The Boring PartsFederalLocal · USLocal · Canada
White Plains, NY

White Plains public meetings in 2024

130 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Fri Dec 20, 2024

White Plains Urban Renewal Agency

White Plains Urban Renewal Agency to vote on lease termination agreement with One Source Homecare Supplies

The Urban Renewal Agency will hold a special meeting to consider a resolution authorizing a lease termination agreement with One Source Homecare Supplies, Inc. The board will also approve minutes from the October 23, 2024 meeting and handle any other business.

urban-renewallease-terminationwhite-plainsagency-meeting
✓ Decided: Agency approves lease termination with One Source Homecare Supplies

The White Plains Urban Renewal Agency approved a lease termination agreement with One Source Homecare Supplies, Inc., allowing the tenant until February 28, 2025, to vacate 42-44 East Post Road. The agency took title to the property on December 19, 2024. The tenant's pharmacy and medical supply businesses will relocate to other locations in White Plains.

Fri Dec 20, 2024

White Plains Urban Renewal Agency

Agency approves NEPA determination for parking garage land acquisition

The White Plains Urban Renewal Agency approved a resolution making a NEPA determination to acquire property from the White Plains Housing Authority for a public parking garage. They also reaffirmed their mission statement and approved the 2023–2024 annual report. Separately, the board authorized a lease termination agreement with One Source Homecare Supplies, Inc. at 42-44 East Post Road, allowing the tenant to remain until February 28, 2025.

urban-renewalparkinghousingenvironmental-reviewannual-reportleasereal-estate
Thu Dec 19, 2024

Agenda

Council adopts ordinance for Hamilton Green PILOT release

The Common Council is holding a special meeting to adopt an ordinance authorizing a partial release of mortgage and amendments to the PILOT agreement for properties at 220 Hamilton Avenue and 20 Barker Avenue, part of the Hamilton Green project. The ordinance was adopted by a 7-0 vote. The council also hears a presentation from the Hindu Temple of Tri-state regarding property at 390 North Street.

pilotsdevelopmenthousingtax-agreementsreligious-institutionwhite-plains
✓ Decided: Council approves release of NYPA parcel from Hamilton Green PILOT mortgage

The Common Council adopted an ordinance authorizing the Mayor to execute documents that release the 220 Hamilton Avenue lot from the existing PILOT mortgage and agreement, as part of the Hamilton Green development. The release facilitates the sale of that parcel to the New York Power Authority, while the PILOT payments continue to be secured by the remaining lots. The ordinance was adopted by a 7-0 vote.

Thu Dec 19, 2024

Agenda

Common Council to vote on NYPA lot release from Hamilton Green PILOT mortgage

The Common Council will consider an ordinance authorizing the partial release of a lot at 220 Hamilton Avenue from a payment-in-lieu-of-taxes (PILOT) mortgage to facilitate the New York Power Authority's headquarters. They will also hear a presentation on the proposed Hindu Temple of Tri-State at 390 North Street. The meeting is called to meet a December 20 deadline tied to federal Inflation Reduction Act benefits.

common-councilspecial-meetingpilot-agreementhamilton-greennew-york-power-authorityhindu-templewhite-plainsdevelopment
Tue Dec 17, 2024

Transportation Commission

Transportation Commission to review parking and traffic requests

The Transportation Commission will discuss several resident requests regarding parking restrictions and traffic safety. Staff have provided recommendations on whether to install new signage or crosswalks at specific intersections.

parkingtraffic-safetyzoningroads
✓ Decided: Commission recommends loading zone on Davis Avenue for 170 Maple Ave

The Transportation Commission approved staff recommendations to deny a 'No Turn on Red' at North Street and Ridgeway and to deny a crosswalk at Walworth Terrace and Quinby Avenue. It also recommended a temporary loading zone on the east side of Davis Avenue south of Maple Avenue for 170 Maple Avenue, and approved polling residents about removing a parking restriction on Gedney Way.

Tue Dec 17, 2024

Planning Board

Planning Board continues Galleria rezoning, recommends temple plan

The Planning Board adopted October meeting minutes and scheduled a public hearing for January 21, 2025 on a site plan amendment for an expanded patio at 11 Middle Road. The board also recommended approval of a site plan amendment for the Hindu Temple of Tri-State at 390 North Street. Additionally, the board continued to January 21 consideration of the District Galleria's DEIS and proposed zoning map amendment to create a TD-2 Transit Development district at 100 Main Street. Other items included extension of a subdivision approval and a special permit amendment.

zoningplanning-boardpublic-hearingsite-planrezoningsubdivisiontemple
Tue Dec 17, 2024

Planning Board

Board to consider new TD-2 zoning district and rezoning of 100 Main Street

The Planning Board will schedule a public hearing for a patio expansion at 11 Middle Road, review a site plan amendment for the Hindu Temple of Tri-State at 390 North Street, and discuss a petition to create a new Transit Development-2 (TD-2) zoning district and rezone 100 Main Street for District Galleria. Adjourned items from prior meetings are also noted.

zoningplanning-boardpublic-hearingsite-plansubdivisionzoning-amendmentdevelopmenthousing
Mon Dec 16, 2024

Conservation Board

Conservation Board reviews zoning amendment for District Galleria

The Conservation Board is meeting to review referrals from the Common Council and Planning Board. The board will consider a new referral regarding a zoning ordinance amendment for the District Galleria at 100 Main Street.

zoningenvironmentland-usesite-plan
Mon Dec 16, 2024

Historic Preservation Commission

Commission to hear request for 18-month extension of Certificate of Appropriateness for 52 North Broadway

The Historic Preservation Commission will hold a public hearing on an application by WP Development NB LLC for an 18-month extension of the Certificate of Appropriateness granted in 2021 for the redevelopment of the Good Counsel Campus at 52 North Broadway. The applicant cites financial market challenges and project complexity as reasons for the extension; no changes to the approved plans are proposed. The commission previously granted a prior 18-month extension in 2023.

historic-preservationcertificate-of-appropriatenessgood-counsel-campuswhite-plainsredevelopmentpublic-hearinglandmarks
Thu Dec 12, 2024

Capital Projects Board

Capital Projects Board to review 2025-2031 Capital Improvement Program requests

The Capital Projects Board is meeting to review funding requests for the 2025-2031 Capital Improvement Program. These requests originate from several city departments and utility funds.

budgetcapital-improvementsinfrastructurecity-planning
Wed Dec 11, 2024

Agenda

Design Review Board considers special use permit for Dish Wireless public utility antenna

The Design Review Board is reviewing multiple resubmitted and new applications for signage, awnings, and a special use permit for a public utility antenna facility. Items include sign changes for retail stores, restaurants, a gas station canopy, and rebranding of a gas station from BP to Exxon.

design-reviewsignagespecial-use-permitpublic-utility-antennagas-stationrebrandingwhite-plains
✓ Decided: Design Review Board approves three sign applications, adjourns one

The Design Review Board approved three sign applications with conditions, including eliminating perimeter canopy down lighting for the Exxon rebranding and requiring opaque backgrounds for illuminated signs. One application for Porsche Pepe was not reviewed because the applicant requested an adjournment.

Wed Dec 4, 2024

Agenda

Board of Appeals to review zoning variances and energy facility interpretation

The Board of Appeals is reviewing several applications for area variances regarding residential additions, pools, and a Buddhist Temple. The board will also consider an appeal regarding whether a Battery Energy Storage Facility is a permitted use in the city.

zoningvariancesenergyhousingland-use
Mon Dec 2, 2024

Agenda

Council approves $4.75M grant for 108 affordable condos at 99 Church St

The Common Council voted 7-0 on multiple items, including a $4,752,000 grant for 108 affordable condominiums at 99 Church Street and 6 Cottage Place, and authorized a new Transit Development-2 (TD-2) District public hearing for January 6, 2025. Other adopted measures include a school bus stop-arm camera enforcement program, litigation authorization, and various grants and donations. Items on sidewalk maintenance (TABLED) and proposed Charter amendment (WITHDRAWN) were not voted on.

affordable-housingzoningbudgetlitigationpublic-safetyyouth-programsplanning
Mon Dec 2, 2024

Agenda

Council approves $4.75M grant for 108 affordable condos at 99 Church Street

The Common Council held a regular meeting on December 2, 2024, voting on numerous ordinances and resolutions. Key actions include approving a $4,752,000 affordable housing grant for 108 condominium units at 99 Church Street and 6 Cottage Place, advancing a zoning amendment for a new Transit Development-2 district (with a public hearing scheduled for January 6, 2025), and approving the amended site plan for the Hamilton Green mixed-use project at 200 Hamilton Avenue. Several other items were adopted, including contracts for school bus camera enforcement, special counsel, and various grants and donations.

affordable-housingzoningsite-planbudgetpublic-safetyyouth-programstransportation
Mon Dec 2, 2024

Agenda

Common Council to consider charter amendment tightening lawsuit notice requirements

The Common Council will consider a local law amending the city charter to formalize notice-of-claim requirements for lawsuits, shifting more liability for sidewalk defects to property owners. Other items include a $125,000 capital project for citywide IT infrastructure replacement, authorization to sue the Town of Carmel for $24,595.65 in police training reimbursement, renewal of legislative affairs special counsel at $44,000, and an ordinance updating FOIL procedures for employee disciplinary records.

charter-amendmentliabilitynotice-of-claimsidewalk-maintenancecapital-projectit-infrastructurelitigationpolice-training
Mon Nov 25, 2024

Agenda

Council considers affordable housing funds for 99 Church St

The Common Council will discuss an application for funds from the Affordable Housing Assistance Fund for a project at 99 Church Street. They will also consider proposed contracts with BusPatrol America LLC for a school bus stop-arm camera enforcement program and a proposed amendment to the Municipal Code regarding sidewalk maintenance. A motion to enter executive session for a potential employment matter is also on the agenda.

affordable-housingschool-bus-safetytraffic-enforcementsidewalk-maintenancecode-amendmentexecutive-sessioncouncil-meeting
Mon Nov 25, 2024

Agenda

Council considers $4.75M grant for 108 affordable condos at 97-109 Church Street

The Common Council will hold a special meeting to consider a $4,752,000 grant from the Affordable Housing Assistance Fund for 108 affordable condominiums at 97-109 Church Street. It will also weigh a contract with BusPatrol America LLC for a school bus stop-arm camera enforcement program, an amendment to sidewalk maintenance rules, and a closed session on potential employment.

affordable-housinggrantschool-safetyenforcementsidewalkscode-amendmentexecutive-sessioncommon-council
Thu Nov 21, 2024

Recreation & Advisory Committee

Recreation Advisory Committee to discuss capital plan and park improvements

The committee is meeting to review staff reports and discuss ongoing projects including park paving and playground equipment. The body will also address the 2025 capital plan submission and upcoming seasonal programming.

parksrecreationcapital-plancommunity-centerpublic-facilities
Tue Nov 19, 2024

Transportation Commission

Commission to discuss 'No Stopping Any Time' on Hamilton Avenue and other traffic requests

The Transportation Commission will review staff recommendations on several traffic safety and parking items, including a proposal to impose 'No Stopping Any Time' restrictions on Hamilton Avenue between North Broadway and Dr. Martin Luther King Jr. Boulevard, with exceptions for meters and bus stops. Other items include requests for a crosswalk at Walworth Terrace and Quinby Avenue, all-way stops at two intersections that staff evaluated as not meeting federal warrants, and a proposal to add two-hour meter parking on downtown streets. The agenda also includes a referral for an amended site plan at 390 North Street for a Hindu Temple expansion, to which staff has no objection.

transportationtrafficparkingpedestrian-safetycrosswalksall-way-stopsland-use
Tue Nov 19, 2024

Planning Board

White Plains Planning Board meeting canceled for November 19

This Planning Board meeting was canceled. The next regular meeting is scheduled for December 17, 2024. Items on the agenda—including a 106-lot subdivision at 336-400 Ridgeway and a special permit amendment for Dish Wireless—were not taken up.

cancelledplanning-boardwhite-plains
Mon Nov 18, 2024

Conservation Board

Conservation Board meeting cancelled for November 18, 2024

The White Plains Conservation Board meeting scheduled for November 18, 2024, has been cancelled. The next regular meeting will be held on December 16, 2024.

meeting-cancelledconservation-board
Wed Nov 13, 2024

Agenda

Design Review Board to consider Hamilton Green mixed-use redevelopment

The White Plains Design Review Board will review multiple applications, including a resubmitted mixed-use redevelopment at 200 Hamilton Ave (Hamilton Green), a special use permit for a Dish Wireless public utility antenna facility at 59-65 Old Mamaroneck Rd, and numerous signage and canopy installations. Other items include an amended site plan for the Hindu Temple of Tri-State at 390 North Street and a new canopy at Royal Petroleum on So Lexington Ave.

design-reviewsignagemixed-usespecial-use-permitsite-planredevelopmentwhite-plains
Wed Nov 6, 2024

Agenda

Buddhist temple, battery storage appeal, multiple variances on White Plains zoning agenda

The Board of Appeals Zoning will hear several applications including a proposed Buddhist temple at 1 Sycamore Lane (adjourned to Dec. 4), an appeal of building department determinations on that project, an interpretation of whether a battery energy storage facility is a utility, a conversion of a home at 1 Fairview Avenue to two-family, and multiple variance extensions and new construction requests.

zoningboard-of-appealsvariancesbuddhist-templewetlandsappealsbattery-storageconversions
Mon Nov 4, 2024

Agenda

Common Council reviews Draft Environmental Impact Statement for District Galleria project

The Common Council is reviewing the Draft Environmental Impact Statement (DEIS) for the District Galleria project at 100 Main Street. The proposal includes rezoning the site to TD-2 and a large-scale redevelopment. The Council may accept the DEIS and schedule a public hearing for comments.

zoningenvironmental-impact-statementgalleria-projectdowntown-redevelopmentwhite-plainscommon-council
Mon Nov 4, 2024

Agenda

City approves property acquisition at 42-44 East Post Road

The Common Council decided on several property acquisitions, affordable housing grants, and infrastructure projects. The body also voted on zoning amendments and legal settlements.

zoningaffordable-housingurban-renewalinfrastructuregrants
Mon Nov 4, 2024

Agenda

Common Council to consider purchase of 42-44 East Post Road for parking garage

The Common Council will hold a public hearing to authorize the Urban Renewal Agency to acquire 42-44 East Post Road. The property is intended for a future multi-level public parking garage to support White Plains Hospital and the White Plains Housing Authority.

land-acquisitionparkingurban-renewalbondsinfrastructure
Mon Oct 28, 2024

Agenda

Council to discuss site plans and sidewalk liability law

The Common Council will discuss site plan proposals for 60 S. Broadway and 290 Ferris Avenue. The body will also review a local law regarding sidewalk defect liability and a funding application for affordable housing.

zoninghousinginfrastructurelocal-lawenvironmental-impact
Mon Oct 28, 2024

Agenda

Council to vote on sidewalk liability law, $500K affordable housing grant

The Common Council will consider a $500,000 grant from the Affordable Housing Assistance Fund for a 12-unit affordable housing development at 60 South Kensico Avenue, and will hold a public hearing on a proposed local law that would make property owners liable for injuries or damages from failure to maintain adjacent sidewalks and curbs, removing city liability.

affordable-housingsidewalksliabilitypublic-hearinggrantshousing-developmentproperty-owners
Wed Oct 23, 2024

White Plains Urban Renewal Agency

Agency to consider NEPA determination for parking garage land acquisition

The White Plains Urban Renewal Agency will hold a special meeting to consider two action items: Resolution 10-2024, which makes a determination under the National Environmental Policy Act (NEPA) regarding the acquisition of property from the White Plains Housing Authority to construct a public parking garage, and Resolution 11-2024, which reaffirms the agency's mission statement and performance measures and approves the annual report. The meeting also includes roll call and approval of minutes from the previous meeting.

urban-renewalwhite-plainsparking-garagehousing-authoritynepaenvironmental-reviewannual-reportmission-statement
Mon Oct 21, 2024

Conservation Board

October 21 Conservation Board meeting cancelled

The Conservation Board meeting scheduled for October 21, 2024, has been cancelled. The next meeting is scheduled for November 18, 2024.

conservation-boardmeeting-cancellationwhite-plains
Wed Oct 16, 2024

Agenda

Design Review Board to consider Hamilton Green mixed-use redevelopment

The Design Review Board will review several resubmitted and new applications for signage, facade changes, awnings, and mechanical equipment. Notable items include a special use permit for a Dish Wireless antenna facility, a mixed-use redevelopment at Hamilton Green, and a one-year extension for a residential development at 1 Water Street. Most items are design-related approvals.

design-reviewsignagespecial-use-permitmixed-useresidential-developmentwhite-plains
Tue Oct 15, 2024

Transportation Commission

White Plains Transportation Commission reviews traffic restrictions and site plan amendments

The White Plains Transportation Commission will meet to approve minutes from the previous meeting and discuss several traffic-related requests. Items include evaluating parking restrictions on Ferris Avenue, reviewing sight lines at multiple locations, and considering amendments to site plans for major developments like Hamilton Green and 1 Water Street.

zoningtraffic-safetyparkingsite-planmixed-use-development
Tue Oct 15, 2024

Planning Board

Planning Board to weigh converting 260-unit apartment to office for NY Power Authority, plus affordable condos

The White Plains Planning Board will hold public hearings on a special permit for a Chick-fil-A parking lot and an eligible facility upgrade for Dish Wireless. Other items include a site plan amendment for Hamilton Green, which would convert a 260-unit apartment building to a 297,105-square-foot office for the New York Power Authority and convert 20 Barker Avenue from 130 rental units to 156 affordable condominiums. The board will also consider a fifth one-year extension for a two-lot subdivision at 60 South Broadway and a one-year extension for a 301-unit apartment building at 1 Water Street. A previously adjourned 106-lot subdivision at Farrell Estates is also on the agenda.

planning-boardzoningspecial-permitsite-plan-amendmenthousingoffice-conversionaffordable-housingsubdivision
Wed Oct 9, 2024

Agenda

Board to decide on Buddhist Temple and height extension for 60 South Broadway

The White Plains Board of Appeals Zoning is reviewing seven variance applications. Key items include a proposed Buddhist Temple at 1 Sycamore Lane requiring multiple area variances and a wetlands buffer encroachment, and a one-year extension for a 302.5-foot building height at 60 South Broadway. The board will also consider residential additions, a porch reconstruction, and a conversion application, plus an appeal of the building department's determination regarding the temple.

zoningboard-of-appealsvariancesreligiousresidentialenvironmentalheight-extension
Mon Oct 7, 2024

White Plains Urban Renewal Agency

Agency to consider acquiring 42-44 East Post Road and issuing $6.6M in bonds

The White Plains Urban Renewal Agency is holding a special meeting to vote on three resolutions: a SEQRA negative declaration for acquiring 42-44 East Post Road, authorization to acquire that property, and issuance of up to $6.6 million in bonds for the East Post Road Urban Renewal Project, which includes a future public parking garage.

urban-renewalproperty-acquisitionbondsparking-garageseqrawhite-plains
Mon Oct 7, 2024

Agenda

Council to vote on $200K accessible playground and $356K ADA ramps

The Common Council will consider ordinances authorizing contracts and budget amendments for two capital projects: adding wheelchair-accessible playground equipment at Delfino Park (total cost $200,000) and designing/constructing ADA-compliant sidewalk ramps along Greenridge Avenue ($356,250, mostly state-funded). It will also vote on a settlement of tax review proceedings for five properties.

capital-projectsparksplaygroundaccessibilitysidewalkspedestrian-safetytax-settlementbudget
Mon Oct 7, 2024

Agenda

Public hearing for parking lot on environmentally sensitive site at 290 Ferris Ave

The Common Council held a public hearing for a proposed parking lot at 290 Ferris Avenue on an environmentally sensitive site. The Council then adopted numerous ordinances and resolutions, including approvals for capital projects, traffic changes, grant acceptances, and development projects such as the adaptive reuse of Church Street buildings and an extension for Haarlem Avenue development.

city-councilpublic-hearingzoningdevelopmenttrafficgrantsurban-renewalenvironmentally-sensitive-site
Mon Sep 30, 2024

Agenda

Council discusses park playground, sidewalk fees, stop signs, and developments

The White Plains Common Council holds a special meeting to discuss capital projects including Delfino Park playground and Greenridge pedestrian ramps, proposed amendments to sidewalk permit fees and deposits (Municipal Code 7-3-25), and a traffic ordinance change for stop signs on Sammis Lane. Presentations cover a proposed amendment for the Hamilton Green development at 200 Hamilton Avenue and a site plan at 23-29 Quarropas Street and 112-122 Court Street. No votes are scheduled; items are for discussion only.

capital-projectsplaygroundsidewalksfeestrafficstop-signsdevelopmenthamilton-green
✓ Decided: Council discusses capital projects, sidewalk fees, and major developments

The Common Council held a special meeting to discuss capital projects, including Delfino Park playground equipment and Greenridge pedestrian ramps, and considered amendments to sidewalk permit fees. They also heard presentations on the Hamilton Green and Court Street Residences developments, but no formal votes were recorded in the minutes.

Mon Sep 30, 2024

Agenda

Council to consider time extension for 814-unit development at 60 South Broadway

The Common Council is reviewing a request from Quarterra (Maple and Broadway Holdings LLC) for a one-year extension of the amended site plan approval for a large mixed-use project at 60 South Broadway. The project includes 814 multifamily units (6% affordable), 29,014 square feet of retail, and 957 parking spaces in two phases. Previous extensions have been granted, and a prior extension from March 2023 remains pending.

zoningsite-plantime-extensionhousingdevelopmentwhite-plains60-south-broadwayquarterra
Tue Sep 24, 2024

Capital Projects Board

Board to consider funding increases for park equipment and pedestrian ramps

The Capital Projects Board will review two amendments to the FY 24-25 Capital Improvement Program. These proposals involve increasing the budget for playground equipment and adding a new project for pedestrian ramps.

capital-improvementparksinfrastructuregrantspedestrian-safety
Thu Sep 19, 2024

Recreation & Advisory Committee

Recreation Advisory Committee to discuss playground, teen programs, and fall events

The Recreation Advisory Committee will meet to review old business including updates on Battle Hill Park Playground and the WE-GO Swing at Delfino Park, and discuss new business such as fall registration and teen programming. The committee will also receive a list of upcoming city events from September through November.

recreationparksplaygroundeventsyouth-programswhite-plains
Tue Sep 17, 2024

Planning Board

Planning Board to hold public hearing for Chick-fil-A parking lot

The Planning Board will conduct a public hearing regarding a special permit for a commercial parking lot at 20 Tarrytown Road. The board will also review several special permit amendments for wireless facility upgrades and site plan amendments for various city properties.

zoningparkingtelecommunicationssite-plancommercial-development
✓ Decided: Planning Board approves four wireless facility upgrades, advances mixed-use projects

The White Plains Planning Board approved four special permit amendments for wireless facility upgrades (AT&T at 78 North Broadway, 950 Mamaroneck Avenue, 456 North Street; Dish Wireless at 59-65 Old Mamaroneck Road), each subject to DPW and Building Department approval. The board also voted unanimously to send letters of no objection to the Common Council for several site plan amendments, including Adora Row (increasing units from 276 to 334), the adaptive reuse project at 97-109 Church Street and 6 Cottage Place (changing 55 rental units to 40 affordable condos), a 24-space parking lot at 290 Ferris Avenue, and a one-year extension for 20 Haarlem Avenue. A public hearing for a Chick-fil-A commercial parking lot at 20 Tarrytown Road was adjourned to October 15, 2024, as the applicant was not present.

Tue Sep 17, 2024

Transportation Commission

Commission to review site plan referrals and parking issues, including Church St affordable condos

The Transportation Commission will discuss parking and traffic requests, including a review of McKinley Avenue parking restrictions, sight lines at Ridgeway and Hazelton, and a 'No Turn on Red' at North Street and Ridgeway. They will also consider three Common Council referrals: an amended site plan for a mixed-use project at 80 Westchester Avenue, a conversion to affordable condos at 97-109 Church Street, and a site plan extension at 20 Haarlem Avenue. The Ferris Avenue parking study remains on hold.

transportationparkingtraffic-safetysite-planaffordable-housingcrosswalks
✓ Decided: Commission approves parking, sight-line, and traffic recommendations

The Transportation Commission approved staff recommendations on several items, including parking changes on McKinley and Whitney Streets, sight-line corrections on Ridgeway and Hazelton, no new crosswalks on Ridgeway, and a 'No Turn on Red' for North Street at Ridgeway. It also approved site plan amendments for developments at 80 Westchester Avenue, 97-109 Church Street, and 20 Haarlem Avenue. All votes were unanimous.

Mon Sep 16, 2024

Conservation Board

Conservation Board meeting for Sept 16, 2024 cancelled

The Conservation Board meeting scheduled for September 16, 2024, has been cancelled. The next meeting is scheduled for October 21, 2024.

meeting-cancelledconservation-board
Mon Sep 9, 2024

Agenda

Design Review Board to decide on sign installations and site plan amendments

The White Plains Design Review Board is considering multiple applications for signage, facade changes, and site plan amendments at its September 9, 2024 meeting. Items include new and resubmitted requests for wall signs, awnings, and building renovations. Several proposals seek amendments or extensions to previously approved site plans for adaptive reuse and redevelopment projects.

design-reviewsignagesite-planamendmentsadaptive-reusedevelopment
✓ Decided: Design Review Board approves multiple signage and exterior projects

The White Plains Design Review Board approved several signage and exterior renovation applications, including The Shoppe, Mobil/Chestnut Market, Webster Bank, 1200 Mamaroneck Ave, and Purple Owl, with conditions such as no visible wires and separate electrical permits. It did not review El Primo (removed from agenda until applicant requests reinstatement) and The Private Shop (applicant absent). It denied signage and awnings for Frankie & Anthony's and Tous Les Jours Bakery, requiring resubmissions. It also reviewed site plan amendments for WEP Development and Adora Row, recommending approval for the latter.

Wed Sep 4, 2024

Agenda

Board of Appeals to review zoning variances for Buddhist Temple and residential additions

The Board of Appeals is reviewing several applications for zoning variances and extensions. Key items include the conversion of a property into a Buddhist Temple and various residential additions and structures.

zoningvarianceshousingreligious-facilitieswetlands
✓ Decided: Board grants 3 area variances, extends solar carport variance

The White Plains Board of Appeals Zoning granted area variances for a two-family conversion at 106 Robertson Avenue, a pergola at 11 Topland Road, and a front yard addition at 696 Mamaroneck Avenue. It also granted a one-year extension for a solar carport variance at Memorial United Methodist Church. Two applications were adjourned, and four new applications were scheduled for hearing on October 9, 2024.

Tue Sep 3, 2024

Agenda

Council adopts local law amending room occupancy tax residency rules

The White Plains Common Council held a regular meeting on September 3, 2024, adopting several ordinances including Local Law No. 2 of 2024 amending permanent residency provisions for the room occupancy tax. They also approved a site plan amendment for Saber-North at 70 Westchester Avenue, authorized agreements for energy management and environmental review of the former Ridgeway Country Club, and set a public hearing for a parking lot at 290 Ferris Avenue. Multiple items were referred to city boards and departments for further review.

local-lawroom-occupancy-taxzoningdevelopment70-westchester-avenueridgeway-country-clubyouth-bureaugrants
Tue Sep 3, 2024

Agenda

Council to consider lowering threshold for hotel occupancy tax exemption to 30 days

The Common Council will consider a local law that reduces the number of consecutive days qualifying as a permanent resident for the room occupancy tax from 90 to 30, exempting those stays. The Council will also vote on a reappointment to the Board of Assessment Review and a site plan amendment for a 203-unit mixed-use development at 70 Westchester Avenue, which adds 28 units and replaces motor vehicle and restaurant uses with retail and office space.

local-lawzoninghousingdevelopmenthotel-taxoccupancy-taxplanning
Tue Aug 27, 2024

Planning Board

Planning Board recommends unit increase for 70 Westchester Avenue project

The Planning Board reviewed several site plan applications and extensions for residential and commercial properties. The board recommended approval for a project at 70 Westchester Avenue to increase dwelling units from 175 to 203. It also adopted a resolution for fees regarding the redevelopment of 400 Ridgeway.

zoninghousingsite-planparkingland-use
Mon Aug 26, 2024

White Plains Urban Renewal Agency

URA to vote on condemning 42-44 East Post Road for parking garage

The White Plains Urban Renewal Agency will hold a special meeting on August 26, 2024 to consider a single action item: a resolution to commence condemnation (eminent domain) proceedings to acquire the property at 42-44 East Post Road. This acquisition is part of a larger plan to build a multi-level public parking garage to serve the area, including White Plains Hospital and Brookfield Commons. The agenda also includes approval of minutes from the April 30, 2024 meeting and other business.

urban-renewaleminent-domainparkingeast-post-roadcondemnationmunicipal-garagewhite-plains
Mon Aug 26, 2024

Agenda

Council reviews site plans

The Common Council of White Plains, New York, is holding a special meeting to discuss and review proposed site plan amendments for properties located at 97-109 Church Street, 70 Westchester Avenue, and 80 Westchester Avenue, as well as a presentation on the Vision Zero Action Plan.

zoningdevelopmentinfrastructuretransportation
Mon Aug 26, 2024

Agenda

Council to consider 108 affordable housing units in Church St adaptive reuse

The White Plains Common Council will hold a special meeting to hear presentations on the Vision Zero Action Plan and three site plan amendments. These include a proposal to convert 97-109 Church Street into 108 affordable for-sale units, an amended site plan and special permit for 70 Westchester Avenue, and a site plan amendment for 80 Westchester Avenue.

vision-zeroaffordable-housingsite-plan-amendmentdevelopmentwhite-plainscommon-council
Tue Aug 20, 2024

Transportation Commission

Commission to vote on stop signs at 10 intersections and all-way stop near school

The Transportation Commission will discuss and vote on staff recommendations for new stop signs at multiple intersections, an all-way stop at Prescott Avenue and Greenridge Avenue near a school, and a 15-minute metered parking change at 55 Church Street. Referrals for commercial parking lots at 2-18 Tarrytown Road (Chick-fil-A), 70 Westchester Avenue, and 290 Ferris Avenue will also be reviewed. Old business on Ferris Avenue parking restrictions remains held pending further study.

transportationtraffic-safetyparkingstop-signsschool-safetycity-planning
Mon Aug 19, 2024

Conservation Board

Conservation Board reviews site plans for environmentally sensitive areas

The Conservation Board is reviewing site plan applications and amendments for projects located on environmentally sensitive sites. The board will also discuss updates to the One White Plains Comprehensive Plan adopted on June 3, 2024.

environmentsite-planzoningparkingcomprehensive-plan
Wed Aug 14, 2024

Agenda

Common Council to amend street closure ordinance for rescheduled National Night Out

The Common Council will consider an ordinance to amend a previously approved street closure ordinance, changing the date of the National Night Out event from August 6 to August 21, 2024, due to inclement weather. The amendment authorizes the closure of South Lexington Avenue between Martine Avenue and Quarropas Street from noon to 11 p.m., with one emergency lane open.

eventsstreet-closurespublic-safetyordinances
Wed Aug 14, 2024

Agenda

Council adopts ordinance amending street closures for 2024 events

The Common Council held a special meeting on August 14, 2024, to consider an amendment to an ordinance authorizing the closure of certain public streets for 2024 events and celebrations. The council adopted the amended ordinance by a vote of 5-0.

streetsclosureseventsordinancespublic-workscouncilwhite-plains
Mon Aug 12, 2024

Agenda

Design Review Board to consider parking lot and temple conversion requests

The Design Review Board is reviewing several applications for signage, awnings, and exterior renovations. The meeting includes requests for site plan approvals and area variances for specific property uses.

zoningsite-plansignageparkingland-use
Wed Aug 7, 2024

Agenda

Five zoning variance hearings set for Sept. 4, including Buddhist temple and height extension

The White Plains Board of Appeals Zoning has no meeting in August 2024. Instead, it has scheduled public appearances for September 4, 2024, to consider five variance applications, including a height extension at 60 South Broadway, a two-family conversion at 106 Robertson Avenue, a pergola at 11 Topland Road, a front-yard addition at 696 Mamaroneck Avenue, and a Buddhist temple construction at 1 Sycamore Lane.

zoningvariancesboard-of-appealswhite-plainspublic-hearing
Mon Aug 5, 2024

Agenda

White Plains Council approves $6.97M for water supply system improvements

The Common Council approved several capital projects, including water line reconstruction and fire station repairs. The body also granted site plan amendments for developments at 161 South Lexington Avenue, 250 Mamaroneck Avenue, and the White Plains Hospital Center.

infrastructurebondszoningpublic-workshealthcarehousing
Mon Aug 5, 2024

Agenda

Council to vote on appointing Nikki Josephs to Library Board

The Common Council will consider the appointment of Nikki L. Josephs, Ph.D. to the Library Board of Trustees for a term ending December 31, 2024. No other items are on the agenda.

appointmentslibrary-boardcommon-councilwhite-plains
Tue Jul 16, 2024

Planning Board

Planning Board approves Brookfield Commons extension and Juliette amendment

The Planning Board approved a one-year extension for the 174-unit Brookfield Commons apartment building and a site plan amendment for The Juliette to adjust retail and unit counts. They scheduled a public hearing for a parking lot at 123 North Kensico Avenue and adjourned three other public hearings to August 27, 2024. The meeting also included adoption of prior minutes.

planning-boardsite-planzoningpublic-hearingsapartmentsparkingcommercial
Tue Jul 16, 2024

Transportation Commission

Transportation Commission to review parking changes and site plan extensions

The Transportation Commission is meeting to discuss parking restrictions on Doyer Avenue and requests for all-way stops at several intersections. The body will also consider site plan extensions and amendments for projects on South Lexington Avenue and Mamaroneck Avenue.

parkingzoningtraffic-safetysite-plansroads
Mon Jul 15, 2024

Conservation Board

July 15 Conservation Board meeting cancelled

The Conservation Board meeting scheduled for July 15, 2024, has been cancelled. The next meeting is scheduled for August 19, 2024.

conservation-boardcancelledwhite-plains
Wed Jul 10, 2024

Agenda

Board reviews building height extension for 60 South Broadway

The Board is reviewing applications for property modifications including home additions, pool construction, and garage reconstruction. Some items also request extensions for existing building height and lot area resolutions.

zoningresidentialproperty-developmentwhite-plains
Mon Jul 8, 2024

Agenda

White Plains Design Review Board to review site plan amendments and new signage

The Design Review Board will consider several applications for building signage, facade updates, and site plan changes. This includes a request for an extension of the site plan and special permit approvals for Brookfield Commons Phase 3.

zoningsignagedevelopmentwhite-plainsbusiness
Mon Jul 1, 2024

Agenda

Proposed law would allow 'best value' method for city procurement

The Common Council is considering a local law to amend the White Plains Municipal Code. The proposal authorizes the Mayor or authorized officers to use a “best value” method when purchasing goods, materials, equipment, or services. This method focuses on optimizing quality, costs, and efficiency.

procurementlocal-lawmunicipal-codewhite-plains
Mon Jul 1, 2024

Agenda

Proposal to authorize 'best value' method for city procurement

The Common Council is considering a local law to amend the White Plains Municipal Code. This amendment would allow authorized officers to use a 'best value' approach when purchasing goods, materials, equipment, or services. When using this method, officials must document how the selection optimizes quality, costs, and efficiency for the City.

procurementlocal lawmunicipal codewhite plains
Mon Jul 1, 2024

Agenda

White Plains Council adopts several multi-million dollar bond ordinances

The Common Council adopted multiple bond ordinances to fund capital projects, including vehicle acquisitions and building repairs. The council also approved a new photo monitoring system for school bus stop violations. A public hearing was held regarding the redevelopment of the White Plains Hospital Center.

budgetinfrastructurepublic-safetytransportationlaw
Mon Jun 24, 2024

Agenda

White Plains discusses school bus photo monitoring and capital projects

The Common Council will discuss a proposed amendment to use signal photo monitoring for school bus stop violations. The meeting also includes discussions on several capital improvement projects, including vehicle acquisitions and building repairs. Additionally, the council will hear presentations regarding 250 Mamaroneck Avenue and a climate action plan.

school-buscapital-projectspublic-safetyzoningclimate-action
Tue Jun 18, 2024

Transportation Commission

White Plains Hospital Center seeks approval for a new building expansion

The Commission will review several requests regarding traffic stops and parking restrictions throughout the city. It will also consider a referral for the White Plains Hospital Center expansion project. Staff recommended holding several items to allow for further study or resident feedback.

parkingtransportationzoningwhite-plainsinfrastructure
Tue Jun 18, 2024

Planning Board

Board recommends approval for 475,000 sq ft White Plains Hospital expansion

The board approved site plan amendments for properties at 1 Nikki Drive and 32 Paddock Road. It also recommended approval for a large-scale addition to White Plains Hospital. Public hearings were scheduled for July 16, 2024, regarding Hillside Terrace and Tarrytown Road.

zoninghospitaldevelopmentwhite-plainsplanning-board
Mon Jun 17, 2024

Conservation Board

The June 17, 2024, White Plains Conservation Board meeting has been cancelled.

The Conservation Board meeting scheduled for June 17, 2024, was cancelled. The next meeting is scheduled for Monday, July 15, 2024.

conservationwhite-plainsmeeting-cancellation
Thu Jun 13, 2024

Capital Projects Board

Amendment to the FY 24-25 Rolling Stock Capital Project budget

The Capital Projects Board is reviewing an amendment to the City of White Plains FY 24-25 Capital Improvement Program. The item proposes a new total cost and funding breakdown for the FY 24-25 Rolling Stock Capital Project.

budgetcapital-projectsrolling-stockwhite-plains
Mon Jun 10, 2024

Agenda

White Plains Hospital Center proposes new hospital building construction

The Design Review Board is reviewing several applications for signage, exterior modifications, and site plan amendments. This includes a major application for a new hospital building at the White Plains Hospital Center main campus.

hospitalsignageconstructionbusinesswhite-plains
Wed Jun 5, 2024

Agenda

White Plains Board of Appeals reviews several new zoning variance applications

The Board of Appeals Zoning is reviewing five new applications for property modifications. These requests include construction of a parking lot, home additions, and pool installations. Most items require variances to existing setback or building coverage regulations.

zoningwhite-plainsland-usebuilding-permitsvariance
Mon Jun 3, 2024

Agenda

White Plains Hospital proposes new 10-story building and expansion

The Common Council is reviewing an application from White Plains Hospital Center for an amended special permit and site plan approval. The proposal includes constructing a new hospital building to increase private bed capacity from 292 to approximately 436. The project involves the demolition of the Davis Parking Garage and several buildings on Maple Avenue and South Lexington Avenue.

hospitalexpansionzoningconstructionhealthcarewhite-plains
Mon Jun 3, 2024

Agenda

Agenda content unavailable due to document processing errors

The provided source text consists entirely of MuPDF error logs indicating that the PDF file could not be parsed correctly. No specific agenda items, decisions, or discussions are present in the record. Consequently, it is impossible to determine what the White Plains body was deciding or discussing at this meeting.

proceduraldata-error
Mon Jun 3, 2024

Agenda

White Plains adopts One White Plains Comprehensive Plan

The Common Council adopted the One White Plains Comprehensive Plan and zoning amendments for Westchester Avenue properties. The council also approved several grants, including funds for cybersecurity and youth programs. A public hearing was scheduled to discuss redevelopment at White Plains Hospital Center.

zoningbudgetpublic-safetyhousingtransportationcommunity-development
Mon Jun 3, 2024

Agenda

Proposed zoning change could add 86 residential units to Westchester Avenue projects

Developers are seeking a zoning map amendment for the Adora Row and Saber Project sites at 70 and 80 Westchester Avenue. The proposal aims to shift the boundary between residential and business districts to allow for higher housing density. If approved, the change could increase total units across both projects from 451 to 537.

zoninghousingdevelopmentwhite-plainsresidential
Tue May 28, 2024

Agenda

Common Council adopted the 2024-2025 Tax Budget and various operating budgets

The Common Council adopted several ordinances for the 2024-2025 fiscal year, including the city's tax budget and operating budgets for water, sewer, and library funds. The council also approved amendments to the municipal code regarding salaries and public works fees.

budgettaxmunicipal-codepublic-worksfinance
Tue May 28, 2024

Agenda

The White Plains Common Council will consider adopting the FY 2024–2025 city budget.

The White Plains Common Council is considering adoption of operating budgets for six municipal funds and an ordinance for the fiscal year ending June 30, 2025. The proposed $212,876,670 gross budget maintains the existing tax rate of $244.18 per $1,000 of assessed valuation. Adjustments include $58,000 for library heat pump studies and $66,000 for grant consulting, offset by $634,401 in state aid and proceeds from a recent bond sale. A final adopted budget summary will be prepared for the July 2024 meeting.

budgettax-levypublic-safetypublic-workslibrarywhite-plains
Tue May 21, 2024

Planning Board

Board approves swimming pool at 32 Paddock Road and two other site plan amendments

The White Plains Planning Board reviews development requests that determine allowable property modifications and lot divisions in local residential districts. At this meeting, members approved a swimming pool at 32 Paddock Road, extended a two-lot subdivision approval at 2 Hunting Ridge Road, and legalized a deck at 3 Kenneth Road. Public hearings for projects at 15 Commerce Street and 1 Nikki Drive were adjourned to a later date. The agenda also listed items for the Farrell Estates subdivision and a house addition at 154 Purdy Avenue without recorded actions in this text.

zoningsite-plansubdivisionhousingdevelopmentpublic-hearing
Tue May 21, 2024

Transportation Commission

Transportation Commission to weigh stop signs, parking changes

The White Plains Transportation Commission will review requests for new all-way stops at South Broadway/Livingston Avenue and Sammis Lane intersections, plus several parking changes. Staff recommends against the South Broadway stop, and recommends holding most other items for further study. The commission will also approve minutes from its April 16 meeting.

trafficparkingstop-signspublic-safetydowntown
Mon May 20, 2024

Conservation Board

Discussion of Comprehensive Plan updates and residential site plan applications

The Conservation Board will discuss updates to the city's Comprehensive Plan, specifically regarding sustainability. The meeting also includes reviews of several site plan applications for residential properties and parking lot expansions. Most items on the agenda are scheduled as status reports only with no formal action planned.

zoningsustainabilityhousingenvironmentwhite-plains
Thu May 16, 2024

Recreation & Advisory Committee

Recreation committee reviews Delfino Park, pickleball courts, camp plans

The White Plains Recreation Advisory Committee is meeting to review department programs and capital projects. Members will hear a program report from the Recreation Administrator and discuss updates on Delfino Park, Battle Hill pickleball courts, summer camp, and the Rock the Block concert series. New business includes field marshals, the Summer in the City guide, Independence Day plans, and pools. The agenda also lists upcoming city events through July.

parksrecreationcapital-projectseventscamppickleball
Tue May 14, 2024

Agenda

White Plains Common Council approves request to extend red-light camera authority

The Common Council met to consider Home Rule requests for New York State legislation. The council adopted resolutions to extend the city's authority to use red-light cameras at up to 12 intersections until December 1, 2029. They also approved a request regarding property alienation for the former Galleria of White Plains parking garage.

trafficpropertypublic-safetylegislation
Mon May 13, 2024

Agenda

Design Review Board to decide on 10 sign and site plan applications

The Design Review Board is meeting to consider 10 applications, mostly for new or modified wall signs at commercial properties. Several items are resubmissions, including a site plan for 97-109 Church Street and exterior changes at NY Presbyterian Hospital. One new application is for a pylon reface at 130 Westchester Avenue.

signagesite-plandesign-reviewcommercialwhite-plains
Mon May 6, 2024

Agenda

White Plains Council approves $2,525,000 in bonds for city street reconstruction

The Common Council held public hearings regarding the FY 2024-2025 budget and a development project on Church Street and Cottage Place. The Council also approved several ordinances, including funding for Kittrell Park Pool improvements and a geothermal study for the public library.

budgetstreetsparkszoninginfrastructurepublic-hearing
Mon May 6, 2024

Agenda

White Plains proposes $2,525,000 in bonds for street reconstruction projects

The Common Council is reviewing legislation to authorize $2,525,000 in serial bonds for the 'Miscellaneous Street Reconstruction FY 24' project. This initiative includes resurfacing streets and improving drainage, sidewalks, street lighting, and signage at various locations. The total estimated cost for this capital improvement program is $4,300,000.

streetsinfrastructurebudgetbondscapital-projects
Wed May 1, 2024

Agenda

Board of Appeals to hear three zoning variance requests

The White Plains Board of Appeals Zoning is meeting to consider three applications for area variances. Two applications were withdrawn before the meeting, and one new application will be heard. The board will decide whether to grant variances for a fence height, building coverage, and retaining wall height.

zoningvariancefenceparking-lotbuilding-coverage
Tue Apr 30, 2024

White Plains Urban Renewal Agency

Agency to approve estoppel agreement for Continuum project at 55/57 Bank Street

The White Plains Urban Renewal Agency will hold a special meeting to consider four resolutions: authorizing an estoppel agreement for the Continuum project, adopting the FY 2024-25 administrative budget, amending the federal inception-to-date budget, and establishing the community development salary schedule. The meeting also includes approval of minutes from September 25, 2023.

urban-renewalbudgetreal-estatehousingcommunity-development
Wed Apr 24, 2024

Agenda

Design Review Board to vote on signs, site plans, and hospital exterior changes

The Design Review Board will consider several resubmitted sign applications and new proposals, including a wall sign for White Plains Honda and exterior modifications for NY Presbyterian Hospital. A site plan and special permit application for WBP Development at 97-109 Church Street and an amendment for Kite Realty Group at 4-6 City Place are also on the agenda.

design-reviewsignssite-planspecial-permithospitaldevelopmentwhite-plains
Tue Apr 16, 2024

Transportation Commission

Commission to review Church Street affordable housing, City Place plaza, Westchester Ave rezoning

The White Plains Transportation Commission will review three Common Council referrals: a proposal to convert buildings at 97-109 Church Street and 6 Cottage Place into 68 affordable condominiums and 55 affordable rental apartments; a request to amend a site plan for exterior and plaza improvements at 1-29 Mamaroneck Avenue (City Center); and a joint request to rezone about 72,444 square feet at 70 and 80 Westchester Avenue from B-3 to RM-0.35. The commission will also consider holding a review of parking restrictions on Lake Street from the I-287 overpass to the city line, pending staff observation. Staff has no objections to the referrals.

affordable-housingzoningsite-planparkingtransportation
Tue Apr 16, 2024

Planning Board

Board considers affordable housing project at 97-109 Church Street

The White Plains Planning Board reviews site plans, zoning amendments, and development petitions before referring recommendations to the Common Council. These items determine whether proposed building conversions, commercial exterior updates, and residential boundary shifts comply with city land-use rules before final approval. The outcomes affect local development patterns, housing supply, and property boundaries in the affected districts.

zoninghousingsite-planaffordable-housingcomprehensive-plan
Mon Apr 15, 2024

Conservation Board

The April 15, 2024, White Plains Conservation Board meeting is cancelled.

The Conservation Board meeting scheduled for April 15, 2024, has been cancelled. The next meeting is scheduled for Monday, May 20, 2024.

conservationwhite-plainsmeeting-cancellation
Mon Apr 15, 2024

Agenda

Presentation of the 2024-2025 budget overview for city departments

The Common Council will receive an overview of the 2024-2025 budget. Presentations include budgets for the Library, Youth Bureau, Parking Department, Department of Public Works, and Department of Public Safety.

budgetfinancewhite-plainsgovernment
Wed Apr 10, 2024

Historic Preservation Commission

The Commission will consider designating 29 Woodland Place as a local historic landmark.

The Historic Preservation Commission will consider designating 29 Woodland Place as a local historic landmark. The meeting also includes continued discussions regarding the Lawyers Westchester Mortgage & Title Co. Building at 235 Main Street and 90 Greenridge Ave.

historic-preservationlandmarkswhite-plains
Mon Apr 8, 2024

Agenda

Design Review Board to vote on signs, awnings, facades, and a new multifamily building

The White Plains Design Review Board will consider 20 items, including sign installations for Medi Bistro, GDC Metro, TD Bank, Hair Hause, Genesis of White Plains, and Forme Urgent Care. New business includes a proposed multifamily building at 37 Lake Street, facade painting and plaza renovations at 7-11 So Broadway, and a zoning map amendment for 70 and 80 Westchester Avenue. The board will also review a site plan amendment for 4-6 City Place and a site plan and special permit application for 97-109 Church Street.

design-reviewsignagezoningdevelopmentwhite-plains
Wed Apr 3, 2024

Agenda

White Plains Board of Appeals reviews pool, fence, and deck variances

The Board of Appeals is reviewing several applications for property variances. These include requests to relocate a swimming pool, install a wrought-iron fence, and construct a rear yard deck.

zoningresidentialpoolsfencesdecks
Mon Apr 1, 2024

Agenda

Common Council approves park upgrades, city trash cans, and two school resource officers

The White Plains Common Council adopted budget amendments for Delfino Park playground equipment and citywide trash can replacements, approved a bond financing agreement with Capital Markets Advisors, LLC, and accepted the 2024-2025 Downtown Business Improvement District budget. The council also authorized two school resource officer positions at the local school district, updated municipal code rules on public records access, extended development approvals for projects on Westmoreland Avenue and Lake Street, and scheduled a May 6 hearing for Church Street adaptive reuse proposals. The body tabled several planning referrals, including zoning map amendments for 80 Westchester Avenue and site plan changes at City Place, while setting a future public hearing for the fiscal year 2024-2025 city budget. These actions directly affect neighborhood amenities, local business assessment rolls, school safety staffing, and upcoming construction timelines in White Plains.

zoningbudgetparkspublic-safetydevelopmentmunicipal-codebusiness-district
Mon Apr 1, 2024

Agenda

City adopts updated policy for procuring goods and services with federal funds.

The City of White Plains is reviewing a revised policy that sets procurement procedures for purchases made with federal funding. The document outlines bidding thresholds, contract types, ethics rules, and documentation requirements for city departments. This agenda item consists entirely of procedural boilerplate; no specific contracts, rezonings, or fee changes are listed.

procurementfederal-fundingcity-policybidding-thresholdsgovernment-procedures
Tue Mar 26, 2024

Planning Board

Board approves project extensions and refers Galleria rezoning to Common Council

The White Plains Planning Board reviewed zoning amendments, project extensions, and infrastructure fee arrangements during a special meeting that adjourned early. The board approved several site plan extensions for residential and mixed-use developments and authorized a fee option instead of direct sewer upgrades at East Post Road. A major petition to rezone the Galleria site into a new TD-2 district was referred to the Common Council with comments, pending a required environmental review. These actions determine local land use patterns, housing capacity, and infrastructure funding for ongoing projects.

zoningrezoningplanning-boardgalleriahousing-densityinfrastructurewhite-plains
Mon Mar 25, 2024

Agenda

Common Council discusses capital projects, site plans, and a zoning map amendment.

The White Plains Common Council will discuss two capital improvement projects that fund public trash collection and park upgrades. Presentations cover three development proposals, including a zoning map amendment for Westchester Avenue that changes local land use rules. A motion is scheduled to enter executive session regarding a potential municipal appointment.

zoningcapital-projectsparksdevelopmentexecutive-session
Mon Mar 25, 2024

Agenda

White Plains council discusses trash can replacement and park playground upgrades

The White Plains Common Council will hold a special meeting to discuss two capital improvement projects: replacing trash receptacles throughout the municipal parking system and installing wheelchair-accessible playground equipment at Delfino Park. The council will also review development proposals for City Center, 70-80 Westchester Avenue, and the properties at 6 Cottage Place and 99 Church Street. A segment of the meeting may transition to executive session regarding a potential staff appointment.

zoningcapital-improvementparks-and-recreationbudgetdevelopment
Thu Mar 21, 2024

Recreation & Advisory Committee

Recreation committee to discuss Delfino Park upgrades, camp lottery, new hire

The White Plains Recreation Advisory Committee is meeting to discuss updates on capital projects, programs, and operations. Items include the Delfino Park basketball court and picnic shelter, the 2024 camp lottery, pickleball courts, and a new recreation supervisor hire. The committee will also review a program report from the Community Center director.

recreationparkscapital-projectscamppickleballhiring
Tue Mar 19, 2024

Board of Ethics

Ethics board to pick chair, secretary, review 2023 disclosures

The White Plains Board of Ethics will nominate and appoint its chair and secretary for 2024. The board will also open and review submitted annual financial disclosure statements for reporting year 2023, likely in executive session. New business and adjournment round out the agenda.

Tue Mar 19, 2024

Planning Board

The March 19, 2024, White Plains Planning Board meeting was adjourned to March 26, 2024.

The scheduled meeting for March 19, 2024, was adjourned to March 26, 2024. The agenda included items regarding zoning amendments for the Galleria Site and extensions for residential and mixed-use projects.

zoninghousingdevelopmentwhite-plainsinfrastructure
Tue Mar 19, 2024

Transportation Commission

Commission to weigh stop signs at two Rosedale intersections

The White Plains Transportation Commission will review requests from the Rosedale Residential Association for traffic control at two intersections. Staff recommend installing a stop sign on Rose Street at Hubbard Drive, but do not recommend an all-way stop at Richbell Road and Barton Road because federal warrants are not met. The commission will also consider referrals for a Galleria DEIS scoping outline and site plan extensions for Westmoreland Avenue and Lake Street projects.

trafficstop-signszoningdevelopmentpublic-safety
Mon Mar 18, 2024

Conservation Board

Zoning amendment for new Transit Development-2 District at 100 Main Street

The Board will review a zoning ordinance amendment to establish a new Transit Development-2 District at 100 Main Street. The meeting also includes discussion regarding updates to the city's Comprehensive Plan, specifically the sustainability and environment chapter. Several other site plan items are for status reports only with no formal action scheduled.

zoningplanningsustainabilityenvironment
Wed Mar 13, 2024

Historic Preservation Commission

Public hearing for designating 29 Woodland Place as a local historic landmark

The commission will hold a public hearing regarding the designation of 29 Woodland Place as a Local Historic Landmark. The meeting also includes continued discussions regarding properties at 235 Main Street and 90 Greenridge Ave.

historic-preservationlandmarkspublic-hearing
Wed Mar 6, 2024

Agenda

White Plains Zoning Board to hear four variance requests for decks, pool, and fence

The Board of Appeals Zoning will consider four applications at its March 6, 2024 meeting. Items include legalizing a rebuilt deck at 3 Kenneth Road, reconstructing a deck at 2 Abbey Drive, relocating a pool at 4 Topland Road, and installing a 6-foot fence at 283 Soundview Avenue. The last three applications are listed as 'no appearance' items.

zoningboard-of-appealsvarianceresidentialwhite-plains
Mon Mar 4, 2024

Agenda

White Plains Common Council ratifies Police Benevolent Association agreement

The White Plains Common Council ratified a collective bargaining agreement with the Police Benevolent Association. The council also approved several intermunicipal agreements for youth mentoring programs and authorized street closures for summer events. Additionally, the council directed a draft environmental impact statement for a new zoning district at the Galleria.

policezoningyouthtransportationpublic works
Mon Mar 4, 2024

Agenda

Common Council to ratify police labor contract extension through 2026

The Common Council will consider ratifying a two-year contract extension with the White Plains Police Benevolent Association. The agenda also includes authorizing a contract for the Vision Zero Action Plan and approving street closures for upcoming summer events.

policelaborbudgettransportationpublic-worksstreet-closures
Mon Feb 26, 2024

Agenda

Proposed 3% fee increase for White Plains Youth Bureau programs

The Common Council will discuss proposed 3% fee increases for various Youth Bureau programs for the 2024/25 fiscal year. The agenda also includes discussions regarding a DRI Grant and the proposed discontinuance of part of Davis Avenue. Additionally, the council may enter executive session to discuss a potential appointment.

youth-bureaubudgetroadsgrantswhite-plains
Mon Feb 26, 2024

Agenda

Motion to enter executive session regarding a potential appointment

The White Plains Common Council will hold a special meeting on February 26, 2024. The agenda includes a motion to enter an executive session to discuss the potential appointment of an individual.

white-plainscommon-councilappointmentsexecutive-session
Mon Feb 26, 2024

Agenda

Proposed fee increases for Youth Bureau programs

The White Plains Common Council will discuss proposed fee increases for the Youth Bureau’s FY 2024/2025 programs. The agenda also includes a discussion on a DRI Grant and the proposed discontinuance of Davis Avenue between Maple Avenue and East Post Road.

youth-programsroadsgrantsappointments
Tue Feb 20, 2024

Transportation Commission

Commission to weigh stop signs, parking bans, loading zone

The Transportation Commission will consider several traffic and parking requests, including an all-way stop at Greenridge and Livingston Avenues, a no-parking restriction on Harding Avenue, a flashing beacon at a Delfino Park crosswalk, a no-parking zone near the Gedney Way Recycling Facility, and a new loading zone on West Post Road. Staff recommendations are provided for each item, and the commission will vote on whether to approve them.

trafficparkingstop-signspedestrian-safetyloading-zone
Mon Feb 12, 2024

Agenda

Design Review Board to vote on 7 sign and utility antenna applications

The Design Review Board will consider seven new applications for signs and a resubmitted special use permit for T-Mobile antenna facilities. Items include a ground sign for the Women's Club of White Plains, exterior color changes, and various wall and leasing signs. The T-Mobile application is requested to be removed from the agenda by the applicant's attorney.

design-review-boardsignsspecial-use-permitwhite-plains
Mon Feb 5, 2024

Agenda

White Plains Council approves speed limit reduction and various capital projects

The Common Council approved several ordinances, including a city-wide speed limit reduction from 30 to 25 miles per hour. The body also authorized multiple capital projects for facility renovations, library lighting, and fire system upgrades.

trafficzoningbudgetpublic-safetyinfrastructure
Mon Feb 5, 2024

Agenda

White Plains Council adopts citywide speed limit reduction to 25 mph

The Common Council passed several ordinances regarding budget amendments, zoning changes, and traffic regulations. Key decisions included reducing the city-wide speed limit from 30 mph to 25 mph and authorizing a $353,500 bond for a fire system upgrade.

trafficzoningbudgetpublic-safetyinfrastructure
Mon Jan 29, 2024

Agenda

White Plains Common Council to consider labor contract extension and capital projects

The Common Council is reviewing an ordinance to ratify a two-year contract extension for CSEA Local 1000. Additionally, several capital project funding requests and budget amendments are presented by the Capital Projects Board.

labor-relationsbudgetcapital-projectsinfrastructurewhite-plains
Mon Jan 29, 2024

Agenda

Council to ratify union agreement and discuss city capital projects

The Common Council will review a first reading ordinance to approve and ratify a December 13, 2023, agreement with the Civil Service Employees Association, Local 1000. The meeting also includes discussions on several capital projects and proposed changes to recreation fees and traffic ordinances.

laborbudgetinfrastructureparkstrafficwhite-plains
Thu Jan 18, 2024

Recreation & Advisory Committee

Recreation committee to review Delfino Park court, pickleball, camp plans

The White Plains Recreation Advisory Committee is meeting to discuss updates on capital projects including the Delfino Park basketball court and picnic shelter, Battle Hill pickleball courts, and Camp 2024, along with holiday program follow-ups. New business includes a potential White Plains Night with the Knicks, a staff reclassification, new spring/summer programs in the City Guide, and the fee schedule. The committee will also approve minutes from September and November 2023 and note upcoming city events.

parksrecreationcapital-projectscamppickleballeventsfees
Wed Jan 17, 2024

Agenda

Design Review Board to vote on 7 sign, window, awning applications

The Design Review Board will consider seven applications, including two resubmissions for a wall sign and window replacements, and five new proposals for signs, an awning, and a retaining wall amendment. Items involve commercial properties on Mamaroneck Ave, Court Street, Martine Ave, Gedney Way, Main Street, Bloomingdale Rd, and Aqueduct Rd.

design-reviewsignsawningswindowsretaining-wallcommercialwhite-plains
Wed Jan 17, 2024

Transportation Commission

White Plains Hospital zoning and Davis Avenue discontinuance up for traffic review

The Transportation Commission will review staff recommendations on several parking and traffic requests, including a no-parking zone on Park Avenue, stop signs on Redwood and Whitewood Roads, and a taxi stand removal at Renaissance Square. It will also revisit two White Plains Hospital Center petitions—a zoning map amendment and a Davis Avenue discontinuance—after reviewing a traffic study, with staff not opposed to either.

parkingtrafficzoninghospitalstop-signsroad-safety
Tue Jan 16, 2024

Planning Board

Planning Board to hold public hearing on Paddock Road site plan

The Planning Board will review and adopt previous meeting minutes, schedule a public hearing for a site plan amendment at 20 Paddock Road, and discuss other zoning matters including lot subdivisions and house additions.

zoningplanningpublic-hearingshousing
Wed Jan 10, 2024

Historic Preservation Commission

Commission discusses goals for 2024 and ongoing property reviews

The Historic Preservation Commission will hold discussions regarding 2024 goals. The meeting also includes continued discussions regarding the Westchester Mortgage & Title Co. Building at 235 Main Street and 90 Greenridge Ave.

historic-preservationwhite-plainslandmarksproperty-review
Wed Jan 3, 2024

Agenda

Board of Appeals to hear four zoning variance requests, including Church Street addition and sign setback

The White Plains Board of Appeals will consider four applications for area variances at its January 3, 2024 meeting. Items include a two-story rear yard addition at 132 Davis Avenue, a one-story addition and residential conversion at 99 Church Street, a ground sign at 305 Ridgeway, and legalization of a deck at 3 Kenneth Road. All requests involve non-conforming properties seeking relief from setback requirements.

zoningvariancepublic-hearingresidentialsignagewhite-plains
Tue Jan 2, 2024

Agenda

White Plains Council approves several ordinances and zoning-related resolutions

The Common Council met to decide on various municipal code amendments, appointments, and development resolutions. Key actions included approving a $15,000 loan for Grace Church and designating the council as lead agency for environmental reviews.

zoningmunicipal-codehousingfinancedevelopmentwhite-plains
Tue Jan 2, 2024

Agenda

Transportation Commission reviews parking lot proposal for 290 Ferris Avenue

The Transportation Commission reviewed a petition to amend the zoning map for 290 Ferris Avenue. The proposal seeks to develop a vacant 14,967 square foot parcel into a twenty-four space surface parking lot. The Commission reported no objections to the request.

zoningtransportationparkingland-use