financeordinance
✓ Decided: Ethics Commission meeting cancelled due to lack of quorum

The meeting was cancelled because the commission failed to achieve a quorum by 5:15 p.m. No substantive decisions were made.

Mon Nov 28, 2022 · 16:00

Education Advisory Committee

EAC discusses school safety protocols and ARPA funding use

The committee will discuss Hyattsville Police Department programs, including active attack response protocols and overdose incidents. Members will also receive updates on grant applications and the potential use of ARPA funds for Title I middle school students.

policeschool-safetyfundingeducation
✓ Decided: Education Advisory Committee reviews police school programs and safety protocols

The committee discussed Hyattsville Police Department school programs, active attack response protocols, and Narcan training. No substantive policy decisions were made, though the committee scheduled future guests and meetings.

Tue Nov 22, 2022 · 16:00

Race and Equity Task Force

Developing a work plan and timeline for a presentation to the City Council

The Race and Equity Task Force will discuss creating a timeline and work plan for an upcoming Council presentation. The committee will also receive updates from the Equity Officer and review the Native American Heritage Month Panel.

race-and-equitycity-councilwork-plancommunity-updates
Mon Nov 21, 2022 · 19:00

City Council

Hyattsville City Council to discuss ward redistricting and animal welfare ordinance

The Hyattsville City Council will meet to discuss selecting a map for ward redistricting. The agenda also includes the first reading of an updated animal welfare ordinance and a redesign plan for Church Place. Additionally, the Council will consider several contracts for city equipment and professional services.

ward-redistrictinganimal-welfareinfrastructurebudgetzoningpublic-safety
✓ Decided: City Council selects 'Council Requests Option B' for ward redistricting

The City Council approved a new ward boundary map and scheduled a public hearing for December 19, 2022. The Council also introduced an animal welfare ordinance and approved several municipal equipment purchases and contracts.

🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
A motion was made by Council President Solomon, seconded by Councilmember Strab, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Waszczak, Haba…
3 yea · 1 nay
Schaible yea · Denes yea · Peabody yea · Simasek nay
The other 7 items passed by unanimous or near-unanimous consent.
Fri Nov 18, 2022 · 16:00

Age Friendly Work Group

Hyattsville Age-Friendly Work Group discusses programming and support services

The work group is reviewing FY23 age-friendly programming, including upcoming workshops on emergency preparedness and affordable housing. The meeting includes a review of a capstone report regarding community-based support services for the aging population. Additionally, members will receive updates on Hyattsville Aging in Place and the Age-Friendly Ecosystem Summit.

agingprogrammingworkshopscommunity-serviceshyattsville
Thu Nov 17, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Review of Thrive Grant applications and planning for upcoming programs

The committee will review applications for the Thrive Grant and discuss potential speaker series programs for FY23. Agenda items also include planning for a Bike Rodeo and updates on Mental Health First Aid and Narcan training.

healthwellnessgrantscommunity-eventspublic-safety
✓ Decided: Committee approves multiple Thrive Grant applications

The Health, Wellness, and Recreation Advisory Committee approved funding for several Thrive Grant applicants after reviewing follow-up questions. The committee also set potential dates for a Bike Rodeo event. One grant application was not approved due to a lack of response from the applicant.

Thu Nov 17, 2022 · 16:00

Educational Facilities Task Force

Updates on Hyattsville Elementary and Middle School facilities

The Educational Facilities Task Force will discuss the timeline for Hyattsville Elementary School and the current status of Hyattsville Middle School. The agenda also includes a discussion regarding returning to traditional funding.

educationschoolshyattsvillefacilities
Thu Nov 17, 2022 · 19:00

Compensation Review Committee

Introduction of Compensation Review Committee mission and officer elections

The meeting provides an overview of the Compensation Review Committee's mission, scope, and timeline. Members will discuss committee goals and elect a chair and recordkeeper.

compensationcommitteehyattsvillegovernment-operations
✓ Decided: Compensation Review Committee begins review of Mayor and Council salaries

The committee met to establish its scope for reviewing salaries for the Mayor and Councilmembers starting in July 2025. Members discussed the need for financial forecasts and salary surveys to inform their recommendations. No salary changes were decided during this meeting.

Tue Nov 15, 2022 · 16:00

Planning Committee

Suffrage Point townhome presentation and local development updates

The Planning Committee will review a presentation regarding the Suffrage Point lower lot townhome development. The meeting also includes progress updates on the Riverfront and Canvas developments and construction on the Rhode Island Trolley Trail.

zoninghousingdevelopmentinfrastructuretransportation
✓ Decided: Planning Committee unanimously approves Suffrage Point townhome project

The Planning Committee approved a proposal for 41 townhomes at Suffrage Point, including a variance for impervious surface to allow for deeper porches. The committee recommended the City accept the project's public alley and requested improvements to path lighting and window materials.

Mon Nov 14, 2022 · 19:30

Redistricting Commission

Review of updated redistricting maps and council comments

The Redistricting Committee will review Council comments and an updated map. The meeting includes reviewing map options and a written memo for the Council. The committee will also discuss the upcoming schedule for reviews, public hearings, and votes.

redistrictinghyattsvillemapsgovernment
✓ Decided: Redistricting Commission drops Minimal Adjustments map, pursues Council Request variants

The Commission voted to stop work on the Minimal Adjustments map due to population deviation issues. It approved the creation of up to two variant maps based on Council requests that meet legal requirements. The Commission will provide a memo to Council outlining the rationale for these options and the Growth Conscious version 4 map.

Wed Nov 9, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

The committee will discuss selecting a new chairperson and recruiting more members.

The committee will address the selection of a new Chairperson and Vice Chairperson due to term limits. Members will also discuss recruiting new members and follow up on items from the October meeting.

policepublic safetyrecruitmentleadershiphyattsville
Tue Nov 8, 2022 · 16:00

Hyattsville Environment Committee

The committee will discuss invasive vine removal and legislative recommendations.

The Hyattsville Environment Committee will review current efforts regarding invasive vine removal and potential expansion with CCAN. The meeting also includes an update on the University Hills Green Team.

environmentinvasive-specieslegislationhyattsvilleuniversity-hills
✓ Decided: Environment Committee approves October meeting minutes

The committee approved the October meeting minutes. Members discussed a proposed stormwater management grant to partner with CCAN and AWS for invasive vine removal, as well as potential ARPA funding for rental property weatherization.

Mon Nov 7, 2022 · 19:00

City Council

Hyattsville Council considers $18.7 million budget amendment for Hamilton Street

The City Council is reviewing several budget amendments and contract approvals. Key items include funding for street improvements, small business relief, and vehicle purchases. The council will also consider various proclamations and committee appointments.

budgetpublic-workssmall-businesspoliceinfrastructuregrants
✓ Decided: City Council denies WSSC utility easement and zoning variance request

The Council approved several equipment purchases and proclamations but failed to select a ward redistricting map. It denied a water and sewer utility easement for David C. Driskell Community Park and opposed a zoning variance for 3510 Lancer Drive.

🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Councilmember Haba, seconded by Council President Solomon, that this agenda item be Tabled. The motion carried by the following vote: Page 10 of 17 City Council Meeting Minutes…
2 yea
Denes yea · Simasek yea
A motion was made by Councilmember Simasek, seconded by Councilmember Denes, that this agenda item be Approved. The motion failed by the following vote: Croslin, Denes, Simasek, Haba, and Peabody
4 yea · 1 absent
Solomon yea · Schaible yea · Sandino yea · Strab yea · Waszczak absent
A motion was made by Council Vice-President Schaible, seconded by Councilmember Strab, that this Action Item be Approved. It failed by the following vote: Schaible, Simasek, and Strab
6 yea · 1 absent
Croslin yea · Solomon yea · Denes yea · Haba yea · Peabody yea · Sandino yea · Waszczak absent
Wed Nov 2, 2022 · 16:00

Shade Tree Board

The Shade Tree Board will discuss proposed revisions to Chapter 112

The Hyattsville Shade Tree Board met on November 2, 2022. The agenda includes a report from Dawn Taft regarding approved permits and illegal removals, as well as discussion of proposed revisions to Chapter 112.

shade-treespermitscode-revisions
✓ Decided: Shade Tree Board approves October meeting minutes

The board approved the October 2022 meeting minutes and reviewed tree permit statistics. Members discussed potential revisions to Chapter 112-4.2b regarding tree replacement requirements, which will be finalized at the next meeting.

Tue Nov 1, 2022 · 19:00

City Council

Public hearing for parking permit petition on 38th Avenue

The City Council will hold a public hearing regarding a parking permit petition for the 5500 block of 38th Avenue. The meeting includes a presentation by Parking Compliance Supervisor Gary Bullis and an opportunity for public comment.

parkingpublic-hearinghyattsville
✓ Decided: City Council held public hearing on permit parking for 38th Avenue

The City Council conducted an administrative public hearing to discuss a petition for a Residential Parking Zone on 38th Avenue. City staff presented traffic study findings and heard testimony from residents. No final decision was made during this meeting.

Fri Oct 28, 2022 · 16:00

Age Friendly Work Group

Age-Friendly Hyattsville Work Group to discuss FY23 program planning and updates.

The group will review updates regarding COVID-19, CERT, and falls prevention workshops. Members will also work to finalize the FY23 Age-Friendly Programs Plan and discuss community-based support models for seniors.

age-friendlycommunity-servicessenior-supportprogram-planningpublic-health
Thu Oct 27, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Committee approves several Thrive Grant applications and updates mental health training

The committee reviewed multiple Thrive Grant applications for local community programs. Several applications, including Love Yoga and Nicholas Orem Middle School, were unanimously approved for funding. The committee also discussed upcoming Mental Health First Aid classes scheduled for December 10, 2022.

grantsmental-healthcommunity-programshyattsville
✓ Decided: Committee approves four Thrive Grant applications

The Health, Wellness, and Recreation Advisory Committee approved funding for four Thrive Grant applications. Several other grant applications were deferred pending follow-up questions. The committee also scheduled a Mental Health First Aid event for December 10, 2022.

Tue Oct 25, 2022 · 16:00

Race and Equity Task Force

Age Friendly Work Group presentation and committee updates

The Race and Equity Task Force will review committee updates and approve August meeting minutes. The agenda includes a presentation on the Age Friendly Work Group and discussion regarding Native American Heritage Month participation.

raceequitycommunity-servicescommittee-updateshyattsville
✓ Decided: Race and Equity Task Force approves sponsorship of Native American Heritage Month panel

The committee approved the August 2022 meeting minutes and voted to sponsor a panel discussion for Native American and Indigenous Heritage Month on November 18th. The session included a presentation on the City's Age-Friendly Action Plan and the redistribution of task force assignments following a member's resignation.

Mon Oct 24, 2022 · 16:00

Education Advisory Committee

The committee will discuss school bus delays and 2024 education grant updates

The committee will discuss concerns regarding school bus delays, including driver recruitment and guard shortages. They will also review proposed changes to the 2024 Education Enrichment Grant application and updates on funding for special needs students.

educationschool busgrantsarpahyattsville
Mon Oct 24, 2022 · 19:30

Redistricting Commission

Reviewing comments to finalize redistricting maps and recommendations

The Redistricting Committee will review comments from public hearings, council discussions, and the Hello Hyattsville page. The committee aims to make final map adjustments and prepare a written recommendation for the City Council.

redistrictinghyattsvillecity-councilpublic-hearingmaps
✓ Decided: Redistricting Commission approves Growth Conscious version 3 map

The commission voted to develop a revised Growth Conscious version 3 map that incorporates the North Point/Hamilton Manor apartment fix, places Hamilton Street and Suffrage Point together in Ward 1, and aims to keep communities together while supporting future growth. The final map, along with a Minimal Adjustment map and a memo, will be submitted to the City Council by Oct. 31 for consideration on Nov. 7. The commission also approved minutes from the Oct. 5 meeting on a voice vote.

Thu Oct 20, 2022 · 16:00

Educational Facilities Task Force

Updates on Hyattsville Elementary and Middle School facilities

The Educational Facilities Task Force will discuss the status of Hyattsville Elementary and Middle Schools. The meeting also addresses an Open Meetings Act violation regarding minutes and includes the appointment of a record keeper.

schoolseducationhyattsvillefacilitiesgovernment
✓ Decided: Task Force learns HMS on track, Phase 2 procurement begins

The Educational Facilities Task Force received an update that Hyattsville Middle School construction is on schedule for July 2023 opening, and learned that procurement for Phase 2 of the ACF program (including Hyattsville Elementary) will begin tomorrow. The task force also acknowledged a prior Open Meetings Act violation for delayed minutes and elected a new secretary.

Wed Oct 19, 2022 · 16:00

Code Compliance Advisory Board

Updates on code issues and status of proposed chapter revisions

The committee will receive an update regarding code issues from Joe Brewer. Members will also review the status of proposed revisions to Chapters 52 and 113 and discuss updates to the Committee Worksheet.

code-compliancehyattsvillelocal-governmentzoning
Tue Oct 18, 2022 · 16:00

Planning Committee

Presentation of the 5402 Jamestown Road development project

The Planning Committee will review a presentation regarding the project at 5402 Jamestown Road. The agenda also includes updates on the Hyattsville Crossing station name change and the West Hyattsville Queens Chapel Sector Plan.

developmenttransitzoningpublic-engagement
✓ Decided: Planning Committee supports 174-unit mixed-use project at 5402 Jamestown Road

The Planning Committee voted 4-0 to support a conceptual site plan for a mixed-use development at 5402 Jamestown Road, including a request to amend the land use plan and sector plan to allow multifamily residential and commercial uses, up to 7 stories, and modified exterior materials. The project proposes 174-200 units, ground-floor retail, and 51 parking spaces. Committee members expressed concerns about podium construction, parking, and public space safety but supported the project overall, with further details to be addressed at the detailed site plan stage.

⚠️ FEMA flood zone AE at this address
Tue Oct 18, 2022 · 16:00

Ethics Commission

Hyattsville Ethics Commission reviews campaign finance and election results

The commission will review annual campaign finance reports and conduct an after action review of the election. The meeting also includes discussion regarding annual ethics reporting to the State of Maryland.

ethicscampaign-financeelectionsreporting
✓ Decided: Ethics Commission affirms city compliance with state ethics law

The Hyattsville Ethics Commission approved September meeting minutes, discussed improvements to campaign finance reporting forms, and affirmed the city's compliance with the Maryland ethics law. Chair Horlick will sign the annual certification form.

Mon Oct 17, 2022 · 19:00

City Council

Hyattsville City Council holds public hearing on proposed ward redistricting

The City Council is conducting a virtual public hearing to gather resident comments on proposed changes to city ward boundaries. The Redistricting Commission will present recommended maps for review. The Mayor and Council intend to vote on these boundary changes in November.

redistrictingpublic hearingcity councilward boundaries
✓ Decided: Public hearing held on proposed ward redistricting maps

The City Council held a public hearing to receive community input on two proposed ward boundary maps from the Redistricting Commission. No decisions were made; the Council will weigh the recommendations and public comment before voting on changes in November.

Mon Oct 17, 2022 · 19:00

City Council

Hyattsville Council to consider 2023 health insurance rates and redistricting maps

The Hyattsville City Council will consider 2023 health insurance premium increases and discuss recommended ward maps for redistricting. The meeting also includes a presentation on the Ward 2 special election results. Additionally, the Council will review several contracts, including behavioral health support and project inspections.

health-insuranceredistrictingpublic-safetybudgetpublic-works
✓ Decided: Council approved health insurance rate increases for 2023

The City Council approved 2023 health insurance premium rate increases averaging 5%, with the city absorbing more than half the increase and employees paying the remainder. The council also authorized a contract with iMind Behavioral Health for 24/7 crisis support, approved a consultant contract with Prince George's County Board of Education for police at Northwestern High School, and accepted certified results of the Special Ward 2 Election. In closed session, the council voted unanimously to appeal a district council decision regarding the Queens Chapel Town Center development.

Wed Oct 12, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Police and Public Safety Committee discusses school safety and community updates

The committee will receive updates from Police Chief Jarod Towers and discuss school safety. The agenda also includes a report on a November 4th blood drive at First United Methodist Church and the rescheduling of a community listening session.

policepublic-safetycommunity-outreachschool-safety
Tue Oct 11, 2022 · 16:00

Hyattsville Environment Committee

Election of new Chairperson and discussion of Hyattsville Sustainability plan

The committee will elect a new Chairperson and introduce Joseph DeMarco. The agenda also includes discussions regarding Sustainable Maryland Certification and the timeline for the Hyattsville Sustainability plan.

chairpersonsustainabilityhyattsvilleenvironment
✓ Decided: Environment Committee elects new chair, advances sustainability plan and tree planting

The Hyattsville Environment Committee unanimously elected Thaddeus Waterman as the new chair for a 14-month term, with a possible trial period. The committee approved the September meeting minutes and discussed the city's Silver Sustainable Maryland certification, the ongoing Hyattsville Sustainability Plan (targeting adoption by spring/summer 2023), and several projects including storm drain stenciling, a pollinator garden, and a proposal to plant 750 trees. No votes were taken on these projects; they remain under discussion.

Wed Oct 5, 2022 · 16:00

Shade Tree Board

Review of ARPA funds request and proposed revisions to Chapter 112

The Shade Tree Board will review reports on tree permits, denials, and illegal removals. The agenda also includes a request for ARPA funds and proposed revisions to Chapter 112.

shade-treesarpa-fundshyattsvillepermitschapter-112
✓ Decided: Tree Board fines property owner $1,000 for illegal oak removal

The Shade Tree Board unanimously approved a $1,000 fine for the illegal removal of a 113-inch oak tree at an unknown address. The board also discussed the Healthy Trees Hyattsville Initiative, which has $20,000 in approved funding pending legal review, and an ARPA funds request to invest in tree inventory software and plant up to 750 trees in low-canopy areas. Proposed revisions to Chapter 112 were postponed to November.

Wed Oct 5, 2022 · 19:30

Redistricting Commission

Redistricting Committee prepares for October 17 Public Hearing

The Redistricting Committee met to review comments from the City Council and the public. Members also discussed modifications to a presentation for the upcoming October 17 Public Hearing, including potential map updates.

redistrictingpublic-hearinghyattsvilleward-3
✓ Decided: Redistricting committee reviews public comments, plans Oct 17 hearing

The Hyattsville Redistricting Committee approved minutes from September 14 and discussed public comments on proposed ward maps. Members agreed to modify their presentation for an October 17 public hearing, emphasizing process rationale, public feedback, and council direction. No new maps were produced; the committee will study whether to unify split apartment blocks in Wards 4 and 5.

Mon Oct 3, 2022 · 19:00

City Council

Hyattsville Council reviews Prince George’s County transit-oriented zoning changes

The City Council will consider sending correspondence to the Prince George’s County Council regarding proposed zoning amendments. They are also reviewing a $150,000 contract for emergency relief administration and discussing an animal welfare ordinance.

zoningbudgethousinganimal-welfareappointments
✓ Decided: Council opposes county zoning change, supports sector plan, awards $150K relief contract

The Council voted to send a letter opposing Prince George's County CB-97-2022, which would revise transit-oriented zoning, and to support the West Hyattsville-Queens Chapel Sector Plan with amendments. It also approved a $150,000 contract with Hyattsville Community Development Corporation to administer household emergency relief and outreach programs. All votes were 7-0 with three members absent.

🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Council President Solomon, seconded by Councilmember Simasek, that the Agenda be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes, Waszczak…
3 yea
Haba yea · Peabody yea · Sandino yea
A motion was made by Council President Solomon, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
24 yea
Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea
A motion was made by Council President Solomon, seconded by Councilmember Simasek, that this was Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes, Waszczak…
3 yea
Haba yea · Peabody yea · Sandino yea
A motion was made by Council President Solomon, seconded by Councilmember McClellan, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
9 yea
Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea · Haba yea · Peabody yea · Sandino yea
A motion was made by Council President Solomon, seconded by Councilmember Simasek, that this agenda item be Approved as Amended. The motion carried by the following vote: Croslin, Solomon, Schaible…
3 yea
Haba yea · Peabody yea · Sandino yea
A motion was made by Councilmember Simasek, seconded by Council Vice-President Schaible, that the meeting be adjouned. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
3 yea
Haba yea · Peabody yea · Sandino yea
Tue Sep 27, 2022 · 16:00

Race and Equity Task Force

Hyattsville Race and Equity Task Force to discuss outreach and age-friendly programs

The committee will review minutes from the August meeting and hear a presentation on the Age Friendly Work Group. The agenda also includes a discussion regarding task force outreach and updates from the Equity Officer.

equitycommunity-servicesoutreachhyattsville
Tue Sep 27, 2022 · 16:00

Ethics Commission

Review of Ward 2 special election campaign finance reports

The Hyattsville Ethics Commission will review campaign finance reports for the Ward 2 special election. This includes reviewing amended initial reports and second finance reports. The commission will also discuss contributions and electronic payment platforms.

ethicscampaign-financeelections
✓ Decided: Ethics Commission reviews campaign finance reports, defers action on delinquent filers

The Hyattsville Ethics Commission approved minutes from September 13 and reviewed outstanding annual reports, deferring action on delinquent filers until after the Ward 2 Special Election. The commission also reviewed and accepted several campaign finance reports for the special election, with letters to be sent to campaigns with noted issues. A new requirement for a third post-election report was noted, with a meeting set for November 29 to review them.

Tue Sep 27, 2022 · 16:00

Board of Supervisors of Election

Discussion of Election Day logistics

The Board of Supervisors of Elections will meet to approve minutes and discuss Election Day logistics. The agenda also includes a section for new business.

electionslogisticsgovernment
Mon Sep 26, 2022 · 16:00

Education Advisory Committee

Hyattsville EAC discusses bus delays, school security, and education grants

The Education Advisory Committee is discussing concerns regarding bus delays and school guard shortages. Members will also review the application process for new Education Enrichment Grants. Additionally, the committee will discuss lessons learned from the Back to School supplies event.

educationschoolssafetygrantstransportation
✓ Decided: Committee discusses bus delays, shelter, grants, and safety

The Hyattsville Education Advisory Committee discussed ongoing bus delays due to driver shortages, considered writing a letter to the school board, and explored outreach to other cities. The committee noted the Beltsville homeless youth shelter will not close. They discussed increasing the Education Enrichment Grant award limit to $750 and reviewed lessons from the Back to School supplies event. No formal votes were taken; all items were discussed or tabled for future action.

Fri Sep 23, 2022 · 16:00

Age Friendly Work Group

Hyattsville Work Group discusses FY23 age-friendly program planning

The Age-Friendly Hyattsville Work Group is meeting to plan outreach and activities for FY23 age-friendly programs. The agenda includes updates on the Hyattsville Aging in Place program and the Enhanced Mobility Options Grant Vehicle.

agingcommunity-servicesplanninghousingpublic-health
Thu Sep 22, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Planning for a Bike Rodeo and updates on health programs

The committee will discuss planning for a Bike Rodeo and potential forest bathing speakers. Members will also receive updates on Mental Health First Aid in Spanish and the Thrive Grant opening on September 1, 2022.

healthrecreationcommunitygrantsprogramming
✓ Decided: Committee approves August meeting minutes, extends Thrive Grant deadline

The Hyattsville Health, Wellness, and Recreation Advisory Committee approved the August meeting minutes unanimously, extended the Thrive Grant application deadline by two weeks, and discussed planning for a Bike Rodeo in May 2023. No other decisions were made; several items were tabled pending further information.

Wed Sep 21, 2022 · 16:00

Code Compliance Advisory Board

Election of officers and code issue updates

The Code Compliance Advisory Committee will elect a Chair and Secretary. The meeting also includes an update on code issues with Joe Brewer.

code-complianceelectionhyattsville
✓ Decided: Code Compliance Committee elects chair and secretary, discusses noise complaints

The Code Compliance Advisory Committee elected Jamie Bean as Chair and Arinee Flurry as Secretary, both unanimously approved by quorum members. The committee discussed typical code complaints (property maintenance, tall grass, litter) and two noise complaints about new construction by Werrlein Properties and Urban Investment Partners. No decisions were made on pending ordinance recommendations (Noise, Animal, Junk Vehicles); City Council member Jimmy McClellan agreed to check on their status.

Tue Sep 20, 2022 · 16:00

Planning Committee

Updates on the West Hyattsville Queens Chapel Sector Plan and sustainability engagement

The committee is discussing the public engagement schedule for the Community Sustainability Plan. It also provided updates on the West Hyattsville Queens Chapel Sector Plan, including a joint public hearing scheduled for October 11, 2022.

zoningsustainabilityplanningpublic-hearing
✓ Decided: Planning Committee approves minutes, discusses community sustainability plan

The Hyattsville Planning Committee approved minutes from September 2021 and July 2022. The committee discussed the Community Sustainability Plan, including public engagement sessions and focus group best practices with UMD Sociology. Updates were provided on the West Hyattsville Queens Chapel Sector Plan and Sectional Map Amendment, with a joint public hearing scheduled for October 11, 2022. The committee also discussed filling a vacancy and answered questions about ongoing projects.

Tue Sep 20, 2022 · 16:00

Board of Supervisors of Election

Discussion regarding Election Day logistics

The Board of Supervisors of Elections will discuss Election Day logistics. The agenda also includes the approval of minutes and potential new business.

electionlogisticsgovernment
✓ Decided: Board approves election day logistics, skips judge training

The Board of Supervisors of Elections approved the minutes from July 12 and September 6, 2022. They reviewed and confirmed the Election Day schedule for October 4, 2022, including polling layout, drive-up voting, and judge assignments. The board decided not to hold an election judge training before Election Day. The City Council passed the board's recommended charter amendments adding a third campaign finance report.

Mon Sep 19, 2022 · 19:00

City Council

Hyattsville Council to amend FY23 budget with over $9 million in ARPA funds

The City Council will review the West Hyattsville-Queens Chapel Sector Draft Plan and recommended ward maps from the Redistricting Commission. The agenda includes a budget amendment to appropriate over $9 million in ARPA funds for FY23. Other items include contract approvals for tutoring services and vehicle acquisitions.

budgetzoningcommunity-developmentpublic-worksfinanceredistricting
✓ Decided: Council approves $9.3M in ARPA funds, multiple grants and contracts

The Hyattsville City Council approved a consent agenda including $9.3 million in ARPA fund appropriations, an $80,000 tutoring contract, and several other routine items. They also approved two grant programs: $70,000 in Commercial Façade Improvement grants and $34,500 in Corridor Investment Program grants. An emergency ordinance adjusting campaign finance reporting deadlines was adopted. Presentations on the West Hyattsville-Queens Chapel Sector Plan, redistricting maps, and a compensation study were heard but no decisions were taken on those topics.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Council President Solomon, seconded by Councilmember McClellan, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
1 yea
Waszczak yea
Thu Sep 15, 2022 · 16:00

Educational Facilities Task Force

Updates on Hyattsville Middle and Elementary School status

The task force will discuss the current status of Hyattsville Middle School and Hyattsville Elementary School. The group will also prepare community talking points following the release of the ACF package on September 16, 2022.

schoolseducationhyattsvillecommunity-engagement
✓ Decided: Task force discusses HES rebuild, traffic concerns for HMS

The Educational Facilities Task Force discussed updates on Hyattsville Middle School (HMS) construction, including truck traffic complaints and traffic pattern concerns, and prepared for the upcoming Board of Education meeting where the Additional Capacity Funding (ACF) Phase 2 list may include Hyattsville Elementary School (HES). No formal decisions were made; the meeting focused on information sharing and strategy for public comment.

Wed Sep 14, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Discussion of police recruitment and retention efforts

The committee will discuss police recruitment and retention efforts with Chief Jarod Towers. The agenda also includes a report on a partnership for a blood drive scheduled for November 4th.

policepublic safetyrecruitmentcommunity outreachblood drive
Wed Sep 14, 2022 · 19:30

Redistricting Commission

Hyattsville Redistricting Committee to review council presentation run through

The committee will approve the minutes from the September 8 meeting and conduct a run through of a Council presentation. The agenda contains primarily procedural items.

redistrictinghyattsvillecouncil
✓ Decided: Redistricting committee rehearses presentation for City Council

The committee approved minutes from September 8 and held a run-through of the presentation to be given to the City Council on September 19. Members discussed handling questions and noted that further steps will depend on Council feedback. No new business was presented.

Tue Sep 13, 2022 · 16:00

Hyattsville Environment Committee

Discussion of Clime DAO Pilot and Hyattsville Sustainability plan status

The Hyattsville Environment Committee will review the Clime DAO Pilot and the current status of the Hyattsville Sustainability plan. The agenda also includes updates on city compost/yard waste directions and the University Hills Green Team. An announcement regarding a new Audubon program with the City is scheduled.

sustainabilityenvironmentcompostpublic-programs
✓ Decided: Committee discusses Clime DAO carbon credit pilot for residents

The Hyattsville Environment Committee heard a presentation from Clime DAO about a proposed carbon credit pilot program that would allow residents to earn tokens for climate actions. No decision was made; the committee noted the concept is risky because it is a startup with no pilot testing. The committee also discussed updates to the city's sustainability plan, potential combined yard waste and compost collection, and the Audubon yard certification program.

Tue Sep 13, 2022 · 16:00

Ethics Commission

Review of Ward 2 election finance reports and campaign finance ordinance

The Ethics Commission will review annual reports and initial finance reports from the Ward 2 special election. The agenda also includes the finalized campaign finance ordinance.

ethicscampaign-financeelectionsordinance
✓ Decided: Ethics Commission reviews campaign finance reports, notes discrepancies

The Hyattsville Ethics Commission reviewed annual campaign finance reports for several candidates, noting minor errors such as a 33¢ discrepancy for Council Member McClellan and a math error for Council Member Waszczak. Reports for Candidate Abdul Rahman and Mayor Croslin were accepted as filed. The commission also reviewed reports for the Ward 2 Special Election, identifying missing cover sheets and incomplete in-kind contribution reporting. Letters were drafted to address concerns, and the commission discussed future revisions to campaign finance forms.

Thu Sep 8, 2022 · 19:30

Redistricting Commission

The committee will review final map adjustments and prepare for a Council presentation.

The Hyattsville Redistricting Committee is meeting to discuss final adjustments to redistricting maps based on community feedback. The committee will also plan an upcoming presentation to the City Council and discuss next steps for community outreach.

redistrictinghyattsvillecommunity-outreachcity-council
✓ Decided: Redistricting Commission approves two maps for council presentation

The Hyattsville Redistricting Committee voted unanimously to present both a growth-conscious map and a minimal adjustment map to the City Council for consideration. The committee also discussed community feedback, census block splitting, and plans for a public hearing on October 17. No final map was selected; the council will review the options.

Wed Sep 7, 2022 · 16:00

Shade Tree Board

Discussion of proposed revisions to Chapter 112

The Shade Tree Board will review the August 2022 minutes and a report on permits, denials, and illegal removals. The meeting also includes discussion regarding proposed revisions to Chapter 112.

shade-treespermitsordinance
✓ Decided: Shade Tree Board fines three property owners for illegal tree removals

The Hyattsville Shade Tree Board approved fines for three illegal tree removals, totaling $2,650. The board also discussed a replacement tree options matrix and tabled further discussion until October. A request for ARPA funding for tree canopy restoration was added to the October agenda.

Tue Sep 6, 2022 · 16:00

Board of Supervisors of Election

Review of election schedules and upcoming outreach events

The Board of Supervisors of Elections will review the ballot intake schedule and the Election Day schedule. The meeting also includes updates on upcoming outreach events and the oath of office.

electionsschedulesoutreachhyattsville
✓ Decided: Board sets ballot intake and election day schedule for Oct. 4 special election

The Board of Supervisors of Elections reviewed and confirmed attendance for ballot intake dates leading up to the October 4, 2022 Special Ward 2 Election. They discussed an updated election day schedule and judge assignments, with a final review planned for the next meeting. The Board also removed the October 3 meeting from the calendar and decided to develop a project plan for future code amendments and voter education at the November 1 meeting.

Fri Aug 26, 2022 · 16:00

Age Friendly Work Group

Planning for FY23 age-friendly programs and community service updates

The Age-Friendly Hyattsville Work Group is meeting to plan outreach and activities for fiscal year 2023. The agenda includes updates on the Mobile Market, ARPA emergency funds, and mobility grants. The group will also meet with the City's Race and Equity Officer.

age-friendlycommunity servicesplanningoutreachhyattsville
✓ Decided: Age-Friendly Work Group plans FY23 programs and hears equity presentation

The Age-Friendly Work Group heard a presentation from the City's Race and Equity Officer on the GARE model and demographics. Members reviewed and tentatively scheduled age-friendly programs for FY23, including emergency preparedness, housing assistance, mental health, and technology workshops. No formal votes or binding decisions were taken; the meeting was informational and planning-focused.

Thu Aug 25, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

HWRAC to finalize Thrive Grant documents for September 1 release

The Health, Wellness, and Recreation Advisory Committee will discuss upcoming community programs and grant opportunities. The committee plans to finalize Thrive Grant documents for release on September 1. Agenda items also include planning for a Bike Rodeo and potential speaker series programs for FY23.

healthwellnessgrantscommunity-events
✓ Decided: HWRAC committee approves July minutes, discusses Bike Rodeo and grants

The Hyattsville Health, Wellness, and Recreation Advisory Committee unanimously approved amended July minutes. They discussed planning for a Bike Rodeo, a Forest Bathing speaker, Mental Health First Aid in Spanish, a Pepco grant, and the Thrive Grant. No final decisions were made on these items.

Tue Aug 23, 2022 · 16:00

Race and Equity Task Force

Affordable housing strategy presentation to the Race and Equity Task Force

The committee will review a presentation regarding the affordable housing strategy. The agenda also includes the reassignment of sections within the Community Engagement and Transportation Plan. Additionally, members will approve minutes from the June meeting.

housingtransportationcommunity-engagementrace-and-equity
✓ Decided: Task force hears affordable housing strategy presentation

The Hyattsville Race and Equity Task Force received a presentation on the city's affordable housing strategy, discussed definitions of affordability, and considered tools like inclusionary zoning and land trusts. The meeting also included administrative updates and a transportation section reassignment.

Tue Aug 23, 2022 · 19:30

Redistricting Commission

Review of Ward 4 population data and map adjustments

The Redistricting Committee will review population percentage data for Ward 4 Northwards and Southwards to determine necessary map adjustments. The committee will also discuss community feedback and updates on community outreach tools.

redistrictingward-4hyattsvillecommunity-outreach
✓ Decided: Redistricting committee discusses map options, no final decision

The committee reviewed two potential map adjustments for Ward 4 South, including a growth-conscious option and a racial-balance option, but took no vote to adopt any map. They also discussed community outreach tools and a timeline for presenting proposals to the City Council in September. No substantive decisions were made beyond approving prior meeting minutes.

Thu Aug 18, 2022 · 16:00

Educational Facilities Task Force

Updates on Hyattsville Middle School construction and elementary school status

The Educational Facilities Task Force will discuss the current status of Hyattsville Middle School and Hyattsville Elementary School. The meeting includes a community update regarding construction concerns at the middle school, such as vibrations affecting neighboring homes. Members will also review action items for the elementary school's ACF draft.

educationschoolsconstructionhyattsvillecommunity-engagement
✓ Decided: Hyattsville Middle School construction on schedule for July 2023 completion

The Educational Facilities Task Force received a status update on Hyattsville Middle School construction, which remains on schedule for July 2023 completion. The committee discussed potential land acquisition for Hyattsville Elementary School expansion and confirmed that rumors about eminent domain for St. Jerome's parking lot are false. The next PGCPS Board of Education meeting in September will consider the Phase 2 ACF plan, and the task force plans to mobilize community support.

Wed Aug 17, 2022 · 16:00

Code Compliance Advisory Board

Election of Chair and Secretary and code issue updates

The Hyattsville Code Compliance Advisory Committee will elect a Chair and Secretary. The meeting also includes an update on code issues with Joe Brewer.

code-complianceelectionshyattsville
✓ Decided: No quorum, meeting adjourned without action

The Code Compliance Advisory Committee meeting was cancelled because a quorum was not present. No decisions were made or business conducted.

Wed Aug 10, 2022 · 16:00

Ethics Commission

Reviewing candidate financial disclosures and a campaign finance ordinance draft

The Ethics Commission will meet virtually to review candidate financial disclosures. The meeting also includes a discussion of the Campaign Finance Ordinance draft.

ethicscampaign-financehyattsville
✓ Decided: Ethics Commission reviews Ward 2 candidate disclosures, recommends campaign finance report timing

The Hyattsville Ethics Commission approved minutes from six prior meetings and reviewed financial disclosures for Ward 2 special election candidates, requesting revisions from two candidates and accepting one. The commission also recommended that a reinstated third campaign finance report be due 45 days after Election Day. No other substantive decisions were made.

Wed Aug 10, 2022 · 19:30

Redistricting Commission

Review of ward maps and demographic data for redistricting

The committee will review demographic data and a GIS web display app related to the Equal Population Map. Members will discuss equity goals and potential map adjustments. The agenda also includes planning for community outreach and upcoming public hearings.

redistrictingmapsequityhyattsvilledemographics
✓ Decided: Redistricting committee reviews demographic data, plans three map options

The committee reviewed racial and ethnic demographic data for wards under an equal-population map and discussed equity considerations, including keeping neighborhoods like the Arts District and Suffrage Point intact. No maps were finalized; instead, staff will develop three map options (equal population, Ward 4 extending south, Ward 4 extending north) for review at the next meeting. The committee also planned community outreach at upcoming events and set a timeline for presenting proposals to the City Council on Sept. 19.

Tue Aug 9, 2022 · 16:00

Hyattsville Environment Committee

Committee to discuss mission statement updates and a Verizon unused space initiative

The Hyattsville Environment Committee will review updates to its mission statement and worksheet. The meeting also includes discussions on a Verizon unused space initiative and ivy removal coordination.

environmentmissionclimateinfrastructure
✓ Decided: Committee approves May minutes, discusses Verizon lot and climate work

The Hyattsville Environment Committee approved its May meeting minutes and made progress on its mission statement. Members discussed the city's previous talks with Verizon about using unused space for parking, noting no agreement was reached and Verizon is deciding whether to sell its building. The committee also reviewed updates on ivy removal efforts and plans for a climate action summit write-up.

Wed Aug 3, 2022 · 16:00

Shade Tree Board

Shade Tree Board to discuss proposed revisions to Chapter 112

The Shade Tree Board will review the July 2022 minutes and hear a report on approved permits, denials, and illegal removals from Dawn Taft. The meeting also includes discussion of proposed revisions to Chapter 112.

shade-treespermitshyattsvilleordinance
✓ Decided: Shade Tree Board approves permit, discusses replacement guidelines

The Hyattsville Shade Tree Board approved the July 2022 minutes and a permit for tree removal after an appraisal by Bartlett Tree Experts. The board discussed developing simplified tree replacement guidelines with two categories (Large/Overstory and Small/Understory), and noted concerns about affordability for residents on fixed incomes. No formal decisions were made on the guidelines.

Tue Aug 2, 2022 · 16:00

Board of Supervisors of Election

Review of ballot envelopes and campaign finance ordinance

The Board of Supervisors of Elections will review ballot envelopes and discuss a campaign finance ordinance. The agenda also includes election updates.

electioncampaign-financeordinance
✓ Decided: Election board defers campaign finance changes to Ethics Commission

The Hyattsville Board of Supervisors of Elections reviewed proposed changes to campaign finance reporting timelines and formally deferred the matter to the Ethics Commission. The board also reviewed updated ballot envelopes and discussed preparations for the October 4th Ward 2 Special Election, including candidate certification and voter outreach.

Mon Aug 1, 2022 · 19:00

City Council

Hyattsville Council to discuss election code changes and infrastructure projects

The City Council will consider proposed revisions to the Election Code regarding campaign finance reporting. The agenda also includes several proposals for city infrastructure, such as bus shelter installations and sewage connections for Portland Loos.

electioninfrastructurepublic-workszoningbudget
✓ Decided: Council approves consent agenda with $100K cleaning contract and more

The Hyattsville City Council approved the consent agenda, which included a $100,000 building cleaning contract with Sentral Services, a $75,000 truck purchase, and several other expenditures. The council also adopted a proclamation honoring Chichie's Pet Boutique's 50th anniversary. A presentation on the 3325 Toledo Road subdivision was given, but no action was taken. The meeting was procedural with no substantive policy decisions beyond the consent items.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Council President Solomon, seconded by Councilmember Sandino, that this agenda item be Approved. The motion carried by the following vote: Croslin, Denes, Waszczak, Simasek…
2 yea
Schaible yea · Schaible yea
Thu Jul 28, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

HWRAC discusses Spanish language outreach and grant opportunities

The committee will review June meeting minutes and discuss outreach to Spanish-speaking residents. The agenda includes discussions regarding Mental Health First Aid in Spanish and the Pepco Sustainable Communities grant opportunity. Members will also address the Thrive Grant amended schedule and potential speaker series programs for FY23.

outreachmental-healthgrantscommunity-programs
✓ Decided: Committee approves June minutes, plans Spanish outreach and grant steps

The Health, Wellness, and Recreation Advisory Committee approved the June meeting minutes unanimously. Members discussed outreach to Spanish-speaking residents, reviewed a Pepco grant opportunity, and planned survey promotion at a September event. No major policy decisions were made; actions were mostly procedural or planning-oriented.

Wed Jul 27, 2022 · 19:30

Redistricting Commission

The committee will review map updates and conduct a mapping exercise.

The Redistricting Committee will review Round 1 map updates and perform a mapping exercise to adjust for physical boundaries, communities of interest, and equity. The meeting also includes discussions on community outreach tools and compactness metrics.

redistrictingmappinghyattsvillecommunity-outreachequity
✓ Decided: Redistricting committee elects new chair, reviews draft maps

The Hyattsville Redistricting Committee approved minutes from July 13, discussed equity frameworks and outreach tools, and reviewed draft maps for equal population and population density. Chair Mosher resigned for personal reasons, and Andrew Sayer was elected as the new chair unanimously. No final maps were adopted.

Tue Jul 26, 2022 · 16:00

Race and Equity Task Force

Presentation of the Affordable Housing Strategy

The committee will review a presentation regarding the Affordable Housing Strategy. Members will also discuss reassigning sections of the Community Engagement and Transportation Plan. The agenda includes approval of June meeting minutes and administrative updates.

housingtransportationcommunity-engagementhyattsville
Fri Jul 22, 2022 · 16:00

Age Friendly Work Group

Planning for FY23 Age-Friendly programs and mobility vehicle procurement updates

The work group will discuss priorities, leads, and timelines for FY23 Age-Friendly programs. Updates will be shared regarding COVID-19 and intergenerational programs. The meeting also includes a status update on the procurement of enhanced mobility options vehicles.

age-friendlyplanningmobilitycommunity-servicescovid-19
✓ Decided: Age-Friendly Work Group prioritizes topics for FY23 programs

The Hyattsville Age-Friendly Work Group reviewed survey results and identified priority topics for FY23, including affordable housing, caregiver resources, emergency preparedness, financial fraud prevention, health and fitness, food and nutrition, LGBTQ outreach, and long-term care planning. No formal votes were taken; the group will finalize the list and develop an activity work plan for the August meeting. Updates were also shared on COVID BA.5 precautions, the cancellation of a bus order due to supply issues, and an upcoming Age-Friendly Ecosystem Summit.

Tue Jul 19, 2022 · 16:00

Planning Committee

Hyattsville Planning Committee reviews 3325 Toledo Road and development updates

The committee will review a project presentation for 3325 Toledo Road and discuss the public engagement schedule for the Community Sustainability Plan. Updates include the July 28 groundbreaking for The Residences at the Six and construction plans for the new police facility at 3505 Hamilton Street. The meeting also includes approval of January, February, and June 2022 minutes.

zoningdevelopmentsustainabilitypolicehousingpublic engagement
✓ Decided: Planning Committee supports 7-story apartment project at 3325 Toledo Road

The Planning Committee voted 5-1 in favor of a 7-story apartment building at 3325 Toledo Road, which will replace half of an existing parking garage with 728 spaces removed. The project will include 40% studios, 50% one-bedrooms, and 10% two-bedrooms, with no three-bedroom units. The committee also approved minutes from January, February, and June 2022 meetings and discussed the Community Sustainability Plan engagement schedule.

🏢 Building at this address: 2 floors
Mon Jul 18, 2022 · 19:00

City Council

✓ Decided: Council approves $11M bond notes for Hamilton Street Public Safety Building

The Hyattsville City Council approved a resolution authorizing up to $11 million in bond anticipation notes for the 3505 Hamilton Street Public Safety Building project, and adopted an ordinance allowing up to $11.25 million in general obligation bonds for the same project. The council also approved a three-year advertising contract with Hyattsville Life & Times, elected Joseph Solomon as Council President, and approved numerous consent agenda items including contracts for landscaping, tree care, and refuse trucks.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Council Member Solomon, seconded by Council Member Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Waszczak, Simasek, McClellan…
8 yea
Schaible yea · Denes yea · Schaible yea · Denes yea · Schaible yea · Denes yea · Schaible yea · Denes yea
A motion was made by Council Member Solomon, seconded by Council Member Waszczak, that this agenda item be Approved. The motion carried by the following vote: Croslin, Waszczak, Simasek, McClellan…
4 yea
Schaible yea · Denes yea · Schaible yea · Denes yea
A motion was made by Council Member Solomon, seconded by Council Member Haba, to approve the Consent Agenda. The motion carried by the following vote: Croslin, Waszczak, Simasek, McClellan, Haba…
2 yea
Schaible yea · Denes yea
A motion was made by Council Member Solomon, seconded by Council Member Haba, that this agenda item be Approved. The motion carried by the following vote: Croslin, Waszczak, Simasek, McClellan, Haba…
4 yea
Schaible yea · Denes yea · Schaible yea · Denes yea
A motion was made by Council Member Solomon, seconded by Council Member Sandino, that this agenda item be Approved. The motion carried by the following vote: Croslin, Waszczak, Simasek, McClellan…
2 yea
Schaible yea · Denes yea
Wed Jul 13, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Discussion of school shooting and police procedures

The committee will discuss school shooting and police procedures and review subcommittee reports regarding community engagement sessions. Chief Jarod Towers will provide updates on hiring, budget, and community issues. The August and December meetings are cancelled.

policepublic-safetycommunity-engagementbudgethiring
Wed Jul 13, 2022 · 19:30

Redistricting Commission

Review of census data and ward boundaries for Hyattsville redistricting

The committee will review 2010 and 2020 Census data and current ward boundaries. Discussion will focus on maintaining physical boundaries and communities of interest. A mapping exercise will consider boundary shifts to accommodate city growth.

redistrictingcensushyattsvilleward-boundaries
✓ Decided: Redistricting committee reviews census data and development plans

The Hyattsville Redistricting Committee reviewed 2010 and 2020 census data and discussed future development impacts on ward populations. They approved the June 27 minutes and planned mapping exercises for the next meeting, but made no final decisions on ward boundaries.

Tue Jul 12, 2022 · 16:00

Hyattsville Environment Committee

The committee will discuss the Verizon unused space initiative and ivy removal.

The Hyattsville Environment Committee will review May meeting minutes and discuss the Verizon unused space initiative. The agenda also includes updates on the Prince George’s County Climate Action Summit and coordination of ivy removal with HAP and CCAN.

environmentclimate-actionivy-removalhyattsville
Tue Jul 12, 2022 · 16:00

Board of Supervisors of Election

Planning for upcoming special elections and reviewing campaign finance reporting

The Board is reviewing preparations for an upcoming special election, including vendor updates and candidate registration timelines. Members will also discuss potential ballot box locations and review Ethics Commission recommendations regarding campaign finance reporting changes.

electionscampaign-financevoter-outreachspecial-election
✓ Decided: Board approves ballot box locations for Special Ward 2 Election

The Board approved placing ballot boxes at the City Building and Driskell Park for the Special Ward 2 Election, and confirmed dates for candidate training and ballot intake. Vendor contracts for Ballot Scout, Fort Orange Press, ES&S, and PG County BOE were discussed but not voted on. The Board also suggested adding a third campaign finance report, but no formal action was taken.

Wed Jul 6, 2022 · 16:00

Shade Tree Board

Proposed revisions to Chapter 112 of the city code

The Shade Tree Board will discuss proposed revisions to Chapter 112, beginning with section 112-4 E. The meeting includes a report on approved permits, denials, and illegal removals by Dawn Taft. The board will also consider approving the minutes from June 2022.

shade-treescity-codepermitshyattsville
✓ Decided: Shade Tree Board approves changes to urban forest code

The Hyattsville Shade Tree Board approved revisions to Chapter 112 of the Urban Forest code, including lowering the tree circumference threshold from 75 to 35 inches and approving changes to section 112-4.2B. The board also discussed replacement tree policies and appointed a subcommittee to develop a replacement scale. No illegal tree removals were reported.

Thu Jun 30, 2022 · 16:00

Board of Supervisors of Election

The Board of Supervisors of Elections will discuss a special election.

The Hyattsville Board of Supervisors of Elections is meeting to hold a discussion regarding a special election. The agenda also includes potential new business and adjournment.

electionshyattsvillespecial election
✓ Decided: Special vote-by-mail election set for Oct. 4 to fill Ward 2 seat

The Board of Supervisors of Elections approved a vote-by-mail special election on October 4, 2022, to fill the Ward 2 Councilmember seat vacated by Mayor Croslin. The board also scheduled a virtual candidate information session for July 27, 2022, and discussed voter outreach events. No other substantive decisions were made.

Tue Jun 28, 2022 · 16:00

Race and Equity Task Force

Election of a new chair and co-chairs following Chair Clarke's resignation

The committee will elect a new chair and co-chairs due to the resignation of Chair Clarke. The agenda includes an overview of Visitable Service and a presentation on a transportation plan. Administration updates regarding Driskell Park and the new mayor/council are also scheduled.

chair-electiontransportationdriskell-parkadministrationequity
✓ Decided: Task force elects new co-chairs after chair resigns

The Race and Equity Task Force accepted Chair Malcolm Clarke's resignation and elected Alicia Freemyn and Jennifer Gafford as co-chairs, with Jocelyn Medallo as secretary. The group also approved minutes from March, April, and May meetings. No other formal decisions were made; the meeting included updates on the Driskell Park redesign and a presentation on the VisitAble training program.

Tue Jun 28, 2022 · 16:00

Planning Committee

Hyattsville Planning Committee reviews redistricting and sustainability plans

The committee will receive a presentation on the Redistricting Committee and discuss the 2022–2026 Community Sustainability Plan process. The meeting also includes development updates for Canvas (Armory) Apartments, Rhode Island Trolley Trail, and Suffrage Point.

redistrictingsustainabilitydevelopmenthousingtransportation
✓ Decided: Planning Committee formalizes Cliff's appointment to Redistricting Committee

The Hyattsville Planning Committee formalized Cliff's appointment to the Redistricting Committee, which is tasked with redrawing ward boundaries based on the 2020 census. The committee also approved the October 2021 minutes (4-0). Updates were provided on the Community Sustainability Plan, development projects, and the redistricting timeline.

Tue Jun 28, 2022 · 16:00

Ethics Commission

Review of special election updates and campaign finance code revisions

The Ethics Commission will receive an update regarding the Special Election. The commission is also reviewing a recommended code revision concerning the timing of final campaign finance reports for special elections.

ethicselectionscampaign-financecode-revision
✓ Decided: Ethics Commission backs 30-day final report rule for special elections

The Hyattsville Ethics Commission discussed the upcoming Ward 2 Special Election and recommended that a final report be required within 30 days of special elections, to be considered by the City Council on July 18. The commission also noted two vacancies and discussed recruiting new members. No formal votes were taken; the meeting was procedural and informational.

Mon Jun 27, 2022 · 16:00

Education Advisory Committee

Discussion of impacts on homeless students from school closures and renovations

The committee will discuss how the HMS closure and Hyattsville ES renovation may affect homeless youth. The meeting also includes reviews of summer enrichment programs and plans for back-to-school events.

educationyouthhomelessnessschoolscommunity-programs
✓ Decided: Committee hears updates on homeless youth, summer programs, and school outreach

The Hyattsville Education Advisory Committee met virtually and unanimously approved the June 2022 agenda and May 2022 minutes. Members discussed homeless youth support, the Hyattsville ES renovation and boundary changes, summer enrichment programs, and outreach to school principals. No formal decisions were made beyond the agenda and minutes approval.

Mon Jun 27, 2022 · 19:30

Redistricting Commission

Hyattsville Redistricting Committee meets to review process and elect officers

The committee will review redistricting requirements, history, and the 2022 timeline. Members will also discuss goal setting and elect a chair and recordkeeper.

redistrictinghyattsvillecommitteeprocessgis
✓ Decided: Hyattsville redistricting committee elects chair, sets July 13 meeting

The Hyattsville 2022 Redistricting Committee held its first meeting, reviewed legal requirements and the redistricting process, and elected Greta Mosher as Chair and T. Carter Ross as Recordkeeper. The committee set its next meeting for July 13, 2022, and will review 2010 Census data and GIS tools to prepare ward boundary recommendations for Council by September 19.

Thu Jun 23, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

The committee will discuss selecting a new Committee Chair.

The Health, Wellness, and Recreation Advisory Committee will meet to discuss selecting a new Committee Chair. The agenda also includes reviewing May meeting minutes and the Thrive Grant amended schedule. Additionally, members will consider potential speaker series programs for FY23.

leadershipgrantsprogramminghealthwellness
✓ Decided: Committee tables chair selection, plans Spanish mental health classes

The committee tabled the selection of a new chair, with no nominations made, and will revisit it next meeting. They approved the April meeting minutes and discussed plans for Spanish-language Mental Health First Aid classes scheduled for June 25, with outreach through schools and churches. The committee also discussed conducting a community survey in English and Spanish to guide future programming, but no formal decision was made on the survey content.

Wed Jun 22, 2022 · 16:00

Educational Facilities Task Force

Status updates for Hyattsville Middle and Elementary school facilities

The task force will discuss the current status of Hyattsville Middle School and Hyattsville Elementary School. Agenda items include building timelines, swing space, and technical advisors for each build. The group also plans to develop community engagement strategies and contact the Board of Education regarding the ACF package.

educational-facilitiesschoolshyattsvillepgcps
✓ Decided: Task force prioritizes Hyattsville Elementary rebuild, explores land expansion

The Educational Facilities Task Force discussed the rebuild of Hyattsville Elementary School (HES), reaffirming it as a top priority for the county's phase II ACF program. They agreed to explore acquiring adjacent land to expand the constricted site and to keep pressure on county and state officials for inclusion. No formal votes were taken on these items; the only votes were to approve past minutes and adjourn, both unanimous.

Tue Jun 21, 2022 · 19:00

City Council

Hyattsville Council to vote on gas-powered leaf blower ban and rebate program

The City Council will vote to adopt an ordinance banning gas-powered leaf blowers and establishing a rebate program. They will also hold the first reading for authorizing up to $11,250,000 in bonds for a public safety building. Additionally, the Council will consider budget amendments for renovations at 5812 40th Avenue.

public-safetybudgetordinanceinfrastructure
✓ Decided: Council adopts gas leaf blower ban, approves $11.25M bond authorization

The Hyattsville City Council adopted Ordinance 2022-02, banning gas-powered leaf blowers effective August 1, 2022, with amendments making renters eligible for the rebate program. The Council also introduced Ordinance 2022-03, authorizing up to $11.25 million in general obligation bonds and $11 million in bond anticipation notes for the 3505 Hamilton Street Public Safety Building. Additionally, the Council approved the purchase of IAPro software for up to $47,900, after untabling the motion, and approved several discretionary fund disbursements.

Thu Jun 16, 2022 · 16:00

Educational Facilities Task Force

Status updates for Hyattsville Middle and Elementary Schools

The Educational Facilities Task Force will discuss the current status of Hyattsville Middle School and Hyattsville Elementary School. The agenda includes updates on building timelines, swing space, and financing MOUs for the elementary school. Members will also discuss community engagement and contacting the Board of Education.

educationschoolshyattsvilleinfrastructure
Wed Jun 8, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Police budget updates and community inquiries regarding surveillance technology

The committee will receive updates from Chief Jarod Towers on police hiring, budget, and community issues. Members will also address community inquiries regarding surveillance apparatus and Department of Homeland Security phones. Additionally, the group will discuss subcommittee reports and a previous presentation on community accountability.

policepublic-safetybudgethiringsurveillancehyattsville
✓ Decided: Committee discusses police staffing, use-of-force policy updates

The committee approved the agenda and May minutes unanimously. Discussions covered rescheduling Police Appreciation Day, updating outdated records retention and use-of-force policies, and increasing police staffing via ARPA funds. No formal votes were taken on these topics.

Mon Jun 6, 2022 · 19:00

City Council

Hyattsville City Council to adopt Fiscal Year 2023 annual budget

The City Council will meet to adopt the Fiscal Year 2023 annual budget and tax rates. The agenda also includes traffic calming evaluations for several residential streets and the introduction of a municipal gas-powered leaf blower ban. Additionally, the Council will consider various contracts for IT hardware and park renovations.

budgettrafficparksenvironmentgovernment
✓ Decided: Council adopts FY2023 budget, Juneteenth holiday, and $2M relief programs

The Hyattsville City Council adopted the FY2023 budget, recognized Juneteenth as a paid city holiday, and approved $2 million in emergency relief programs for small businesses and nonprofits. It also approved traffic calming measures on three streets, a King Park renovation design, and introduced a gas-powered leaf blower ban. The purchase of IAPro police software was tabled pending more information.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Councilmember Haba, seconded by Councilmember Solomon that this agenda item be Tabled. The motion carried by the following vote: Croslin, Solomon, Schaible, Waszczak, Denes…
1 yea
Si masek yea
Wed Jun 1, 2022 · 16:00

Shade Tree Board

Proposed revisions to Chapter 112

The Shade Tree Board will discuss proposed revisions to Chapter 112. Dawn Taft will also present a report regarding approved permits, denials, and illegal removals.

shade-treeshyattsvillepermitsordinances
✓ Decided: Shade Tree Board approves Chapter 112 urban forest revisions

The Shade Tree Board approved changes to Chapter 112 of the Urban Forest code, including sections 112-4.A, 112-4.D, and 112-4.E, with the latter adding language about protecting critical root zones. The board also discussed tree replacement options, including allowing homeowners to donate trees for planting elsewhere if they can't plant a large shade tree, and reviewed permit activity, including one denial and three approvals.

Tue May 31, 2022 · 16:00

Ethics Commission

Review of Campaign Finance Report #2 and general election updates

The Hyattsville Ethics Commission will meet virtually to discuss a General Election update and review Campaign Finance Report #2. The agenda also includes standard procedural items such as scheduling the next meeting.

ethicselectionscampaign-finance
✓ Decided: Ethics Commission accepts two campaign reports, flags Schaible's

The Hyattsville Ethics Commission reviewed mayoral candidates' financial reports. It accepted Croslin's amended first report and the second reports of Croslin and Bhat, but sent a letter to candidate Schaible about incomplete in-kind contribution reporting. The commission also clarified that businesses cannot contribute to campaigns, so using a business space for an event is allowed only if costs are not discounted or waived.

Fri May 27, 2022 · 16:00

Age Friendly Work Group

Presentation of public health research and age-friendly program updates

The work group will review University of Maryland School of Public Health capstone projects regarding senior community needs and in-home care support. The meeting also includes updates on Hyattsville Aging in Place and intergenerational programs planning.

agingpublic-healthcommunity-serviceshyattsvilleresearch
✓ Decided: Age-Friendly Work Group hears UMD research on senior needs, in-home care

The Age-Friendly Work Group received presentations from University of Maryland graduate students on two research projects: a survey of senior residents' needs during COVID-19 and beyond, and a review of models for community-based in-home support services. The group also heard updates on Hyattsville Aging in Place (HAP) leadership, resumption of Seniors on the Go trips, and planned intergenerational activities. No formal decisions were made; the meeting was informational and procedural.

Thu May 26, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Selection of a new Committee Chair and review of upcoming health programs

The committee will discuss selecting a new Committee Chair and approving minutes from the April meeting. The agenda also includes reviewing June Spanish Language Mental Health First Aid Classes and the Thrive Grant amended schedule.

healthwellnessrecreationhyattsvillemental-healthgrants
✓ Decided: Committee tables chair selection, plans Spanish mental health classes

The committee tabled the selection of a new chair until the next meeting, with no nominations made. They approved the April meeting minutes and discussed plans for Spanish-language Mental Health First Aid classes scheduled for June 25, with outreach through schools and churches. The committee also discussed creating a community survey to guide future programming, but no formal decisions were made on the survey content.

Wed May 25, 2022 · 16:00

Code Compliance Advisory Board

Update on code issues with Joe Brewer

The Code Compliance Advisory Committee will meet via Zoom to approve the February minutes. The committee will also receive an update regarding code issues from Joe Brewer.

code-compliancehyattsvillemeeting-agenda
Tue May 24, 2022 · 16:00

Race and Equity Task Force

Hyattsville Race and Equity Task Force to receive Redistricting Task Force update

The committee will review minutes from previous meetings and hear an update on the Redistricting Task Force. The agenda includes introductions for a new member and the Equity Officer. A presentation regarding aging and people with disabilities is also scheduled.

redistrictingequitydisabilitycommunity
✓ Decided: Task Force appoints member to Redistricting Committee

The Race and Equity Task Force appointed Alicia Freemyn to the Redistricting Committee and tabled approval of March and April minutes until June 28, 2022. They also heard updates on the Driskell Park renaming and a presentation on aging and disabilities, but no other formal decisions were made.

Tue May 24, 2022 · 16:00

Board of Supervisors of Election

Updates on election procedures and Election Day planning

The Board of Supervisors of Elections will discuss general election updates and voter turnout. The agenda also includes updates to the ballot intake schedule and Election Day planning.

electionsvotinghyattsville
✓ Decided: Election board reviews plans, no changes to ballot intake

The Board of Supervisors of Elections met in person and reviewed election updates, including vendor updates and ballots received. They reviewed the ballot intake schedule without making adjustments and finalized Election Day plans, including judge assignments and room setup. No substantive decisions were made; the meeting was procedural.

Mon May 23, 2022 · 16:00

Education Advisory Committee

Discussion of Hyattsville Elementary renovation and proposed school boundary changes

The Education Advisory Committee will review updates from the Redistricting Task Force and discuss city youth programs. The agenda includes an overview of education enrichment grants and outreach to school principals. Members will also address responses regarding a homeless shelter closure.

educationzoningyouth-programsschool-boundariescommunity-outreach
✓ Decided: Committee discusses redistricting, youth programs, school boundary changes

The Education Advisory Committee discussed several topics, including a redistricting task force presentation, city youth programs, and a proposed school boundary change for Hyattsville Elementary. No formal decisions were made; the committee postponed the grants program overview and agreed to keep the homeless shelter closure topic on the agenda for next month.

Tue May 17, 2022 · 16:00

Hyattsville Environment Committee

The committee will discuss the Verizon unused space initiative and pollinator corridor.

The Hyattsville Environment Committee will review April meeting minutes. The agenda includes updates on a pollinator corridor and the Verizon unused space initiative. Members will also discuss ivy removal with CCAN.

environmentpollinatorsvegetationcommunity-outreach
✓ Decided: Committee discusses converting Verizon lot to city park

The Hyattsville Environment Committee discussed a resident's proposal to convert an unused Verizon lot at 5504 44th Ave into a city-owned park or improve it environmentally. The committee approved the April meeting minutes unanimously. No formal decisions were made on the Verizon lot, pollinator corridor, or ivy removal; the ivy removal discussion was tabled because CCAN could not attend.

Tue May 17, 2022 · 16:00

Ethics Commission

Review of Campaign Finance Report #1 and general election update

The Hyattsville Ethics Commission is meeting to receive a general election update. The commission will also review Campaign Finance Report #1.

ethicselectionscampaign-finance
✓ Decided: Ethics Commission approves Bhatt's campaign report, flags Croslin and Shaible

The Hyattsville Ethics Commission reviewed campaign finance reports from all three mayoral candidates, approving Candidate Bhatt's report. It noted possible discrepancies in the reports of Candidates Croslin and Shaible and approved letters seeking additional information or amendments. The letters were approved by voice vote for delivery by the City Clerk's office. The next meeting is scheduled for May 31, 2022.

Mon May 16, 2022 · 19:00

City Council

Public hearing for traffic calming petitions on three Hyattsville streets

The City Council is holding a virtual public hearing to review resident petitions for the implementation of traffic calming devices. The session includes discussions regarding 41st Place, Lancer Drive, and Longfellow Street. A decision will be announced within fifteen days following the close of the hearing.

trafficpublic-hearingroadshyattsvilleinfrastructure
✓ Decided: Council hears traffic calming petitions for three streets

The City Council held a public hearing to gather resident input on traffic calming petitions for the 4900 block of 41st Place, the 3400 and 3500 blocks of Lancer Drive, and the 3500 block of Longfellow Street. No decisions were made during the hearing; the Council will announce its decision within 15 days of the hearing's close. The meeting was procedural, with public comments and staff presentations only.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Councilmember Waszczak, seconded by Simasek, that hearing be Adjourned. The mo tion carried by the following vote: Croslin, Schaible, Denes, Waszczak, Sandino, Peabody, Solomon…
1 yea
Haba yea
Mon May 16, 2022 · 19:00

City Council

Hyattsville Council considers $1.2 million pandemic relief and new budget

The City Council will introduce the Fiscal Year 2023 budget and establish a seven-person Redistricting Commission. Proposals include allocating $1.2 million for an individual emergency relief program and $200,000 for food assistance using ARPA funds. The Council will also discuss a potential ban on gas-powered leaf blowers.

budgetarpareliefredistrictingpublic-works
✓ Decided: Council introduces FY2023 budget, approves ARPA relief programs

The Hyattsville City Council introduced the FY2023 budget ordinance (8-1) and approved two ARPA-funded relief programs: $1.2 million for individual emergency relief (with child payments raised to $1,250) and $200,000 for food assistance grants. The Council also established a nine-member Redistricting Commission, renewed the Axon contract, and approved consent items including police mobile support trailers.

🗳️ How they voted (10 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that this Agenda be Approved as Amended. The motion carried by the following vote: Page 2 of 11 City Council M…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, that this a genda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, to approve the C onsent Agenda.The motion carried unanimously. Croslin, Solomon, Schaible, Denes, Waszczak…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Sandino yea
A motion was made by Council Vice-President Schaible, seconded by Council President Solomon, that this agenda item be Approved as Amended. The motion carried by the following vote: Page 6 of 11 City…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, that this Page 8 of 11 City Council M eeting Minutes May 16, 2022 agenda item be Approved as Amended. The motion…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that this a genda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
H aba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Sandino, that this a genda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 absent
Denes absent
motion to a djourn be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes, Waszczak, Simasek, McClellan, Peabody, and Sa ndino
1 yea
H aba yea
Wed May 11, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Upcoming Public Safety Round Table and police department updates.

The committee will discuss police hiring, budget, and community issues with the Chief of Police. Members will also review a proposed name change for the outreach subcommittee and prepare for a June 8th public safety roundtable.

policepublic-safetycommunity-outreachhyattsville
✓ Decided: Committee discusses police budget, training, and community outreach

The committee approved the agenda and April minutes unanimously. They discussed police hiring, budget items including a new rescue vehicle and body cameras, and planned community events like National Police Week and a June 8th Public Safety Round Table on search warrants. No formal votes were taken on these topics.

Wed May 4, 2022 · 16:00

Shade Tree Board

Shade Tree Board discusses proposed revisions to Chapter 112

The Shade Tree Board will review the April 2022 minutes and a report on permits, denials, and illegal removals. The agenda also includes a presentation of the Trees of Hyattsville video and discussion regarding proposed revisions to Chapter 112.

treeszoninghyattsvillepublic-notice
✓ Decided: Shade Tree Board fines two illegal tree removals

The Hyattsville Shade Tree Board approved fines for two illegal tree removals: $550 for a black walnut and $800 for a pear tree. The board also discussed English ivy removal and education efforts, but took no formal action on those topics. The meeting was largely procedural, with no other substantive decisions made.

Tue May 3, 2022 · 16:00

Board of Supervisors of Election

Board discusses election complaints and upcoming voter outreach efforts

The Board will discuss election complaints and receive updates from several vendors and partners. The agenda also includes planning for candidate forums and potential voter outreach events.

electionsvoter-outreachcandidate-forumshyattsville
✓ Decided: Special election date and calendar reviewed; no final decision made

The Board of Supervisors of Elections met virtually and reviewed the draft calendar for the upcoming mayoral special election, based on a pending charter amendment allowing up to 140 days. Clerk Reams reported that e-pollbooks would not be used and that vendor contracting had begun. No formal decisions were made; the meeting was procedural, covering updates and next steps.

Mon May 2, 2022 · 16:00

Ethics Commission

Hyattsville Ethics Commission to discuss an election complaint

The Hyattsville Ethics Commission will hold a virtual meeting to address an election complaint. The commission also plans to discuss new business and schedule its next meeting.

ethicselectionshyattsville
✓ Decided: Ethics Commission finds councilmember violated city code over campaign email use

The Hyattsville Ethics Commission determined that Councilmember Danny Schaible violated city code §10-6, paragraph F(3)(b), by using his city email for campaign-related activity. The Commission approved sending a letter directing him to cease such use. The meeting was otherwise procedural, with no other substantive decisions.

Mon May 2, 2022 · 19:00

City Council

Hyattsville City Council to consider Fiscal Year 2023 real property tax rate

The Hyattsville City Council is holding a public hearing regarding the proposed Fiscal Year 2023 real property tax rate. The proposed rate is $0.63 per $100 of assessed value. It is anticipated that the Council will set the final tax rate during this meeting.

tax-ratebudgetpublic-hearing
✓ Decided: Council sets FY23 property tax rate at $0.63 per $100 assessed value

The Hyattsville City Council held a public hearing and voted to set the Fiscal Year 2023 real property tax rate at $0.63 per $100 of assessed value. An amendment to lower the rate to $0.61 failed. The final motion to approve the $0.63 rate carried 6-4.

Mon May 2, 2022 · 19:00

City Council

✓ Decided: Council approves $1.25M renovation for teen center at 5812 40th Avenue

The Hyattsville City Council approved a $1.25 million turn-key renovation of the 5812 40th Avenue building to house the Teen and Multigenerational Center, with construction and contingency costs not to exceed that amount, pending legal review. The council also adopted several proclamations, approved an appointment to the Race and Equity Task Force, and passed a consent agenda including contracts for solar interconnection, police equipment upgrades, and other routine items. Discussions were held on a proposed gas-powered leaf blower ban and a Business Improvement District feasibility study, but no final decisions were made on those items.

Thu Apr 28, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Committee reviews FY2023 budget and mental health programming

The committee will review the Fiscal Year 2023 budget and discuss Spanish language mental health classes for May and June. Members will also address amendments to the Thrive Grant document and schedule.

budgetmental-healthgrantscommunity-programs
✓ Decided: Committee approves $2,900 for Mental Health Awareness Month activities

The committee unanimously approved supporting Mental Health Awareness Month activities by paying up to $2,900 for instructors. They also approved the March 24 meeting minutes and voted to keep Thrive Grant funding levels the same, while deciding to reassess funding language and calendar dates at a future meeting.

Tue Apr 26, 2022 · 16:00

Race and Equity Task Force

The task force will review a presentation on the city's housing plan.

The committee will meet to approve minutes from September and March meetings. The agenda includes a presentation on the Housing Plan and an introduction to the City’s Mental Health Programs Manager. Updates regarding Driskell Park and the Equity Officer are also scheduled.

housingmental-healthequityparksadministration
✓ Decided: Task force hears mental health programs update, tables minutes approval

The Race and Equity Task Force met and heard a presentation from the city's Mental Health Programs Manager about police mental health initiatives, including a wellness check-in program and a crisis intervention team. The group tabled approval of previous meeting minutes until the next meeting and discussed the upcoming housing plan presentation. No formal votes were taken on substantive policy decisions.

Mon Apr 25, 2022 · 16:00

Education Advisory Committee

Hyattsville EAC discusses ARPA funds and student challenges

The Education Advisory Committee will review a meeting with the City Administrator regarding ARPA funds for Title 1 students. The committee will also evaluate the Education Enrichment Grant process and discuss a conflict resolution program for students.

educationarpa-fundsgrantsstudent-serviceshousing
✓ Decided: Education Advisory Committee approves minutes, discusses ARPA funds and grants

The Hyattsville Education Advisory Committee met on April 25, 2022, and unanimously approved the March 2022 and August 2021 meeting minutes. The committee discussed using ARPA funds to address student challenges for the 2022-23 school year, reviewed the Education Enrichment Grant process, and considered a conflict resolution program. No formal decisions were made on these agenda items; the meeting was primarily discussion and planning.

Fri Apr 22, 2022 · 16:00

Age Friendly Work Group

Discussion on housing and support resources for older residents

The Age-Friendly Hyattsville Work Group will discuss housing and support resources for older community members, featuring a presentation on SEED services. The meeting also includes updates on the Hyattsville Aging in Place program and upcoming reports regarding senior community needs and in-home care research.

housingseniorscommunity-serviceshealth
✓ Decided: Age-Friendly Work Group hears SEED housing services, plans workshops

The Age-Friendly Hyattsville Work Group met and heard a presentation from SEED, a nonprofit offering housing counseling, food, and financial services to older adults. The group discussed partnering with SEED to offer a workshop series in Hyattsville on topics like financial fitness, identity theft prevention, and computer training. City staff will follow up with SEED to plan the series. No formal decisions were made; the meeting was informational and procedural.

Thu Apr 21, 2022 · 16:00

Educational Facilities Task Force

Updates on HMS and HES builds and new leadership

The Educational Facilities Task Force will discuss updates regarding the HMS build and the current understanding of the HES build. The meeting also includes a discussion about new leadership and the approval of minutes.

educationconstructionleadership
✓ Decided: EFTF re-elects chair and secretary, focuses on school rebuilds

The Educational Facilities Task Force unanimously re-elected Daniel Broder as chairperson and Stuart Eisenberg as secretary. Members discussed the Hyattsville Elementary School swing space, the Nicholas Orem rebuild after a sewage failure, and the HMS build progress. No major funding or construction decisions were made; the meeting was largely procedural and informational.

Wed Apr 20, 2022 · 16:00

Code Compliance Advisory Board

Code compliance update and committee business

The Code Compliance Advisory Committee will receive an update on code issues with Joe Brewer. The meeting also includes the approval of February minutes and discussions regarding new business and committee news.

code-compliancehyattsvillemeeting-agenda
Mon Apr 18, 2022 · 19:00

City Council

Hyattsville Council considers $18.7 million contract for public safety building project

The City Council will consider a contract up to $18.7 million for the 3505 Hamilton Street Public Safety Building Adaptive Reuse Project. The agenda also includes allocating $1,200,000 in ARPA funds for individual emergency relief programs. Additionally, the Council will review mayoral election candidates and new community engagement tools.

public-safetybudgetarpacommunity-engagementconstruction
✓ Decided: Council awards $18.7M contract for Hamilton Street public safety building

The Hyattsville City Council approved a contract with Whiting-Turner Company for the 3505 Hamilton Street Public Safety Building Adaptive Reuse Project, with an authorized expenditure not to exceed $18,700,000. The council also approved a related change order for construction administration and management services. Several ARPA-funded relief programs were discussed but not voted on, with council preferring to bring them back for a vote at the next meeting.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Councilmember Simasek, seconded by Councilmember Haba, that the Agenda be Approved. The motion carried by the following vote: Page 2 of 15 City Council Meeting Minutes April 18…
1 yea
Waszczak yea
[context] Croslin, Solomon, Schaible, Denes, Simasek, McClellan, Haba, Peabody, and Sandino
2 yea
Waszczak yea · Waszczak yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
3 yea
Waszczak yea · Waszczak yea · Waszczak yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, to approve the Consent Agenda. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
1 yea
Waszczak yea
A motion was made by Councilmember Denes, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes, Simasek…
1 yea
Waszczak yea
Wed Apr 13, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Police & Public Safety Committee discusses hiring, budget, and community updates

The committee will discuss police hiring, budget updates, and the Community Action Team. Members will also review subcommittee leadership and prepare for a June 8th listening session on search warrants.

policepublic safetybudgetcommunity outreachhiring
Wed Apr 13, 2022 · 16:00

Ethics Commission

Ethics Commission discusses election updates and financial disclosures

The Hyattsville Ethics Commission met virtually to discuss general election updates and review financial disclosure documents. The agenda included information on candidate forums and the arrival of ballots in homes early May.

electionethicsfinancial-disclosure
✓ Decided: Ethics Commission accepts two financial disclosures, flags one for correction

The Hyattsville Ethics Commission accepted the 2021 Financial Disclosure Statements of candidates Vish Bhatt and Robert S. Croslin as submitted. The Commission identified corrections needed in Candidate Danny Schaible's disclosure, with a deadline of April 15, 2022, and approved a letter notifying him. No other substantive decisions were made.

Tue Apr 12, 2022 · 16:00

Hyattsville Environment Committee

Discussion of Pollinator Action Plan and CCAN ivy removal efforts

The Hyattsville Environment Committee will discuss the Pollinator Action Plan and debrief on CCAN ivy removal efforts. The meeting also includes an introduction of Christopher Koya to discuss a potential social impact project collaboration.

environmentpollinatorsivy-removalcommunity-projects
✓ Decided: Committee approves March minutes, plans pollinator action and ivy removal

The Hyattsville Environment Committee approved the March meeting minutes and discussed several initiatives, including a potential Route 1 corridor pollinator action plan, a partnership with the Chesapeake Climate Action Network for ivy removal, and a collaboration with a Congressional Black Caucus Foundation fellow. No formal votes were taken on these items; they remain in discussion or planning stages.

Tue Apr 5, 2022 · 16:00

Board of Supervisors of Election

Hyattsville Council reviews police vehicle purchase and development plans

The Hyattsville City Council is reviewing several infrastructure and development items. The agenda includes a proposal for new bus shelters and opposition to the Suffrage Point subdivision plan. The Council will also consider contract changes for engineering services.

zoningpoliceinfrastructuredevelopmentpublic-works
✓ Decided: Board certifies three candidates for June 7 special mayoral election

The Board certified Vish Bhatt, Robert S. Croslin, and Danny Schaible as candidates for the June 7, 2022 Special Mayoral Election. They also approved the March 1, 2022 meeting minutes and discussed timelines and logistics for the special election, including ballot intake dates and voter outreach events. No other substantive decisions were made.

Mon Apr 4, 2022 · 19:00

City Council

Hyattsville Council considers police vehicle purchases and zoning appeals

The City Council is reviewing several infrastructure and zoning items, including a request to deny a variance for 3107 Lancer Place. The meeting also includes discussions on new bus shelter concepts and transportation engineering contracts. Additionally, the Council will consider purchasing six new police vehicles.

zoningpolicetransportationinfrastructurepublic-works
✓ Decided: Council approves zoning variance denial, appeals, and police vehicle purchase

The Hyattsville City Council approved several action items, including sending correspondence to deny a zoning variance at 3107 Lancer Place, filing an appeal regarding the Queens Chapel Town Center, and opposing the Suffrage Point subdivision. The council also approved consent items, including the purchase of six police vehicles and a food distribution agreement. No substantive decisions were made on discussion items, which were only discussed.

🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, that the Agenda be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Waszczak…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, that the Proclamations be Adopted. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, that these Appointments be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Sandino, to approve the Consent Agenda. The motion carried by the following vote: Croslin, Solomon, Schaible, Waszczak…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Haba, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Peabody, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Denes yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible…
1 yea
Denes yea
Fri Apr 1, 2022 · 16:00

Shade Tree Board

Proposed revisions to Chapter 112 and tree permit reports

The Shade Tree Board will review the March 2022 minutes and hear a report regarding approved permits, denials, and illegal removals. The board will also discuss future meeting dates and consider proposed revisions to Chapter 112.

treesordinancepermits
✓ Decided: Tree Board moves meetings to first Wednesday at 7:30 pm

The Hyattsville Shade Tree Board approved changing its meeting time to the first Wednesday of the month at 7:30 pm, effective immediately, and will continue meeting virtually. The board also approved several revisions to Chapter 112 of the Urban Forest code, including striking annual report language and adding a hardship waiver for tree replacement. Other items, such as application details and a clause on tree inspections, were tabled pending input from staff member Dawn Taft.

Wed Mar 30, 2022 · 19:00

City Council

Hyattsville City Council discusses ARPA relief plans and FY23 draft budget

The Hyattsville City Council is holding a work session to discuss emergency relief plans using American Rescue Plan funds. The council will also receive the introduction of the draft budget for Fiscal Year 2023.

budgetarpafinancehyattsville
✓ Decided: Council discusses ARPA fund use and FY23 draft budget

The Hyattsville City Council held a work session to discuss the allocation of $17.9 million in American Rescue Plan Act (ARPA) funds and the draft Fiscal Year 2023 budget. No formal decisions were made; the meeting was for presentation and discussion only. Council members raised questions and suggestions about using ARPA funds for affordable housing, childcare, food assistance, and other priorities, and reviewed departmental budget presentations.

🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
A motion was made by Council Vice-President Schaible, seconded by Councilmember Simasek, that the Agenda be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Waszczak…
9 yea
Croslin yea · Solomon yea · Schaible yea · Waszczak yea · Simasek yea · Denes yea · Peabody yea · Sandino yea · Haba yea
A motion was made by Council Vice-President Schaible, seconded by Councilmember Waszczak, that the meeting be Adjourned. The motion carried by the following vote: Croslin, Solomon, Schaible…
9 yea
Croslin yea · Solomon yea · Schaible yea · Waszczak yea · Simasek yea · Denes yea · Peabody yea · Sandino yea · Haba yea
Mon Mar 28, 2022 · 16:00

Education Advisory Committee

Discussion of American Rescue Plan Act and school programs

The committee will discuss the American Rescue Plan Act with Patrick Paschall. The meeting also includes discussions regarding Hyattsville Middle School snack funding and the Summer Enrichment Program.

educationfundingschoolshyattsville
✓ Decided: EAC discusses ARPA funds for education, no formal decisions

The Education Advisory Committee met and discussed how to allocate American Rescue Plan Act (ARPA) funds for educational purposes, including potential support for students affected by school construction and food insecurity. No formal decisions were made; the committee agreed to include summer reading and enrichment programs in a letter to the City Council. The meeting was procedural and informational.

Fri Mar 25, 2022 · 16:00

Age Friendly Work Group

Review of FY22 and FY23 Age-Friendly Action Plan priorities

The Age-Friendly Hyattsville Work Group will review milestones from the 2021 Action Plan and discuss priorities for fiscal years 2022 and 2023. The meeting also includes updates on community programs and ARPA fund recommendations.

hyattsvilleage-friendlycommunity programsplanningbudget
Thu Mar 24, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Discussion of Speaker Series and Mental Health Awareness Month

The committee will discuss the Speaker Series and Mental Health Awareness Month. The agenda consists of general topic discussions and procedural items.

healthwellnessrecreationhyattsville
Tue Mar 22, 2022 · 16:00

Race and Equity Task Force

Race and Equity Task Force to review equity plan presentations

The committee will hear presentations regarding the Equity Plan and discuss cultural programming ideas for Community Services. The meeting also includes updates on the Equity Officer, Centennial Park, and COG resources.

equitycommunity-serviceshyattsvillepublic-meeting
✓ Decided: Task force approves minutes, schedules equity plan presentations

The Race and Equity Task Force approved minutes for January and February 2022 and set a schedule for equity plan presentations from April through September. No substantive policy decisions were made; discussions focused on hiring an Equity Officer, cultural programming, and process concerns.

Mon Mar 21, 2022 · 19:00

City Council

Hyattsville Council reviews requested revisions for Suffrage Pointe development

The City Council will consider requested density and design revisions to the Suffrage Pointe development plan. The meeting also includes discussions on a proposed $20,000 grant program for high school graduates and several budget amendments.

developmenteducationbudgetyouthinfrastructure
✓ Decided: Council tables Suffrage Point plan, approves amended letter on density

The Hyattsville City Council voted unanimously to table the Suffrage Point preliminary subdivision plan (HCC-279-FY22) to revisit it on April 4, 2022. The council also approved an amended motion (HCC-293-FY22) to send correspondence to the District Council superseding the March 9 letter, reiterating that density shall not exceed the R-55 zone maximum and that net acreage excludes floodplain, streets, alleys, stormwater facilities, and other public ways. The consent agenda was approved, including a $500 Ward 3 discretionary fund for school snacks, a $188,000 speed camera budget increase, and a $50,000 change order for IT cabling.

Thu Mar 17, 2022 · 16:00

Educational Facilities Task Force

Updates on HMS build, RGMS retrofitting, and HES build status

The task force will receive updates regarding the HMS build and RGMS retrofitting projects. The meeting also includes a review of the current understanding of the HES build and a discussion on potential land availability.

educationschoolsinfrastructurefacilities
Wed Mar 9, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Police Chief to discuss hiring, budget, and community safety updates

The committee will discuss police department updates regarding hiring, the budget, and the Community Action Team. Members will also address trash overflow solutions and review warrant procedures in the city. Additionally, the group will discuss Opioid Maryland Settlement Funds and 2022 outreach opportunities.

policepublic-safetybudgetcommunity-outreach
✓ Decided: Hyattsville police committee discusses staffing, trash, forms subcommittees

The committee approved the agenda and January minutes, heard from Public Works about trash overflow and rodent control, and received updates from Police Chief Towers on staffing and budget. They decided to devote the next meeting's agenda to structuring subcommittees for ongoing work. No formal votes were taken on substantive policy items.

Wed Mar 9, 2022 · 16:00

Ethics Commission

Updates on the June 7 special election and campaign finance reviews

The Ethics Commission will discuss updates regarding the June 7 special election, including staffing and candidate information sessions. The meeting also includes a follow-up on a Chapter 8 amendment concerning annual report timing for special elections.

ethicselectionscampaign-financehyattsville
Tue Mar 8, 2022 · 16:00

Hyattsville Environment Committee

Discussion of city plastic reduction proposals and state environmental resolutions

The committee will discuss two proposed city legislative items regarding plastic bag reduction and single-use plastics. The agenda also includes a resolution supporting state environmental bills.

environmentplasticlegislationwaste
✓ Decided: Committee approves resolution supporting county single-use plastic bill

The Hyattsville Environment Committee approved a motion to support a Prince George's County bill aimed at reducing single-use plastics, with Ben Simasek to draft a motion for the City Council. The committee also discussed supporting state environmental bills, ivy removal with Hyattsville Aging in Place, and a potential city plastic bag reduction ordinance, but took no final action on these items.

Mon Mar 7, 2022 · 19:00

City Council

Public hearing on American Rescue Plan emergency relief plans

The Hyattsville City Council will hold a public hearing regarding the American Rescue Plan Emergency Relief Plans. This item is presented by the City Administrator and involves the Finance Department.

public-hearingfinanceemergency-reliefarpa
✓ Decided: Council holds public hearing on ARPA emergency relief plans

The Hyattsville City Council held a public hearing on March 7, 2022, to gather community input on proposed American Rescue Plan (ARPA) emergency relief plans. No formal decisions were made; the hearing was for public comment only. Residents and organization representatives spoke in favor of funding for food pantries, meal programs, direct resident assistance, and support for artists and refugee families.

Mon Mar 7, 2022 · 19:00

City Council

Hyattsville Council considers speed enforcement contract and new developments

The City Council is reviewing automated speed enforcement contracts and residential subdivision plans for Avalon Bay and Suffrage Pointe. The meeting also includes discussions on budget initiatives for the Hyattsville Learning Lab and a Youth Advisory Council.

zoningpolicebudgethousingpublic-safety
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, that this agenda item be Approved. The motion carried by the following vote: City Council Meeting Minutes March…
1 yea · 1 nay
Haba yea · Sandino nay
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Denes, Waszczak…
1 yea · 1 nay
Schaible yea · Sandino nay
A motion was made by Council Vice-President Schaible, seconded by Councilmember Denes, that this agenda item be Approved. The motion carried by the following vote: Croslin, Solomon, Schaible, Denes…
1 yea · 1 nay
Haba yea · Sandino nay
The other 8 items passed by unanimous or near-unanimous consent.
Fri Mar 4, 2022 · 16:00

Shade Tree Board

Shade Tree Board to hold elections and discuss Chapter 112 revisions

The Shade Tree Board will review permit reports, including the denial of permit IL21-006 for Dawn Taft. The board will also conduct elections for Chair, Vice Chair, and Secretary positions. Additionally, members will discuss proposed revisions to Chapter 112.

shade treeelectionspermitschapter 112
✓ Decided: Tree Board approves $550 fine for illegal oak removal

The Hyattsville Shade Tree Board approved a $550 fine for the removal of a 92.4-inch oak tree, revised two sections of the city tree ordinance, and elected new officers. The board also voted to support the Healthy Trees Hyattsville initiative.

Tue Mar 1, 2022 · 16:00

Board of Supervisors of Election

Review of Mayoral Special Election calendar and budget

The Board will review the draft calendar, budget, and vendor updates for the Mayoral Special Election. The agenda also includes a staffing update and discussion regarding a charter amendment.

electionmayoralbudgetcharterstaffing
✓ Decided: Special election set for June 7; candidate filing opens March 21

The Board of Supervisors of Elections reviewed the timeline for the June 7 mayoral special election, with candidate registration from March 21 to April 8. The council approved a $108,000 budget for the election, and vendors for printing and day-of equipment were approved. No decisions were made on charter amendment scenarios, which will be discussed further.

Mon Feb 28, 2022 · 16:00

Education Advisory Committee

Review and selection of Education Enrichment Grants

The committee will review and select Education Enrichment Grants. Discussion topics include grief support and follow-up items such as a letter to Council and scheduling meetings with school leadership.

educationgrantsschool-leadershipcommunity-support
✓ Decided: Education Advisory Committee approves 20 enrichment grants totaling $10,000

The Hyattsville Education Advisory Committee unanimously approved 20 Education Enrichment Grants of $500 each, totaling $10,000, for schools and programs including Northwestern High School, Rosa Parks, and Hyattsville Middle School. The committee also unanimously approved a recommendation to name the Educational Enrichment Grant in honor of former Mayor Kevin Ward. The January 2022 meeting minutes were approved with one edit.

Fri Feb 25, 2022 · 16:00

Age Friendly Work Group

Discussion of 2021 Senior Community Needs Survey follow-up actions

The Age-Friendly Hyattsville Work Group is reviewing follow-up steps for the 2021 Senior Community Needs Survey. The meeting includes discussions on draft community documents and information regarding ARPA Relief Funds. Members will also receive updates on local programs and upcoming community activities.

age-friendlyseniorscommunity-resourcesarpahyattsville
Thu Feb 24, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Election of officers and review of THRIVE council action

The Health, Wellness, and Recreation Advisory Committee will meet via Zoom to elect new officers and review Council action regarding THRIVE. The committee will also approve previous meeting minutes.

electionTHRIVEhyattsvillehealthwellness
✓ Decided: Committee elects Pete Reiniger chair, approves THRIVE grant allocations

The Health, Wellness, and Recreation Advisory Committee approved the January 27, 2022 meeting minutes and unanimously elected Pete Reiniger as Chairperson. The committee approved the THRIVE grant motion as written for five applicants, reallocating $6,500 to the speaker series with a focus on mental health. Discussions were held on future THRIVE grant improvements, Mental Awareness Month activities in May 2022, and a potential partnership with the Prince George's County Board of Education.

Tue Feb 22, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Hyattsville police committee discusses community listening event and subcommittee chair

The committee will discuss setting a date for a community listening engagement event. Members will also nominate a new chair for the policy subcommittee and receive an update from the Chief of Police.

policepublic-safetycommunity-engagementhyattsville
✓ Decided: Committee discusses police hiring, new deputy chief, and Tyre Nichols case

The committee met and approved the agenda and January minutes. They discussed the police chief's hiring update, introduced the new Deputy Chief Lanham, and addressed the Tyre Nichols killing, emphasizing accountability and policy changes. No formal votes were taken on these discussion items.

Tue Feb 22, 2022 · 19:00

City Council

Hyattsville City Council to discuss charter amendment for special election timing

The Hyattsville City Council will hold a public hearing regarding Charter Amendment Resolution 2022-01. This resolution proposes adjusting the time requirements for conducting special elections when a vacancy occurs in the office of Mayor or Councilmember.

hyattsvillecity councilcharter amendmentspecial electiongovernment administration
✓ Decided: Council hears proposal to extend special election timeline from 75 to 140 days

The City Council held a public hearing on Charter Amendment Resolution 2022-01, which would extend the time for holding a special election to fill a vacancy in the office of Mayor or Councilmember from 75 to 140 days. City Clerk Laura Reams presented the proposal, and Board of Supervisors of Elections Chair Zachary Peters spoke in support. Public commenter David Marshall opposed the amendment and a vote-by-mail-only election. No vote was taken; the hearing was adjourned.

Tue Feb 22, 2022 · 19:00

City Council

Hyattsville Council considers $1.3 million parking lot sale and special election costs

The Hyattsville City Council will consider the $1,300,000 sale of the Jefferson Street parking lot and budget amendments for a special election. The agenda also includes discussions regarding automated traffic enforcement and property tax relief studies.

budgetelectionpropertypublic-workshousing
✓ Decided: Council approves sale of Jefferson Street parking lot for $1.3M

The Hyattsville City Council approved the sale of the Jefferson Street parking lot to Urban Investment Partners (Hyattsville Town One, LLC) for $1,300,000, subject to City Attorney review. The Council also approved the FY22 Thrive Grant disbursement as amended, allocating $3,200 to grant proposals and $5,800 to mental health programming. A charter amendment resolution adjusting special election time requirements was introduced and adopted. The consent agenda, including a $108,000 budget amendment for the special election, was approved.

Thu Feb 17, 2022 · 16:00

Age Friendly Work Group

Discussion of American Rescue Plan Act (ARPA) funds and community needs

The Age-Friendly Hyattsville Work Group will discuss the use of ARPA funds and how to prioritize community needs. The meeting also includes follow-up actions for the 2021 Senior Community Needs Survey and program updates.

arpaseniorscommunity-needshyattsvillepublic-programs
Wed Feb 16, 2022 · 16:00

Hyattsville Environment Committee

Discussion of County Master Plan of 2035 Transportation Plan and American Rescue Plan

The committee will discuss next steps for the County Master Plan of 2035 Transportation Plan. The meeting also includes updates on the American Rescue Plan and state legislation.

transportationbudgetlegislation
✓ Decided: Committee discusses ARPA funds, state bills; no formal votes taken

The Hyattsville Environment Committee met and discussed next steps for the County Master Plan of 2035 Transportation Plan, noting no updates yet. Members discussed the American Rescue Plan, with $18M to be spent by 2026, and considered whether to propose an initiative; comments are due Feb 25th. The committee also reviewed state environmental legislation and discussed inviting speakers on climate issues. No formal decisions or votes were recorded; the meeting was procedural and informational.

Wed Feb 16, 2022 · 16:00

Code Compliance Advisory Board

Updates to noise and leaf blower ordinances

The Code Compliance Advisory Committee will discuss updates regarding the noise and leaf blower ordinances. The meeting also includes a review of Chapter 113 and an update on code issues with Joe Brewer.

ordinancescode-compliancehyattsville
Tue Feb 15, 2022 · 16:00

Race and Equity Task Force

Race and Equity Task Force to host grief and healing address

The committee will hear a grief and healing address from Lt. Steve Thomas of the Anne Arundel County Police Crisis Intervention Team. The meeting also includes an equity officer update and scheduling for future equity plan presentations.

race-and-equitycommunity-safetyhyattsville
✓ Decided: Task Force schedules Equity Plan section presentations for April-September

The Race and Equity Task Force scheduled presentations for sections of the Equity Plan from April to September, with housing first. They also tabled approval of September and January meeting minutes until March, and discussed the special election for Mayor and the Equity Officer hiring process. No final decisions were made on substantive policy.

Tue Feb 15, 2022 · 16:00

Planning Committee

Hyattsville Planning Committee to review local development updates

The committee will receive updates on several projects, including Avalon Bay at MPG and Canvas Apartments. Members will also elect new officers and adopt the 2022 annual meeting calendar.

developmenthousingplanningelectionshyattsville
✓ Decided: Planning Committee approves meeting calendar and October 2021 minutes

The Hyattsville Planning Committee approved the October 2021 minutes and the 2022 annual meeting calendar. The January 2022 minutes were deferred to the next meeting. The committee also adopted a succession arrangement for the chair position, with Todd to step in if Maureen is unavailable. No decision was made on a recorder.

Thu Feb 10, 2022 · 16:00

Board of Supervisors of Election

Planning for a mayoral special election and reviewing charter amendment requests

The Board will discuss selecting a date and reviewing the calendar for a mayoral special election. The meeting includes updates on vendors and potential equipment procurement. Members will also review a request for a charter amendment public hearing.

electionsmayoral-electioncharter-amendmentcampaign-finance
Wed Feb 9, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Discussion on police accountability through officer decertification

The committee will hear a presentation regarding police accountability via officer decertification for misconduct. Members will also discuss warrant procedures, opioid settlement funds, and potential uses for ARPA funds.

policepublic-safetyaccountabilitybudgetcommunity-outreach
Wed Feb 9, 2022 · 16:00

Ethics Commission

Officer elections and updates on the 2022 mayoral special election

The Ethics Commission will discuss nominations for Chair and Recordkeeper. The meeting also includes updates on a charter amendment resolution regarding the 2022 special election for Mayor.

ethicselectionsgovernmentmayoral-vacancy
✓ Decided: Ethics Commission elects new chair, plans special election oversight

The Hyattsville Ethics Commission reorganized for 2022, electing Michael Horlick as chair and T. Carter Ross as recordkeeper. The commission discussed the upcoming special election to fill the late Mayor Ward's seat, including a proposed charter amendment to extend the election timeline to 140 days. Members volunteered to draft language for election code changes and to contribute to a post-election report. No formal decisions were made beyond the officer elections.

Mon Feb 7, 2022 · 19:00

City Council

Hyattsville Council to hold special mail-in election for Mayor

The City Council is meeting to address a vacancy in the Mayor's office and plan a special vote-by-mail election. The agenda includes discussions on budget initiatives, such as a roundabout design and a high school graduate grant program. The Council will also consider administrative agreements and proclamations.

mayoral electionbudgetinfrastructurezoningcommunity grants
✓ Decided: Council approves vote-by-mail special mayoral election

The Hyattsville City Council approved a resolution declaring the 2022 special mayoral election a vote-by-mail election and granting a 30-day extension due to missing equipment. The council also approved a zoning variance support letter for 3300 Lancer Drive, scheduled public hearings, and adopted several proclamations and consent items. Discussion items on a roundabout, branding, a grant program, and trail lighting were presented but not voted on.

Tue Feb 1, 2022 · 16:00

Board of Supervisors of Election

Election of Board officers and discussion of Special Election status

The Board will elect a Chair and Recordkeeper. Members will also discuss the status of a special election and hold a remembrance for Mayor Ward.

electionsgovernmentspecial-election
✓ Decided: Board recommends extending special election timeframe to 140 days

The Board of Supervisors of Elections held a virtual meeting on February 1, 2022, and took several actions. They unanimously approved Erin Payne as Recordkeeper, closed the meeting to consult with the City Attorney about the Mayoral vacancy, and discussed a special Vote-by-Mail election. The Board decided to recommend to the City Council that the timeframe for the special election be extended from 75 to 140 days, and directed Clerk Reams to draft a letter to the City Council. No action was taken during the closed session.

Fri Jan 28, 2022 · 16:00

Age Friendly Work Group

Discussion of American Rescue Plan Act (ARPA) funds for community needs

The work group will discuss prioritizing community needs using City of Hyattsville ARPA funds. The meeting also includes follow-up on the 2021 Senior Community Needs Survey and updates on local aging initiatives.

hyattsvillearpaseniorscommunity needsaging
Thu Jan 27, 2022 · 16:00

Health, Wellness, and Recreation Advisory Committee

Election of officers and review of THRIVE recommendations

The committee will elect new officers and approve the 2022 meeting calendar. Members will also review THRIVE recommendations and a presentation for the City Council. Additionally, the committee will discuss ideas for cultural programming.

healthwellnessrecreationelectionsprogramming
✓ Decided: Committee approves 2022 calendar, THRIVE grant letter

The Health, Wellness, and Recreation Advisory Committee approved the 2022 meeting calendar and a cover letter for THRIVE grant recommendations to be presented to City Council on February 22. Officer elections were tabled until the next meeting. The meeting began with remarks honoring the late Mayor Kevin Ward.

Tue Jan 25, 2022 · 16:00

Race and Equity Task Force

The task force will discuss cultural programming ideas and equity plan assignments.

The Race & Equity Task Force is meeting to discuss ideas for cultural programming. The committee will also review administrative updates, including the mural project and annual calendar.

race-and-equitycultural-programmingmural-projectcommunity-engagement
✓ Decided: Task force approves annual calendar, assigns equity plan topics

The Race and Equity Task Force approved its annual meeting calendar, except for the February date, and assigned members to lead and review six equity plan categories: housing, community policing, community engagement, transportation, aging and disabilities, and jobs. The group also discussed cultural programming ideas for heritage months, including a potential talk by Lawrence T. Brown, and received updates on the mural project and the Equity Officer hiring process.

Mon Jan 24, 2022 · 16:00

Education Advisory Committee

Discussion of bus delays, enrichment grants, and school mediation training

The committee will discuss bus transportation delays and the status of American Rescue Plan funding. Members will also review enrichment grant applicants and a budget memo to council for conflict resolution training. Additionally, the group will explore educational initiatives for the homeless population.

educationtransportationbudgetstudentscommunity
✓ Decided: Education committee extends enrichment grant deadline to Feb. 22

The Hyattsville Education Advisory Committee voted unanimously to delay the enrichment grant application deadline from Jan. 31 to Feb. 22, after receiving zero applicants. The committee also approved new leadership and discussed a summer learning pilot program, but no final decision was made on that proposal.

Thu Jan 20, 2022 · 16:00

Educational Facilities Task Force

Updates on educational facility builds and retrofits

The Educational Facilities Task Force will discuss progress regarding the HMS build and RGMS retrofitting. The meeting also includes a review of the HES build status and a discussion about potential land availability.

educationfacilitiesconstructionhyattsville
✓ Decided: Hyattsville Middle School build on schedule; Phase II funding secured

The task force heard that the Hyattsville Middle School construction is on schedule with steel erection upcoming. County funding of $25 million per year for Phase II school construction was confirmed after a veto was overruled. Hyattsville Elementary is a candidate for Phase II but faces competition from high school proposals and site constraints.

Wed Jan 19, 2022 · 16:00

Planning Committee

Review of Avalon Bay at MPG and 5402 Jamestown Road development plans

The committee will review a preliminary subdivision plan for Avalon Bay at MPG and a conceptual site plan for 5402 Jamestown Road. The agenda includes updates on Suffrage Point South and the KFC at Queens Chapel Town Center. Members will also elect officers and adopt an annual meeting calendar.

zoningdevelopmentplanninghyattsville
✓ Decided: Planning Committee recommends approval of Avalon Bay subdivision

The Hyattsville Planning Committee recommended approval of the preliminary plan of subdivision for the Avalon Bay at MPG project, with concerns about pedestrian safety on Toledo Rd. They also reviewed a conceptual site plan for 5402 Jamestown Road, expressing support for affordable housing but raising concerns about parking and building design. The committee approved the October 2021 minutes and adopted the 2022 meeting calendar, but made no decision on a co-chair or secretary.

⚠️ FEMA flood zone AE at this address
Wed Jan 19, 2022 · 16:00

Ethics Commission

Hyattsville Ethics Commission discusses officer elections and financial disclosures

The commission will prepare for upcoming officer elections and member re-appointments. Members will also review annual financial disclosure forms and the 2022 calendar. The agenda includes a review of finance reports and discussion regarding the FY23 election budget.

ethicselectionsappointmentsbudgetfinance
Tue Jan 18, 2022 · 19:00

City Council

Hyattsville Council considers premium pay for certain essential workers

The City Council will review presentations on road reconstruction and development at 5402 Jamestown Road. The meeting includes motions to authorize COVID-19 test kit purchases and a temporary premium pay program for essential employees. Additionally, the Council will discuss real property negotiations in a closed session.

covid-19budgetemploymentinfrastructuregrants
✓ Decided: Council approves amended support for Adelphi Road Sector Plan

The Hyattsville City Council approved a motion to send correspondence to M-NCPPC supporting the preliminary Adelphi Road Sector Plan, subject to conditions in Table 1 and an amendment to encourage reopening the public comment period for 60-90 days and expanding input methods beyond digital. The council also approved several consent items, including a $50,000 solar panel grant appropriation, a public hearing for ARPA relief programs, purchase of COVID-19 test kits, a letter supporting Sustainable Maryland funding, and a premium pay program for essential workers. No action was taken in closed session.

Wed Jan 12, 2022 · 16:00

Police & Public Safety Citizens' Advisory Committee

Hyattsville Police & Public Safety Committee to discuss department protocols

The committee will receive updates from Chief Jarod Towers regarding police department protocols, including incident data capture and camera usage. Members will also conduct annual officer elections and discuss potential uses for federal COVID-19 funds.

policepublic safetycommunity outreachhyattsville
✓ Decided: Hyattsville police committee re-elects officers, tables chief's report

The committee unanimously re-elected Patricia Page as chair and Joel Chan as secretary, and created a new vice chair position, electing Jerome Brown. They tabled discussion of Chief Towers' report on incident data protocols until next month due to an email error. The committee also discussed federal COVID funds, with only one HPD employee eligible, and agreed to submit ideas by email for future discussion.

Tue Jan 11, 2022 · 16:00

Hyattsville Environment Committee

HEC to elect officers and discuss Sustainable Maryland recertification

The Hyattsville Environment Committee will elect a Chairperson and a recorder. Mike Hunninghake of Sustainable Maryland is scheduled to present on the organization's work and lead a brainstorming exercise. The committee will also discuss supporting the Sustainable Maryland recertification process.

sustainabilityelectionsenvironmenthyattsville
✓ Decided: Hyattsville Environment Committee approves support for Sustainable Maryland funding

The Hyattsville Environment Committee approved a motion to support a City Council resolution backing Sustainable Maryland's state funding proposal. They also approved the late November meeting minutes and re-elected Rich Canino as chair and Janet Nackoney as recorder. The committee discussed recertification requirements and brainstormed new activities.

Mon Jan 10, 2022 · 19:00

City Council

Discussion on creating a Civilian Oversight of Law Enforcement Committee

The City Council will discuss establishing a Civilian Oversight of Law Enforcement Committee. The agenda also includes a presentation on the Preliminary Adelphi Roads Sector Plan and several budget amendments. Additionally, the Council will consider various appointments and contract authorizations.

policebudgetcommunityappointmentsinfrastructure
✓ Decided: Council approves letter opposing Suffrage Pointe wetlands permit

The Hyattsville City Council approved a letter to the Maryland Department of Environment requesting rejection of Werrlein WSSC LLC's wetlands permit application for Suffrage Pointe, notification to adjoining property owners, and a 30-day extension of the public comment period. The council also approved several routine items, including expenditures for tree plantings, an EnergiPlant system, and budget amendments. A discussion on establishing a Civilian Oversight Committee was held but no final decision was made.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
A motion was made by Council President Croslin, seconded by Councilmember Sandino, that this meeting be adjourned. The motion carried by the following vote: Ward, Croslin, Schaible, Denes, Waszczak…
1 yea
Haba yea
Fri Jan 7, 2022 · 16:00

Shade Tree Board

Discussion of proposed revisions to Chapter 112

The Shade Tree Board will review the December 2021 minutes and receive a report on approved permits and denial IL21-006. The board will also discuss proposed ordinance changes for Chapter 112.

shade treeordinancepermitshyattsville
✓ Decided: Tree Board discusses new Healthy Trees Hyattsville program

The Hyattsville Tree Board approved the December meeting minutes and discussed a proposed Healthy Trees Hyattsville program to help residents with tree care and removal costs, which will go to the council for approval this spring. The board postponed discussion on an illegal tree removal permit (IL21-006) and proposed revisions to Chapter 112-2E pending further research. No formal decisions were made on these items.

Tue Jan 4, 2022 · 16:00

Board of Supervisors of Election

Election of Board Chair and FY23 budget planning

The Board of Supervisors of Elections will elect a new Chair and adopt the 2022 meeting calendar. The agenda also includes updates on 2021 campaign finance and FY23 budget planning.

electionbudgetcampaign-financehyattsville
✓ Decided: Election Board elects Zach Peters as chair, adopts 2022 calendar

The Board of Supervisors of Elections elected Zach Peters as Chair and unanimously adopted the 2022 meeting calendar. Members reviewed campaign finance reports from 2021, discussed a draft election report, and reviewed the proposed FY23 budget. No new business was discussed, and the meeting adjourned at 4:48 PM.

Mon Jan 3, 2022 · 19:00

City Council

Hyattsville Council to discuss establishing a civilian police oversight committee

The Hyattsville City Council will discuss the establishment of a Civilian Oversight of Law Enforcement Committee. The agenda also includes a presentation on the Preliminary Adelphi Roads Sector Plan and several appointments to local boards. Additionally, the Council will consider expenditures for tree plantings and park improvements.

policezoningbudgetparksappointmentscommunity