The Boring PartsFederalLocal · USLocal · Canada
Oceanside, CA

Oceanside public meetings in 2025

45 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Tue Dec 16, 2025

Board Meeting

Orange County Board of Supervisors to review airport contracts and homeless services

The Board of Supervisors is meeting to decide on various service contracts, including airport engineering and homeless housing. The body will also consider a response to a Grand Jury report on homelessness and a resolution opposing offshore oil drilling.

contractshomelessnessaviationenvironmentpublic-workspublic-safety
Tue Dec 2, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $3M in new contracts and emergency declarations

The Orange County Board of Supervisors will meet to approve multiple contracts totaling millions of dollars, including workforce development services and emergency vehicle upfitting. They will also consider extending a local health emergency for the Trabuco Canyon Airport Fire area and adopt a final environmental study for a renewable natural gas project at Frank R. Bowerman Landfill.

budgetcontractshealth-emergencyworkforce-developmentairportlandfillenvironmental-review
Tue Dec 2, 2025

Board Meeting

Orange County Board of Supervisors to review workforce and infrastructure contracts

The Board of Supervisors will consider multiple workforce development contracts under the Workforce Innovation and Opportunity Act and various infrastructure projects. The meeting includes decisions on airport services, landfill maintenance, and a ground lease for the former South County Justice Center in Laguna Niguel.

contractsworkforce-developmentinfrastructurepublic-healthreal-estate
Tue Nov 18, 2025

Board Meeting Afternoon

Board considers ordinance on illegal encampments and camping on public property

The Orange County Board of Supervisors will consider a second reading of an ordinance regarding illegal encampments on public and Flood Control District property. The body is also deciding on various service contracts and a public hearing for the Orange County Housing Authority's revised annual and administrative plans.

homelessnesspublic-safetycontractshousingauditpublic-works
Tue Nov 18, 2025

Board Meeting

Orange County supervisors to vote on $6.75M helicopter engine contract and housing plan

The Orange County Board of Supervisors will meet to decide on multiple contracts, including a $6.75 million three-year engine overhaul deal for county helicopters and a $3 million digital media service contract. They will also hold a public hearing on the Orange County Housing Authority’s revised annual plan for FY 2025-26. The board will consider appointments, grants, and resolutions, including recognition of Adoption Awareness Month and National Hunger and Homelessness Awareness Week.

budgetcontractshousingaviationgrantsappointmentspublic-healthdigital-services
Tue Nov 4, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $94.7M pharmacy contract and new building codes

The Orange County Board of Supervisors will meet on November 4, 2025, to discuss and vote on several key items, including a $94.7 million pharmacy benefits contract, grants totaling over $2.5 million, and updates to building codes. The board will also consider a local health emergency related to the Trabuco Canyon Airport Fire and a zoning amendment for battery energy storage systems.

building-codeshealth-emergencypharmacy-contractgrantszoningpublic-safetyflood-control
Tue Nov 4, 2025

Board Meeting

Orange County Board considers new pharmacy benefits contract and building code updates

The Board of Supervisors will discuss a $94.7 million pharmacy benefits contract and a new ordinance regarding illegal encampments. Public hearings are scheduled for battery energy storage zoning and the adoption of 2025 building, plumbing, mechanical, electrical, and fire codes.

pharmacy-benefitszoningbuilding-codeshomelessnesscontractspublic-health
Tue Oct 28, 2025

Board Meeting Afternoon

Orange County Board considers $250 million reimbursement for capital projects

The Board of Supervisors will discuss financing for capital facilities projects and the adoption of updated 2025 building, plumbing, mechanical, electrical, and fire codes. The meeting also includes several high-value contracts for the Sheriff-Coroner and Waste & Recycling departments.

budgetpublic-worksbuilding-codescontractspublic-safetyinfrastructure
Tue Oct 28, 2025

Board Meeting

Orange County supervisors to vote on $250M capital projects plan and building code updates

The Orange County Board of Supervisors will meet to decide on a $250 million capital facilities financing plan, approve updated building and plumbing codes, and vote on multiple contracts totaling over $50 million. The board will also hear a public hearing on proposed code changes and discuss grants, appointments, and donations including four Rivian vehicles for the Sheriff-Coroner.

building-codescapital-projectscontractsdonationsfacilitiesfinancingpublic-workssheriff
Tue Oct 14, 2025

Board Meeting Afternoon

Orange County supervisors to vote on airport allocations and $9.3M land sale

The Orange County Board of Supervisors will meet to decide on commercial airline allocations at John Wayne Airport, certify completed streets, approve contracts for sheriff services and animal hospital care, and vote on a $9.3 million land sale to the City of Irvine. The board will also discuss extending a local health emergency for the Trabuco Canyon Airport Fire area and consider grants for public safety and health programs.

airportcontractshealth-emergencyland-salepublic-works
Tue Oct 14, 2025

Board Meeting

Board to vote on airport departures, $9.3M land sale, and $3.6M drug testing contract

The Orange County Board of Supervisors will meet to decide on commercial airline access at John Wayne Airport, approve a $9.26M land sale to Irvine, and vote on a $3.6M drug testing contract for the Probation Department. The board will also discuss grants, facility leases, and recognize heritage months.

airportzoningbudgethealthpublic-worksgrantslaw-enforcement
Tue Sep 23, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $54M airport power upgrade contract

The Orange County Board of Supervisors will meet to consider contracts, appointments, and budget updates, including a $54.5M airport power upgrade and emergency declarations for wildfire recovery. Residents may speak on agenda items or during public comments.

budgetcontractsairporthealth-emergencydiscretionary-fundswildfire-recoveryappointments
Tue Sep 23, 2025

Board Meeting

Orange County supervisors to vote on $54.5M airport power upgrade contract

The Orange County Board of Supervisors will meet to conduct regular business including approving contracts, budget updates, and resolutions. Items include a $54.45 million contract for John Wayne Airport power upgrades, allocations from district discretionary funds, and continued emergency declarations for the Airport Fire.

airportbudgetcontractsemergency-managementfundinghealth-servicesparkswildfire
Tue Sep 9, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $2.6M sheriff IT contract and $100K gun buyback funding

The Orange County Board of Supervisors will meet on September 9, 2025, to consider multiple contracts, allocations, and resolutions. Items include a $2.6M contract for sheriff intelligence services, renewals of stormwater and GIS software contracts, and discretionary fund allocations for local nonprofits and programs. Several items have been continued from previous meetings.

budgetcontractslaw-enforcementnonprofitspublic-healthtechnology
Tue Sep 9, 2025

Board Meeting

Orange County supervisors to vote on $2.6M sheriff IT contract and $679K housing grants

The Orange County Board of Supervisors will meet to conduct regular business including votes on contracts, discretionary fund allocations, and grant awards. Items include a $2.6M intelligence analyst services contract for the Sheriff-Coroner and $679,397 in state housing grants for local programs.

budgetcontractshousinglaw-enforcementpublic-workstechnology
Wed Sep 3, 2025

Board of Supervisors Special Meeting

Board of Supervisors to hold Strategic Priorities Workshop

The Board of Supervisors will meet for a special session focused on a workshop regarding Orange County Board Strategic Priorities. No other items are scheduled for decision or discussion.

strategic-planningcounty-administrationworkshop
Tue Aug 26, 2025

Board Meeting Afternoon

Orange County supervisors to vote on multiple contracts and land-use approvals

The Orange County Board of Supervisors will consider approving several contracts, including security services and software maintenance, and will vote on subdivision maps for new housing developments in District 5. The board will also discuss responses to two Grand Jury reports and hear a public hearing on a General Plan Amendment for the Safety Element.

contractshousingpublic-workssafetyzoning
Tue Aug 26, 2025

Board Meeting

Orange County Board considers ordinance restricting Kratom sale and possession

The Board of Supervisors will discuss an ordinance to restrict the sale, distribution, and possession of Kratom. The meeting also includes several high-value contracts for sheriff services and waste management, as well as public hearings on fire hazard zones and the General Plan Safety Element.

public-healthpublic-safetycontractszoningwaste-managementinfrastructure
Tue Aug 12, 2025

Board Meeting Afternoon

Board considers $3 million body camera contract and $4.6 million payment processing renewal

The Orange County Board of Supervisors is meeting to vote on various service contracts, including law enforcement equipment and healthcare provider agreements. The board will also discuss the continuation of a local health emergency for the Trabuco Canyon Airport Fire.

law-enforcementhealthcarepublic-worksbudgetemergency-management
Tue Aug 12, 2025

Board Meeting

Orange County supervisors to vote on $3.02M body-cam contract and $2M fire-camp program

The Orange County Board of Supervisors will meet on August 12, 2025, to consider routine contracts, appointments, and resolutions, including a $3.02 million body-worn camera contract and a $2 million fire-camp inmate program. The meeting also includes consent items like subdivision approvals and donations, as well as discussion items such as health emergency continuations and ambulance service contracts.

body-camerasfire-campcontractshealth-emergencyambulance-services
Tue Jul 15, 2025

Board Special Meeting

Board considers extending local health emergency for Trabuco Canyon Airport Fire

The Orange County Board of Supervisors will discuss the continuation of a local health emergency originally issued on September 20, 2024. This measure is intended to facilitate debris and ash removal and protect water wells in affected areas.

health-careemergency-managementfire-recoverywater-wells
Tue Jun 24, 2025

Board Meeting Afternoon

Orange County Board of Supervisors to review law enforcement and health contracts

The Board of Supervisors is meeting to approve numerous law enforcement service contracts with various cities and the OCTA. The body will also consider mental health service plans and emergency care provider agreements.

law-enforcementpublic-healthcontractsbudgetpublic-works
Tue Jun 24, 2025

Board Meeting

Orange County supervisors to vote on $160M+ in law enforcement and service contracts

The Orange County Board of Supervisors will consider dozens of contracts, appointments, and resolutions at this meeting. Items include law enforcement service agreements with multiple cities totaling over $160 million, workforce development plan approvals, and proclamations for World Refugee Day and Gun Violence Awareness Month.

law-enforcementbudgetcontractsworkforce-developmentpublic-healthappointmentsproclamations
Tue Jun 10, 2025

Board Budget Hearings

Orange County Board of Supervisors to hold public hearing on FY 2025-26 budget

The Board of Supervisors will hold a public hearing to consider the recommended budget for fiscal year 2025-26. The body will also consider an ordinance restricting kratom and the continuation of a local health emergency for the Trabuco Canyon Airport Fire.

budgetpublic-healthordinancegovernment-administration
Tue Jun 10, 2025

Board Budget Hearings_Read Out

Orange County Board of Supervisors to hold public hearing on FY 2025-26 budget

The Board of Supervisors will hold a public hearing to consider the recommended budget for fiscal year 2025-26. The body will also discuss restrictions on kratom and the continuation of a local health emergency.

budgetpublic-healthordinancesgovernment-administrationpublic-safety
Tue May 20, 2025

Board Meeting

Orange County Board of Supervisors to consider $17.2 million helicopter purchase

The Board of Supervisors will meet to discuss various county contracts, public works projects, and health services. Key items include a major aircraft procurement for the Sheriff-Coroner and several multi-million dollar behavioral health contracts.

public-safetyhealthcareinfrastructurecontractsaviation
Tue May 20, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $66M in new contracts and services

The Orange County Board of Supervisors will consider renewing and approving multiple contracts totaling over $66 million for services including mental health, public safety, and infrastructure projects. The meeting also includes proclamations for heritage months and routine administrative actions.

mental-healthpublic-safetycontractsbudgetinfrastructureaging-servicesairportenvironmental-review
Tue May 6, 2025

Board Meeting Read Out

Orange County Board of Supervisors to review health and infrastructure contracts

The Board of Supervisors is deciding on numerous service contracts for behavioral health, public works, and airport maintenance. The meeting also includes the continuation of a local health emergency for the Trabuco Canyon Airport Fire.

health-carebehavioral-healthpublic-worksinfrastructureemergency-managementhousing
Tue May 6, 2025

Board Meeting

Orange County Board of Supervisors to review health and infrastructure contracts

The Board of Supervisors will consider multiple high-value contracts for behavioral health services, airport maintenance, and public works. The meeting includes decisions on emergency health declarations and various board appointments.

healthcarebehavioral-healthinfrastructurepublic-workscontractsaviation
Tue Apr 29, 2025

Special Meeting

Board to submit victim impact statement in federal criminal case

The Orange County Board of Supervisors will meet in a special session to discuss administrative matters. The only discussion item is a request for County Counsel to submit a victim impact statement in a federal criminal case. The meeting also includes closed sessions for a public employee appointment and labor negotiations.

victim-impact-statementfederal-caselabor-negotiationspublic-appointmentadministrative
Tue Apr 22, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $102M airport taxiway contract and $7.1M crisis housing services

The Orange County Board of Supervisors will meet to discuss and vote on multiple contracts, including a $101.999M construction contract for John Wayne Airport taxiway reconstruction and a $7.066M contract for adult crisis residential services. The board will also consider appointments to various county boards and commissions, and receive updates on grants and IT projects.

airportbudgetcontractshealth-servicesinfrastructureappointmentsgrants
Tue Apr 22, 2025

Board Meeting

Orange County supervisors to vote on $102M airport taxiway project and $7.1M mental health contracts

The Orange County Board of Supervisors will meet to vote on major contracts and agreements, including a $101.99 million construction project for John Wayne Airport taxiways and $7.1 million in mental health services contracts. The board will also consider routine appointments, library funding, and public works agreements.

airportmental-healthcontractspublic-workslibraries
Tue Apr 8, 2025

Board Meeting Afternoon

Orange County Board of Supervisors to review health emergency and multi-million dollar contracts

The Board of Supervisors will consider the continuation of a local health emergency for the Trabuco Canyon Airport Fire. The body is also deciding on several high-value healthcare and social service contract renewals and appointments to county councils.

healthcarepublic-healthcontractsemergency-managementhomeless-servicesappointments
Tue Apr 8, 2025

Board Meeting

Orange County Board of Supervisors to review health emergency and multi-million dollar contracts

The Board of Supervisors will consider renewing several high-value health and social service contracts and extending a local health emergency for the Trabuco Canyon Airport Fire. The meeting also includes appointments to county councils and a public hearing on the 2025 Weed Abatement Program.

health-carepublic-safetycontractsemergency-managementappointments
Tue Mar 25, 2025

Board Meeting Afternoon

Orange County Board of Supervisors to consider multiple fee increases

The Board of Supervisors will discuss several service contracts and public hearings regarding fee increases for real estate fraud prosecution and arrest record reviews. The meeting also includes approvals for housing plans and land acquisition for the Coyote Creek Bikeway Project.

feescontractspublic-safetyhousinginfrastructurehealth-care
Tue Mar 25, 2025

Board Meeting

Orange County supervisors to vote on $10M+ in contracts and fee hikes

The Orange County Board of Supervisors will consider approving over $10 million in new and renewed contracts, including janitorial services, utility management, and substance-use treatment. They will also hold public hearings on proposed fee increases for real estate fraud prosecution, fingerprinting services, and local arrest records.

contractsfeespublic-hearingssubstance-use-treatmentjanitorial-services
Tue Mar 11, 2025

Board Meeting Full

Orange County supervisors to vote on $94.8M ERP contract and housing loans

The Orange County Board of Supervisors will meet to decide on major contracts, including a $94.8 million enterprise resource planning system upgrade, and approve loan financing for a senior housing project in Yorba Linda. The board will also discuss emergency declarations, grant awards, and policy changes such as a temporary moratorium on battery energy storage permits.

budgethousingcontractshealthtechnologyemergency-serviceszoning
Tue Feb 25, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $48M drug treatment contracts and $12M housing grants

The Orange County Board of Supervisors will meet to act on multiple contracts, leases, and policy updates across departments. Items include renewing $48 million in drug treatment service contracts, approving a $12 million supportive housing funding notice, and adopting a 2025 weed abatement program. The board will also consider easement exchanges with Stanton and lease agreements for library and recreation facilities.

budgetcontractshousingpublic-workshealth-servicesweed-abatementeasementslegislation
Tue Feb 25, 2025

Board Meeting

Board considers $48 million for narcotic replacement therapy services

The Orange County Board of Supervisors will discuss several high-value healthcare and security contracts, including funding for supportive housing in Brea. The board is also reviewing legislative priorities for 2025 and updates to campaign contribution limits.

healthcarehousingcontractscampaign-financepublic-works
Tue Feb 11, 2025

Board Meeting Afternoon

Orange County supervisors to vote on $7.6M housing plan and health ordinance

The Orange County Board of Supervisors will consider renewing a local health emergency for the Airport Fire, approving a $7.6 million housing grant application, and adopting an ordinance to create a new Health Authority. They will also vote on multiple contracts totaling over $10 million for services including housing advocacy, corrections care coordination, and environmental cleanup.

housinghealthcontractsemergency-managementenvironment
Tue Feb 11, 2025

Board Meeting

Orange County Board considers 6th Cycle Housing Element and Safety Element amendments

The Board of Supervisors will hold public hearings on General Plan amendments for housing and safety. The meeting also includes decisions on emergency extensions for the Airport Fire and various service contracts.

housingpublic-safetyemergency-managementcontractsgrantszoning
Tue Jan 28, 2025

Board Meeting Afternoon

Board considers moratorium on large scale battery energy storage systems

The Orange County Board of Supervisors will discuss a mid-year budget report and a potential moratorium on large scale battery energy storage systems. The body is also reviewing multiple service contracts and housing loan agreements.

budgetenergyhousinghealthcarepublic-works
Tue Jan 28, 2025

Board Meeting

Orange County supervisors to vote on homelessness policy and major contracts

The Orange County Board of Supervisors will decide on homelessness programs, approve multi-year service contracts worth millions, and consider a temporary ban on large-scale battery storage systems. The meeting also includes routine administrative updates and continued items from prior agendas.

budgetcontractshomelessnesshousingland-usepublic-healthutilities
Tue Jan 14, 2025

Board Meeting

Board to vote on $165M bond for Rienda 3 community facilities district

The Orange County Board of Supervisors will hold a public hearing on a proposal to establish Community Facilities District No. 2025-1 (Rienda 3) in District 5, including a $165 million bond issuance for infrastructure and a special tax election. The board will also consider a $160 million eminent domain resolution for the Coyote Creek Bikeway Project in District 4, requiring a two-thirds vote.

bondseminent-domaininfrastructurelaw-enforcementparkspublic-workstaxestransportation
Tue Jan 14, 2025

Board Meeting Read Out

Orange County supervisors to vote on $165 million Rienda 3 bond and bikeway eminent domain

The Orange County Board of Supervisors will meet to decide on a $165 million bond for the Rienda 3 Community Facilities District and hold a public hearing on eminent domain for the Coyote Creek Bikeway Project. They will also vote on contracts totaling over $13 million for IT, security, and construction services, and consider renewing health and social services agreements.

bondseminent-domaincontractspublic-healthinfrastructurelaw-enforcementparksutilities