Westfield

Massachusetts

Upcoming

Mon Jul 6, 2026

City Council

Council to vote on $1.1M state grant for 911 radio consoles

The City Council will vote on accepting four state grants totaling over $1.6 million for the Westfield Regional Public Safety Communications Center. The grants fund equipment, training, and software for 911 operations. The council also holds public hearings on taking three roads by eminent domain and considers a final vote on a moratorium on data centers.

westfieldcity-councilgrantspublic-safety911eminent-domaindata-centersbudget
Mon Jul 6, 2026

City Council

City considers eminent domain for three streets

The City Council holds public hearings on orders to take property by eminent domain for Michael Drive, Victoria Circle, and Woodsong Road. No dollar amounts are mentioned.

eminent-domainpublic-hearingpropertyroads
Mon Jul 6, 2026

City Council Finance Committee

Committee to vote on $100k salary reserve increase for union talks

The Finance Subcommittee will consider amending the proposed FY27 budget to add $100,000 to the Reserve for Unforeseen Salary Account for ongoing collective bargaining negotiations. They will also approve minutes from five previous meetings.

financebudgetsalariescollective-bargaining
Tue Jul 7, 2026

Board of Public Works

July 7 Board of Public Works meeting canceled

The regularly scheduled meeting of the Westfield Board of Public Works for July 7, 2026, has been canceled. A rescheduled date has not yet been determined.

meeting-cancellationcity-of-westfieldboard-of-public-works
Wed Jul 8, 2026

Animal Control

Dangerous dog hearing for two lab mixes on Bush St.

The City of Westfield Animal Control will hold a public hearing to determine the status of two lab mix dogs, Daisy and Riley, that have been involved in multiple incidents. The hearing is scheduled for July 8, 2026 at City Hall Room 315.

animal-controldogspublic-hearingwestfield
Wed Jul 8, 2026

Board of Assessors

Wed Jul 8, 2026

Board of Health

Westfield Board of Health July meeting cancelled

The July 8, 2026 Board of Health meeting is cancelled. The next regular meeting is August 12, 2026 at 6:00 PM.

cancellationboard-of-healthwestfield
Thu Jul 9, 2026

Water Commission

Commission to vote on drought status and water restrictions

The Water Commission will discuss and possibly vote on declaring a drought status and implementing water restrictions. They will also review abatement requests for three properties, hear a monthly department report, and vote on previous meeting minutes.

waterdroughtabatementrestrictionswestfieldpublic-works
Mon Jul 13, 2026

License Commission

Public hearing for a new motor vehicle dealer license

Farzaan Mufeed, doing business as Zia Motors, is seeking a Class 2 Motor Vehicle Dealer’s License. The application would allow the business to buy, sell, exchange, and assemble second-hand vehicles at 766 Southampton Road.

zoningbusinessautomotivelicensing

Last 30 days

Thu Jul 2, 2026

City Council

City Council meeting rescheduled to July 6

This meeting agenda contains only a notice of date change, rescheduling the July 2, 2026 City Council meeting to Monday, July 6, 2026 at 6:00 PM. No substantive items for discussion or decision are listed.

meeting-scheduleprocedural
Wed Jul 1, 2026

Municipal Light Board

Board to hear updates on 99 Medeiros Way project and energy supply outlook

The Municipal Light Board will review minutes, hear public comments, and receive reports on operations, finances, and energy programs. Action items include approval of quarterly publications, training exercises, and updates on the 99 Medeiros Way project. The board will also discuss health benefits and a surplus truck disposition.

utilitieselectricgasoperationsfinanceemployee-benefitsprojects
Wed Jul 1, 2026

City Council Personnel Action Committee

Committee to vote on two commission appointments

The Personnel Action Committee will consider appointing Kyle Theriault to the Parks and Recreation Commission and Jesus Torres Jr. to the Commission for Citizens with Disabilities. The committee will also approve previous meeting minutes and hold public participation.

personnelappointmentsparks-and-recreationdisabilitiescommittees
Tue Jun 30, 2026

City Council Legislative and Ordinance Committee

Council to consider narrowing definition of residential complex to 4 units or less

The Legislative and Ordinance Committee will discuss and possibly vote on an ordinance amendment to change the definition of a residential complex from more than four dwelling units to four units or less. They will also consider a resolution to establish a revolving account for solid waste bags as part of the Pay-As-You-Throw program.

ordinancezoninghousingsolid-wastepay-as-you-throwcommittee
Mon Jun 29, 2026

School Committee

Westfield School Committee reviews budget transfers and new student policies

The committee will evaluate the Superintendent's annual performance and approve several budget transfers between departments. Members will also review multiple policy updates regarding student discipline, English learners, and restraint protocols.

educationbudgetpolicysuperintendentgrants
Mon Jun 29, 2026

School Committee

School Committee to discuss collective bargaining strategy

The School Committee will meet in executive session to discuss labor strategy. The primary focus is collective bargaining with the Westfield Education Association Unit B and Personal Service Agreements.

labor-relationscollective-bargainingschool-administrationpersonnel
Mon Jun 29, 2026

City Council Personnel Action Committee

Personnel Action Committee meeting rescheduled to July 1st

This meeting agenda is a procedural notice changing the meeting date from June 29th to July 1st, 2026. No substantive agenda items are listed for discussion or decision.

personnel-action-committeemeeting-rescheduleprocedural
Thu Jun 25, 2026

Retirement Board

Board to review private equity investments and approve bills payable

The Westfield Retirement Board will hold a video conference to review investment performance, discuss a private equity co-investment mandate, and approve bills payable, warrants, and minutes.

retirementinvestmentsfinancecontractslitigationboard-meeting
Thu Jun 25, 2026

City Council

City council to vote on $63,747 for fire HQ HVAC replacement

The city council will consider a request from the mayor to appropriate $63,747.50 from free cash to replace two HVAC rooftop units at the Fire Department Headquarters at 34 Broad Street. The meeting is a special session for immediate consideration and approval of this capital project.

budgetfire-departmentcapital-projectscity-council
Wed Jun 24, 2026

Zoning Board of Appeals

Zoning board to hear ADU site plan at 122 Wyben Rd.

The Westfield Zoning Board of Appeals will hold public hearings on three applications: a site plan for an accessory dwelling unit at 122 Wyben Rd., a special permit for a non-conforming setback addition at 35 Barbara St., and a variance for an accessory structure at 1091 Shaker Rd. They will also review proposed changes to a previously approved site plan for 288 Elm Street.

zoningboard-of-appealspublic-hearingaccessory-dwelling-unitvariancespecial-permitwestfield
Tue Jun 23, 2026

Conservation Commission

Multi-unit housing and two lot subdivisions up for public hearing

The Conservation Commission will hold public hearings on three development proposals in wetland areas: a multi-unit housing project at Lockhouse Road and two lots on Pochassic Road. They will also review enforcement orders for properties on Mockingbird Lane and Union Street, discuss the draft Wetlands Protection Ordinance rules, and provide updates on conservation projects including Pequot Pond treatment.

conservationwetlandspublic-hearingshousing-developmentenforcementopen-spaceordinance
Mon Jun 22, 2026

Historical Commission

Historical Commission to discuss 250th celebration and cemetery updates

The Westfield Historical Commission will review old business including the National Registry and upcoming 250th celebration events, and discuss new business such as the Master Plan Priorities and OBG Tree Removal.

historical-commissionhistorycemetery250th-celebrationnational-registrymaster-plan
Thu Jun 18, 2026

Water Commission

Thu Jun 18, 2026

City Council

Thu Jun 18, 2026

City Council

Wed Jun 17, 2026

Traffic Commission

Wed Jun 17, 2026

Off-Street Parking Commission

Wed Jun 17, 2026

City Council

Tue Jun 16, 2026

Westfield Cultural Council

Tue Jun 16, 2026

Planning Board

Tue Jun 16, 2026

Commission for Citizens with Disabilities

Tue Jun 16, 2026

City Council Legislative and Ordinance Committee

Mon Jun 15, 2026

School Committee Subcommittee

Mon Jun 15, 2026

School Committee

Mon Jun 15, 2026

School Committee

Mon Jun 15, 2026

City Council Finance Committee

Thu Jun 11, 2026

Westfield Technical Academy

Thu Jun 11, 2026

Water Commission

Thu Jun 11, 2026

City Council Finance Committee

Wed Jun 10, 2026

Westfield Housing Authority

Wed Jun 10, 2026

Board of Public Works

Wed Jun 10, 2026

Board of Health

Wed Jun 10, 2026

Board of Assessors

Tue Jun 9, 2026

Westfield Airport Commission

Tue Jun 9, 2026

Conservation Commission

Tue Jun 9, 2026

City Council Finance Committee

Mon Jun 8, 2026

Police Commission

Mon Jun 8, 2026

Parks and Recreation Commission

Mon Jun 8, 2026

License Commission

Mon Jun 8, 2026

Fire Commission

Mon Jun 8, 2026

Council On Aging

Mon Jun 8, 2026

City Council Finance Committee