The Boring PartsFederalLocal · USLocal · Canada
Cayuga, IN

Cayuga public meetings in 2025

231 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Tue Dec 23, 2025

Board of Health

Cayuga County Board of Health to discuss environmental program fee adjustments

The Board of Health will meet to review department updates and approve claims. The agenda includes a discussion on adjusting fees for the environmental program. The board will also review reports on communicable diseases and immunization clinics.

public-healthfeesenvironmental-healthimmunizationmedical-audits
✓ Decided: Board reappointed Dr. Leah Weinberg and approved routine health items

The Board approved the minutes from the November 25 meeting, accepted the septic‑replacement grant claims, and accepted several hearing and consent orders. Members also voted to re‑appoint Dr. Leah Weinberg for a full term, pending legislative approval. The meeting was then adjourned.

Thu Dec 18, 2025

Community Services Board

Board will vote to renominate chair and vice chair

The Cayuga County Community Services Board will conduct its regular meeting, including roll call, review of the October 30th, 2025 minutes, and public comment. Reports from the director, communications, finance, and several subcommittees will be presented. A vote will be taken to renominate the chair and vice chair of the board. No other specific actions or decisions are listed on the agenda.

governanceelectionsboard-meetingspublic-commentssubcommittee-reports
✓ Decided: Board approved October minutes and renominated members

The board approved the October 30, 2025 meeting minutes. A motion renominated six members to the Community Services Board and two members to subcommittees. The meeting was then adjourned.

Thu Dec 18, 2025

General Municipal Law 239-l, m & n Review Committee

Committee reviews solar, zoning and dairy site plan amendments

The Cayuga County GML 239‑l, m & n Review Committee will first review the minutes from its November 20, 2025 meeting. It will then consider a solar law amendment for the Village of Cayuga, a zoning amendment for the Town of Brutus, and a site plan and special use permit for Byrne Dairy in the Village of Weedsport. The committee may recommend approval, disapproval, changes, or request additional material for each item.

solarzoningsite-planspecial-uselocal-lawplanning
✓ Decided: Committee approves solar law amendment and two local permits

The Cayuga County GML 239‑l, m & n Review Committee approved three municipal actions. It recommended approval of the Village of Cayuga Solar Law Amendment without change. It found the Town of Brutus zoning amendment and the Village of Weedsport Byrne Dairy site‑plan and special‑use permit to be local‑concern matters only and approved them.

Wed Dec 17, 2025

Water & Sewer Authority Board

Cayuga board to discuss water rates and waterline projects

The Cayuga Water & Sewer Authority Board will review draft minutes, accounts payable, and a workers' compensation insurance renewal. The meeting includes a public hearing on FY 2026 water and sewer rates and updates on waterline projects.

watersewerratesinfrastructurecontractpublic-hearing
✓ Decided: Board approved a 2% rate increase for Sewer District #2

The board unanimously approved a 2% increase in treatment and operations & maintenance rates for Sewer District #2. It also approved the purchase of a vac trailer for $110,394 and renewed workers' compensation insurance with a 5% premium decrease and a three‑year price lock. New hourly pay rates of $28 for A. Bergerstock and $25 for P. Schoonmaker were set, and a 3% raise for remaining staff was authorized. Board nominations and reappointments were confirmed, and a letter supporting the Community Projects Funding Bill was approved.

Thu Dec 11, 2025

Mental Health Sub-Committee

Cayuga County Mental Health Subcommittee meets December 11

The Mental Health Subcommittee will meet to review the Local Services Plan and the Mental Health Task Force. The agenda includes reports from several behavioral health and counseling agencies.

mental-healthcommunity-servicespublic-healthcayuga-county
✓ Decided: Mental Health Subcommittee meeting canceled for lack of quorum

The December 11, 2025 meeting of the Cayuga County Community Services Board Mental Health Subcommittee was canceled because a quorum was not present. No decisions, approvals, or votes were recorded.

Thu Dec 11, 2025

Legislature

Legislature to adopt motor vehicle tax law and approve 2026 tax levies

The Cayuga County Legislature will hold public hearings on two proposed local laws—one establishing a county motor vehicle tax and another opting not to create a registration system for short‑term rentals. The Ways & Means Committee will consider several tax‑levy resolutions for towns, fire districts and the City of Auburn for the 2026 fiscal year. Additional items include authorizing a software subscription renewal with Power DMS (NEOGOV) and approving contracts for health services and public‑safety equipment.

taxpublic-hearingbudgetcontractshealthplanningpublic-safetysoftware
✓ Decided: County approved 2026 tax levies for towns, fire districts and City of Auburn

The Legislature adopted several resolutions levying real‑property taxes for 2026 based on each town, fire district and the City of Auburn's share of county taxes. It also authorized the tax director to relevy delinquent taxes, school and village taxes, and unpaid water‑sewer charges. Additional actions included renewing the civil‑service software license and abolishing listed vacant HR positions. All motions passed unanimously.

Tue Dec 9, 2025

Ways & Means Committee

Ways & Means Committee to review 2026 tax levies and year-end budget adjustments

The committee is deciding on the levy of taxes for towns, fire districts, and the City of Auburn for 2026. Members will also discuss year-end accrual adjustments for the 2025 operating budget and various departmental contracts.

taxesbudgetgovernment-operationspublic-healthpublic-safetyartificial-intelligence
✓ Decided: County adopts AI policy and approves multiple tax and public‑works contracts

The Ways & Means Committee adopted the Cayuga County Artificial Intelligence Policy and approved several tax levy resolutions, a software subscription renewal, and public‑works agreements. It also authorized budget adjustments, a 911 center UPS battery purchase, and a snowmobile for the Sheriff’s Office. All motions passed with unanimous support except one vote against the snowmobile purchase.

Tue Dec 9, 2025

Human Resources & Civil Services Commission

Civil Service Commission reviews eligible lists and adopts new HELP job specifications

The Cayuga County Civil Service Commission will certify eligible candidates and consider extensions or expirations of existing eligible lists for several positions. It will adopt class specifications and draft new position duty statements for numerous HELP program jobs. The commission will also discuss interpretation of minimum qualifications, additional qualifications for an application disapproval, and upcoming 2026 salary increases for union employees.

civil-servicehiringworkforce-developmentsalaryqualificationshelp-program
✓ Decided: Commission adopted new class specifications for HELP program positions

The commission waived reading and approved the November 17, 2025 minutes. It extended eligible lists for three exams and expired six others. It adopted class specifications for 15 HELP program positions and approved new position duties statements for 19 roles. The next meeting was scheduled for January 13, 2026.

Tue Dec 9, 2025

Legislature

Cayuga County Legislature to hold public hearing on 2026 budget

The Cayuga County Legislature will meet for a special session to conduct a public hearing. The primary focus of the meeting is the 2026 Cayuga County Budget.

budgetpublic-hearingfinance
✓ Decided: Cayuga County Legislature adopts 2026 budget and passes key motions

The Legislature adopted the 2026 county budget (Resolution No. 446‑25). A motion to restore the Senior GIS Specialist position to a .6 FTE was approved. Motions to reduce the Ward O’Hara Agricultural Museum request and to lower the motor‑vehicle tax increase to 6.5 % were defeated. Additional motions, including one by Daly, passed, and the meeting adjourned at 6:22 PM.

Thu Dec 4, 2025

Planning & Economic Development Committee

County to implement $135,000 NYSERDA clean energy grant for solar and EV chargers

The Planning & Economic Development Committee will review department updates on multiple projects, including land‑use planning for the Town of Conquest, grant implementations for the Village of Moravia and Village of Weedsport, and the NYSERDA clean‑energy grant for Emerson Park. Additional reports will cover recycling program results, water‑quality initiatives, and the transition to ArcGIS Pro. No formal decisions are indicated; the meeting serves to inform the committee of ongoing work.

land-usegrantsrecyclingGISenergywater-quality
✓ Decided: Kimberly Schulze appointed to Cayuga County Parks Commission for 2026 term

The Planning & Economic Development Committee approved the November 13, 2025 meeting minutes unanimously. The committee also appointed Kimberly Schulze to the Cayuga County Parks Commission, with a term from January 1, 2026 to December 31, 2026.

Thu Dec 4, 2025

People with Development Disabilities Sub-Committee

Subcommittee to review minutes and agency reports

The Cayuga County People with Developmental Disabilities Sub-Committee will convene to review and approve November 2025 minutes and receive reports from various service agencies.

developmental-disabilitiescommunity-servicesminutesagency-reports
Thu Dec 4, 2025

Water Quality Management Agency (WQMA)

Water Quality Management Agency to form Nomination Committee

The agency will discuss the formation of a Nomination Committee. The meeting includes updates from county departments, local municipalities, lake associations, and regional partners.

water-qualityenvironmentcounty-governmentinvasive-species
✓ Decided: WQMA unanimously accepted the November 6 minutes and adjourned

The agency approved the November 6, 2025 meeting minutes with a unanimous vote. A motion to adjourn the December 4, 2025 meeting was also passed unanimously. No other substantive actions were decided.

Thu Dec 4, 2025

Government Operations Committee

County adopts AI policy and considers new motor vehicle tax law

The Government Operations Committee will vote on several resolutions, including adopting the county’s Artificial Intelligence policy, approving a revised SUNY capital request, authorizing the County Clerk’s mortgage tax expenses, and adopting a new motor vehicle tax law. It will also set dates for annexing the tax warrant and for newspaper publications in 2026. The agenda includes updates on the November 2025 general election, IT projects, and veteran services, but no decisions are listed for those items.

aipolicytaxlegislationbudgetelectionsit
✓ Decided: Government Operations Committee adopts AI policy and approves key resolutions

The committee approved the November 13, 2025 minutes. It unanimously adopted the county’s Artificial Intelligence policy and authorized several administrative actions, including expenses for the Mortgage Tax Clerk, a SUNY capital request for Cayuga Community College, and designating December 11, 2025 for the tax warrant annex. All motions passed with unanimous support.

Wed Dec 3, 2025

Health & Human Services Committee

STD services contract with East Hill and Finger Lakes approved

The Health & Human Services Committee will vote on several resolutions, including authorizing contracts for wildlife specimen preparation, STD testing and treatment, and rabies vaccination clinics. It will also approve hiring a senior public health sanitarian and amend the social services budget to accept state funding for the SAEF program. Additional items address youth program agreements and inter‑municipal tuberculosis control.

health-servicescontractsstaffingbudgetyouthmental-healthwildlife
✓ Decided: Health & Human Services Committee approved several contracts and program authorizations

The committee adopted eight resolutions authorizing the Chair of the Legislature and the Public Health Director to enter into contracts with Ciciarelli Wildlife Solutions, East Hill Family Medical and Finger Lakes Community Health, Finger Lakes Wildlife, the County’s Information Technology Department, and the Finger Lakes SPCA of CNY for rabies clinics. It also approved a senior public health sanitarian position, an intermunicipal tuberculosis control agreement with Onondaga County, a budget amendment to accept state funding for the Shelter Arrears Eviction Forestallment program, and a repeal of a youth agreement in favor of a new partnership with Growing Hope Cayuga, Inc. All motions passed with unanimous support except one abstention on the mental‑health services contract.

Wed Dec 3, 2025

Alcohol & Substance Use Sub-Committee

Cayuga County Alcohol & Substance Use Sub-Committee meets December 3

The Alcohol & Substance Use Sub-Committee will meet to review agency reports and conduct general business. The agenda consists of procedural boilerplate items.

community-servicessubstance-usepublic-health
✓ Decided: Subcommittee approved October 2025 minutes

The Alcohol & Substance Use Sub‑Committee approved the October 1, 2025 meeting minutes after a motion by Laurie Piccolo and a second by Alexa Hicks. The meeting was then adjourned on a motion by Caroline Dixon, seconded by Gary Mann. No other substantive actions were taken.

Wed Dec 3, 2025

Water & Sewer Authority Board

Cayuga Water & Sewer Authority sets meeting schedule for December

The Cayuga Water & Sewer Authority Board will meet to review the agenda and schedule future committee meetings. The next regular board meeting is scheduled for December 17, 2025.

watersewerschedulecommitteeboard-meeting
✓ Decided: Board approved submission of recommended appointments to County Legislature

The board voted unanimously to submit the recommended board appointments and reappointments to the Cayuga County Legislature. The motion was made by A. Rindfleisch and seconded by E. Wagner. The meeting was then adjourned by a unanimous vote. The next board meeting is scheduled for December 17, 2025.

Tue Dec 2, 2025

Public Works Committee

Public Works Committee to consider $15,460 highway software agreement

The committee will discuss a potential energy performance project to upgrade building infrastructure and review soil and water conservation updates. They are deciding on a software maintenance contract for the Highway Department.

highwayssoftwareenergy-efficiencyagricultureerosion-controlinfrastructure
✓ Decided: Public Works Committee approved software support agreement with Novo Solutions

The committee approved the November 6, 2025 meeting minutes. It re‑appointed Slade Cox to the Cayuga County Soil & Water Conservation District Board for a term from Jan 1 2026 to Dec 31 2028. The committee authorized the Chair of the Legislature and the Highway Superintendent to accept a support and maintenance agreement with Novo Solutions, Inc. for highway‑department software services. The meeting was adjourned at 4:34 PM.

Tue Dec 2, 2025

Judicial & Public Safety Committee

County approves five‑year fire‑control system maintenance contract with Johnson Controls

The Judicial & Public Safety Committee approved several resolutions, including a five‑year fire‑control system maintenance agreement with Johnson Controls at $9,829.64 per year. It also authorized the purchase of UPS batteries from Eaton Corporation for $12,120 and a 2026 Ski‑Doo snowmobile for $15,920. Additionally, the committee created a new Emergency Services Dispatcher (HELP) position and unfunded a Supervising Dispatcher role.

public-safetybudgetemergency-servicesfire-safetyequipmentcontracts
✓ Decided: Sheriff’s Office authorized purchase of a 2026 Snowmobile

The committee approved the purchase of batteries for the 911 Center UPS and authorized the Sheriff’s Office to buy a 2026 Snowmobile. It also approved a five‑year maintenance contract with Johnson Controls for the fire control system. A resolution to unfund one dispatcher and create a HELP position was tabled pending personnel committee approval. The meeting minutes were approved and the session was adjourned.

Tue Nov 25, 2025

Community Services Board

Community Services Board will discuss routine reports and subcommittee updates

The board will review the October 30th minutes and hear public comments. It will receive the Director’s Report, communications updates, and financial reports. Subcommittees on alcohol and substance use, people with developmental disabilities, mental health, and nominations will present their reports. The meeting will also address any unfinished or new business items.

community-servicesreportspublic-commentssubcommitteesbudget
Tue Nov 25, 2025

Board of Health

Board will consider adjustments to the Environmental Program fee

The Cayuga County Board of Health will review and approve the minutes from its October 21, 2025 meeting. It will consider fiscal claims presented by Fiscal Manager Rosalyn Fagan and discuss hearing and consent orders, department updates, and fee adjustments. Additional reports include communicable disease and immunization clinic data, QA/QI committee activities, STI audits, and a mock medical emergency drill. The meeting will conclude with the Medical Director's report and adjournment.

healthbudgetfeescommunicable-diseaseimmunization
✓ Decided: Board of Health approves minutes, claims, consent orders, and fee changes

The board approved the October 21 meeting minutes after correcting Dr. Weinberg’s name. It approved the pending financial claims reviewed by the fiscal manager. The board approved the hearing and consent orders for several entities. Finally, the board approved the revised fee schedule for temporary residences and mobile home parks.

Tue Nov 25, 2025

Legislature

Cayuga County Legislature sets date for budget public hearing

The Cayuga County Legislature will hold a public hearing on the 2026 budget and consider a local law establishing an animal abuser registry. The body also approved several committee appointments and contracts for county services.

budgetanimal-welfarepublic-safetyappointmentscontractslegislation911health
✓ Decided: County Legislature approves budget, workers’ comp savings, and municipal health pact

The Cayuga County Legislature approved the minutes from previous meetings and adopted several resolutions. It restored $30,000 to the Agricultural Museum, adopted the 2026 budget recommendations, authorized a three‑year municipal health insurance agreement, renewed workers’ compensation coverage at a lower cost, and closed six Capital “H” projects, transferring remaining balances. A motion to table items to December 9 was defeated.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by McNabb-Coleman to add back in one part-time position in the Health Department, Early Intervention, 2nd by Vitale. Roll Call vote – Noes – Winslow, Shea, Pecher, Strong, Daly, Sargent…
11 yea
Vitale yea · Noes – Winslow yea · Shea yea · Pecher yea · Strong yea · Daly yea · Anna yea · Nightengale yea · Sargent yea · Winslow yea · Muldrow yea
Thu Nov 20, 2025

General Municipal Law 239-l, m & n Review Committee

Review of metal plant special use permit for Town of Moravia

The committee will first review the minutes from its October 16, 2025 meeting. It will then consider five local actions: a waterfront revitalization plan for the Village of Cayuga, a battery storage law for the Town of Scipio, a special‑use permit for a metal plant in the Town of Moravia, and a site‑plan, special‑use permit and variance for an accessory dwelling unit in the Town of Owasco. For each item the committee may recommend approval, approval with changes, disapproval, or request additional material.

land-usezoningspecial-use-permitslocal-lawsplanning
✓ Decided: Committee approved four local laws and permits without changes

The Cayuga County GML 239‑l, m & n Review Committee recommended and approved four proposals without amendment. Each motion received an all‑AYE vote. The committee also approved the minutes from the October 16, 2025 meeting.

Thu Nov 20, 2025

Health Insurance Consortium Board of Directors

Board will approve the consent agenda covering prior minutes and finances

The Cayuga Health Insurance Consortium Board will vote to approve the consent agenda, which includes the previous meeting minutes and financial statements. The board will receive updates on USI medical and dental claim finances, as well as wellness, marketing, and Article 47 matters. New business topics and future meeting scheduling will also be discussed.

health-insurancefinanceboardagenda
✓ Decided: Board approved consent agenda and prior meeting minutes

The board voted to approve the consent agenda and the minutes from the previous meeting. Financial claims and budget updates were presented, and the Municipal Agreement amendment for a three‑year term was noted as already approved. The board scheduled the 2026 meeting calendar for approval at a future January meeting and adjourned.

Wed Nov 19, 2025

Water & Sewer Authority Board

Board to consider Amendment #4 to the Wholesale Sewer Agreement with Auburn

The Cayuga Water & Sewer Authority Board will discuss several project updates and a contract amendment. Key items include the Wholesale Sewer Agreement Amendment #4 with the City of Auburn and updates on multiple waterline projects. The board will also review FY2026 water and sewer rates and receive reports from finance, engineering, and strategic planning committees.

watersewercontractsratesengineeringplanning
✓ Decided: Board approved $15,000 contribution for special election on new sewer district

The board voted 4‑2‑1 to approve a contribution of up to $15,000 toward the special election required for forming Sewer District #3 under the Cayuga Lake Protection Plan. It also unanimously authorized the chair to sign a one‑year extension of the wholesale sewer agreement with the City of Auburn. The board unanimously approved switching payment processing to Paymentus and paying all open invoices. A bid for a $100,063 Vac Truck was tabled until December 17, 2025, and a special meeting and public hearing on FY 2026 water and sewer rates were scheduled for December 3 and December 17, 2025.

Tue Nov 18, 2025

Ways & Means Committee

Committee reviews 2026 tentative budget for legislature approval

The Ways & Means Committee will hold a budget workshop to review the 2026 County Tentative Budget and discuss proposed changes to specific account lines. The committee will submit its recommendations to the full County Legislature for consideration.

budgetlegislaturepublic-safetypublic-workscommittee-meeting
✓ Decided: County health insurance costs rise $1.3 million in 2026 budget

The Ways & Means Committee approved several staffing additions, including one MEO, a third security in Social Services, and a Sheriff’s Department SRO, all with unanimous support. A proposal to make the Youth Bureau Director a full‑time position was defeated (1 aye, 3 noes). The budget also raises health‑insurance expenses by $1.3 million (a 14% rate increase) and retirement contributions by $400,000. Additional budget changes include eliminating certain full‑time positions and reallocating funds across departments.

Tue Nov 18, 2025

Ways & Means Committee

Ways & Means Committee to review 2026 Tentative Budget recommendations

The committee is meeting to propose changes and revisions to the 2026 Tentative Budget. Members will also consider various resolutions regarding municipal agreements, tax levies, and department contracts.

budgettaxescontractspublic-workspublic-safety
✓ Decided: County approved NG911 grant for new emergency call system

The Ways & Means Committee approved a series of resolutions, including the acceptance of a Next Generation 911 grant to fund a new emergency call system. It also extended the county audit agreement for five years and authorized several tax, staffing, and contract actions. All motions were adopted unless noted otherwise.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion by Vitale to amend to 3 years, 2nd by Winslow, amendment defeated
4 nay
Winslow nay · Nightengale nay · Daly nay · Shea nay
Mon Nov 17, 2025

Human Resources & Civil Services Commission

Commission establishes eligible civil service lists for dozens of county positions

The Cayuga County Civil Service Commission will certify eligibles and establish eligible lists for a range of positions, including Clerk, Deputy Sheriff roles, Emergency Medical Technician, and various probation and social services jobs. It will adopt class specifications for several HELP program positions such as Competent Professional Authority and Coordinator of Substance Use Initiatives. The commission will also review an exempt class for the Deputy County Treasurer and consider reinstatement requests from E‑911 and the county jail. An HR report will note that 34 positions are authorized for hiring and that union negotiations are pending.

civil-servicehiringclassificationreinstatementuniontraining
✓ Decided: Commission approved new position duties statements and adopted class specifications

The Cayuga County Civil Service Commission adopted a set of class specifications for HELP Program positions and approved new duties statements for numerous new roles. It also expired several eligible lists, approved reinstatements, and set the date for the next meeting.

Thu Nov 13, 2025

Planning & Economic Development Committee

Planning Committee reviews Moravia $300K Small Project Grant fund awards

The Cayuga Planning & Economic Development Committee will discuss updates on several ongoing projects, including the implementation of the Village of Moravia's $300,000 Small Project Grant Fund. The committee will also receive reports on the Town of Conquest land‑use contract, the Village of Cayuga LWRP contract extension request, and the Cayuga Lake Scenic Byway Corridor Management Plan update.

grant-fundingland-usezoningwater-qualityrecyclingplanning
✓ Decided: Committee approved October 9 minutes and appointed two board members

The Planning & Economic Development Committee approved the October 9, 2025 minutes by unanimous consent. The committee also appointed Jessica Kolodzie and Nancy Sullivan to the Cayuga Cortland Workforce Development Board for terms from 11/26/25 to 11/25/27. No other substantive actions were recorded.

Thu Nov 13, 2025

Ways & Means Committee

Budget workshop to review Health & Human Services, Planning, Government Operations

The Special Ways & Means Committee will hold a budget workshop. The committee will review the budgets of the Health & Human Services, Planning, and Government Operations committees. No decisions are recorded beyond the review discussion.

budgethealthplanninggovernment-operationscommittee
✓ Decided: Committee adjourned at 5:59 PM by unanimous vote

The Cayuga Ways & Means Committee met on November 13, 2025. The only action taken was a motion to adjourn the meeting at 5:59 PM, which was seconded and approved unanimously. The minutes also included a 2026 budget summary for various departments, but no votes or decisions were recorded on those items.

Thu Nov 13, 2025

Mental Health Sub-Committee

Board will discuss the Local Services Plan and agency updates

The Cayuga County Community Services Board mental health sub‑committee will review prior minutes, hear brief public comments, and receive reports from the director and various agencies. The meeting will include discussion of the Local Services Plan and updates from the Mental Health Task Force. No specific decisions or contracts are listed in the agenda.

mental-healthcommunity-servicespublic-hearingplanningboard-meeting
Thu Nov 13, 2025

Government Operations Committee

County reviews $4 M DREAMS records‑digitization project status

The Government Operations Committee will receive updates on election processing, County Clerk finances, DMV revenue, and multiple IT initiatives. A major focus is the DREAMS project, a $4 M effort to migrate legacy records to Laserfiche Cloud, which has spent $2,779,994.03 to date. No formal actions or votes are listed; the meeting appears to be informational.

electionsfinancerecords-digitizationitinfrastructure
✓ Decided: Committee approved the October 9, 2025 meeting minutes

The Government Operations Committee approved the minutes from the October 9, 2025 meeting. The motion was made by Mark Strong, seconded by Heidi Nightengale, and passed with all members in favor. No other actions, appointments, or votes were recorded.

Wed Nov 12, 2025

Health & Human Services Committee

Committee approves creating new WIC nutritionist positions

The Health & Human Services Committee will consider creating three new positions for the Women, Infants, and Children (WIC) program to maintain compliance and handle rising caseloads. The agenda also includes authorizing contracts for clinical psychologists and behavioral health clinicians, and updates on Medicare enrollment and Meals on Wheels staffing.

healthwicnutritionmental-healthchild-welfarebudgetstaffing
✓ Decided: Health & Human Services Committee approved new staff positions and contracts

The committee approved the October 10, 2025 minutes. New members were appointed to the PWDD and Mental Health subcommittees. Eight resolutions were adopted, creating new health and human services positions, authorizing contracts for rabies testing, behavioral health, clinical assessments, computer upgrades, and adjusting the mental‑health budget.

Wed Nov 12, 2025

Planning Board

Board will approve June 2025 minutes and nominate 2026 officers

The Cayuga County Planning Board will consider approval of the minutes from its June 11, 2025 meeting. It will also nominate officers for the 2026 term, which must be approved by the County Legislature. The board will hear questions or comments on county planning updates and review the minutes of the GML 239‑l, m & n Committee. A local status report will be presented before adjournment.

planninggovernanceminutesofficerscounty
✓ Decided: Board approved June 2025 minutes and reappointed 2025 officers for 2026

The Planning Board voted to approve the minutes from the June 11, 2025 meeting. The Board also voted to renominate all 2025 officers to serve again in 2026, keeping Darrin Rooker as Chairman, Louise Hand as Vice Chairman, and Deborah Ross as Secretary.

Mon Nov 10, 2025

Legislature

Legislature reviews 2026 budget and holds executive session on collective negotiations

The Cayuga County Legislature will present the proposed 2026 budget. An executive session will be held to discuss collective negotiations under article fourteen of the civil service law. The meeting may also include any other business brought before the board.

budgetcivil-serviceexecutive-sessionlegislature
✓ Decided: Legislature entered and exited executive session, then adjourned

The Cayuga County Legislature moved into an executive session on collective negotiations, returned to the public session, and adjourned the meeting. All three motions were approved unanimously. No substantive budget or policy decisions were recorded.

Thu Nov 6, 2025

Public Works Committee

County approves supplemental snow‑and‑ice contract adding $789,913 funding

The Public Works Committee will vote on three resolutions. One creates a full‑time Laborer position in Buildings & Grounds with a $43,430 salary. Another enters a two‑year service agreement with PASCO for HVAC Alerton controls at $6,359 per year. The third authorizes the chair to sign a supplemental agreement with NYS DOT that raises lane miles to 188 and increases the snow‑and‑ice contract estimated expenditure to $789,912.92 for the 2025‑26 season.

public-workslaborcontractssnow-icehighwayhvac
Thu Nov 6, 2025

People with Development Disabilities Sub-Committee

Board will vote to approve September 2025 meeting minutes

The People with Developmental Disabilities Sub‑Committee will hold its regular meeting on November 6 at 12:00 pm. Members will hear public comments, review and approve the September 2025 minutes, and receive reports from several agencies. The agenda also includes discussion of old and new business and any announcements before adjournment.

development-disabilitiescommunity-servicespublic-hearingminutes-approval
✓ Decided: Subcommittee approved September minutes and adjourned meeting

The People with Developmental Disabilities Sub‑Committee approved the September 2025 minutes as submitted. The meeting was then adjourned. No other substantive actions or approvals were recorded.

Thu Nov 6, 2025

Judicial & Public Safety Committee

Cayuga County seeks $1.5 million grant for 911 telephone system upgrade

The Judicial & Public Safety Committee is reviewing a grant to modernize the 911 telephone system and recorder. The body is also considering personnel fills for emergency dispatch and the sale of a sheriff's vehicle.

public-safety911grantsemergency-servicesbudget
Thu Nov 6, 2025

Water Quality Management Agency (WQMA)

Presentation of the Sterling‑Wolcott Integrated Watershed Action Plan

The Cayuga County Water Quality Management Agency meeting will review minutes from prior meetings, hear a presentation on the Sterling‑Wolcott Integrated Watershed Action Plan, and receive updates from multiple agency, lake association, and working‑group reports. No formal decisions are indicated; the agenda consists of informational reports and a presentation.

water-qualitywatershedagency-reportslake-reportsworking-groups
✓ Decided: Board approved October minutes and adjourned the session

The agency accepted the October 2, 2025 meeting minutes after a motion by Ann Robson and a second by Dan Welch; the motion passed unanimously. A motion to adjourn was made by Doug Kierst, seconded by Pat Mooney, and also passed unanimously. The meeting closed at 10:50 am.

Wed Nov 5, 2025

Alcohol & Substance Use Sub-Committee

Public comments and agency reports will be reviewed at the meeting

The Cayuga County Community Services Board Alcohol & Substance Use Sub‑Committee will hold its regular meeting at noon on November 5, 2025. The agenda includes standard items such as roll call, public comments, review of minutes, agency reports, and announcements. No specific resolutions, contracts, or policy changes are listed.

substance-usecommunity-servicespublic-hearingmeeting
✓ Decided: Alcohol & Substance Use Subcommittee meeting cancelled due to lack of quorum

The November 5, 2025, meeting of the Cayuga County Alcohol and Substance Use Subcommittee was cancelled because a quorum was not present. No decisions, approvals, or votes were recorded.

Wed Nov 5, 2025

Legislature

Legislature considers local law to override tax levy limit

The Cayuga County Legislature will discuss several tabled resolutions regarding personnel vacancies and a local law to override the tax levy limit established in General Municipal Law §3-C.

taxeshiringsocial-servicesroadslocal-law
✓ Decided: County Legislature adopts Local Law to override 2026 tax levy limit

The Cayuga County Legislature adopted Local Law No. 4, allowing the county to exceed the statutory tax levy limit for fiscal year 2026. The motion passed with all legislators in favor except Vitale and McNabb‑Coleman. A motion to take HH‑6 and HH‑7 off the table was defeated, and a motion to table several personnel authorizations (HH‑6, HH‑7, GO‑4, PW‑1, PW‑2, PW‑5, LEG‑6) was approved. The meeting was adjourned at 5:07 PM.

Thu Oct 30, 2025

Community Services Board

Community Services Board to elect Chair and Vice Chair

The Community Services Board will meet to conduct regular business and review reports on mental health, substance use, and developmental disabilities. The board is scheduled to vote on a nominating committee follow-up and elect a Chair and Vice Chair.

community-servicesmental-healthsubstance-usedisability-servicesgovernance
✓ Decided: Board nominated three members to subcommittees

The board approved the September 25, 2025 meeting minutes. A motion nominated Joyce McGlynn and Megan Sedorus to the People with Developmental Disabilities Subcommittee and Carol Colvin to the Mental Health Subcommittee; the motion carried. The meeting was adjourned at 12:56 pm.

Tue Oct 28, 2025

Legislature

Public hearing on proposed hotel room occupancy tax

The Cayuga County Legislature will hold a public hearing on a local law that would impose a tax on the occupancy of hotel rooms and short‑term rentals, as authorized by Chapter 533 of the New York Laws of 1994. The meeting also includes approval of recent minutes, appointments to several boards, and a series of authorizations for contracts, grants, and staffing across health, public safety, and government operations. Notable financial actions include a $82,197 grant to the District Attorney’s Office for a gun‑involved violence elimination program and acceptance of state election and mail‑in voting grants.

taxpublic-hearingbudgetpublic-safetyhealthgovernmentelections
✓ Decided: County settles 2023 West Genesee Rd tax dispute and adopts new equalization rates

The Legislature approved a settlement of the 2023 West Genesee Road tax assessment case, authorizing the Special Counsel to finalize the agreement and update tax records. It also adopted equalization rates for the 2026 county tax levy. A vacant Junior Accountant position was converted to a non‑competitive HELP Program role and approved despite two dissenting votes. The county renewed its legal services contract with Bond Schoeneck & King for 2026‑2028.

Thu Oct 23, 2025

Legislature

Cayuga Legislature to discuss 2026 budget for 911, parks, and soil conservation

The Cayuga County Legislature will hold a special meeting to review the 2026 budget requests for the 911 department, Parks & Trails, and the Soil & Water Conservation District. The agenda includes a presentation on 911 equipment upgrades and personnel testing, as well as an overview of the Parks & Trails department's staffing and revenue.

budget911parkssoil-waterlegislatureexecutive-sessionstaffing
✓ Decided: Legislature entered, exited executive session and adjourned unanimously

The body approved a motion to go into executive session unanimously. It then approved motions to return to the regular session and to adjourn, each with unanimous support.

Thu Oct 23, 2025

Health Insurance Consortium Board of Directors

Board to decide whether to extend municipal agreement for 3 or 5 years

The Cayuga Health Insurance Consortium Board will approve the consent agenda covering prior minutes and financials. It will receive updates on USI medical and dental claim finances and renewal rate prices. Old business includes wellness, marketing, and Article 47 updates. New business centers on voting to renew the municipal agreement for either a three‑year or five‑year term.

health-insurancebudgetcontractsgovernance
Tue Oct 21, 2025

Ways & Means Committee

Cayuga County Legislature to approve legal services and opioid settlement contracts

The Ways & Means Committee will review department updates and approve resolutions for legal services, opioid settlement funds, and various departmental contracts and staffing changes.

budgetcontractslegalhealthelectionspublic-safetystaffing
✓ Decided: County adopts 2026 tax levy equalization rates and approves key contracts

The Ways & Means Committee approved the adoption of equalization rates for the 2026 County tax levy. It also approved the settlement of the W. Genesee Road LLC case, created an accountant position in the Finance Department, and authorized a legal services contract with Bond Schoeneck & King. Health contracts with Canine Cove Kennel and DAC Solutions were approved, along with hiring two Human Services Examiner positions. A request for proposals for 160 Genesee Street was tabled, and a Motor Vehicle Cashier position was authorized.

Tue Oct 21, 2025

Board of Health

Cayuga County Board of Health to discuss environmental program fee adjustments

The Board of Health will meet to review department updates and approve claims. The agenda includes a discussion on environmental program fee adjustments and reports on community health services.

public-healthfeesimmunizationswicenvironmental-health
✓ Decided: Board approves minutes, claims, consent orders, and revised permit fees

The Cayuga County Board of Health unanimously approved the minutes from the August 26, 2025 meeting, the recent financial claims, and the hearing and consent orders presented. The board also approved the revised Environmental Health Division permit fee schedule, which will take effect for 2026 permit renewals. All motions passed with all members present voting in favor.

Thu Oct 16, 2025

General Municipal Law 239-l, m & n Review Committee

Cayuga County reviews site plans and zoning for four towns

The GML 239-l, m & n Review Committee is meeting to evaluate local actions for potential intermunicipal or countywide impacts. The committee will review a zoning amendment and three site plan applications.

zoningsite-plansolarland-useintermunicipal-review
✓ Decided: Committee disapproves Victory solar project and approves three other local actions

The committee reviewed four municipal proposals. It determined the Town of Mentz zoning amendment, the Town of Summerhill wedding‑venue site plan, and the Town of Scipio cottage site plan and special‑use permit are local concerns and approved them unanimously. It recommended disapproval of the Town of Victory solar project site plan and special‑use permit, also unanimously. All votes were recorded as AYE.

Thu Oct 16, 2025

Mental Health Sub-Committee

Mental Health Sub-Committee to review local services and agency reports

The Cayuga County Community Services Board Mental Health Sub-Committee will meet to discuss the Local Services Plan and the Mental Health Task Force. The agenda includes a presentation from Peaceful Schools and reports from several behavioral health agencies.

mental-healthcommunity-servicespublic-health
✓ Decided: July 2025 subcommittee minutes approved

The subcommittee approved the draft minutes from July 17, 2025 after a motion by Caroline Dixon and a second by Katrina Garrigan. The motion carried. The meeting was then adjourned on a motion by Meghan Rusco, seconded by Sumner Youngs, which also carried.

Wed Oct 15, 2025

Health & Human Services Committee

Health Dept contracts Canine Cove Kennel and Ciciarelli Wildlife for animal services

The Health & Human Services Committee will vote on several resolutions authorizing contracts for animal rabies control and wildlife specimen preparation. It will also approve contracts with Chapel House for supportive case management and transitional emergency housing for homeless clients. Additional resolutions create a Principal Account Clerk position and fill vacant human‑services examiner and accountant roles.

healthhuman-serviceshousingbudgetcontractsemployment
✓ Decided: Committee approved multiple contracts and funding authorizations, including opioid settlement dollars

The Health & Human Services Committee approved the September 10, 2025 minutes. It unanimously authorized several contracts and agreements, such as with Canine Cove Kennel, DAC Solutions, and Open Practice Solutions. The committee also approved the acceptance of regional abatement dollars from state opioid settlements to be passed through to the City of Auburn. Additional authorizations included staffing changes in Social Services and a mental‑health navigator funding agreement.

Wed Oct 15, 2025

Legislature

County Legislature reviews FY 2026 budgets for highway, DA, sheriff, planning

The Cayuga County Legislature will discuss the FY 2026 budget proposals for the Highway Department, District Attorney’s Office, Sheriff’s Office/Jail and County Planning. Topics include salary costs, revenue programs, contract adjustments and fund balances. The meeting will decide on appropriations and any changes to contracts or staffing levels.

budgethighwaydistrict-attorneysheriffplanningcontractsrevenue
✓ Decided: Legislature voted to adjourn meeting at 6:30 PM

The Cayuga County Legislature met on October 15, 2025. After presentations on highway, district attorney, sheriff/jail, and planning budgets, the only formal action was a motion to adjourn the meeting at 6:30 PM. The motion was seconded and approved unanimously. No other votes or decisions were recorded.

Wed Oct 15, 2025

Water & Sewer Authority Board

CCWSA board to review FY2026 budget and waterline projects

The Cayuga County Water and Sewer Authority Board will review the FY2026 budget, accounts payable reports, and draft minutes from September 2025. The board will also discuss updates on the City of Auburn Water Contract Negotiations and various waterline projects.

watersewerbudgetinfrastructureboard-meeting
✓ Decided: Board unanimously approves FY2026 budget and key contracts

The Cayuga Water & Sewer Authority Board unanimously approved the FY2026 budget and payment of open invoices. It also approved the rate‑methodology contract with the City of Auburn and appointed R. Shea as Governance Committee chair through Dec. 31, 2025. The board authorized K. Rindfleisch as the NBRC official signer and approved the meeting agenda, draft minutes, and adjournment.

Tue Oct 14, 2025

Public Works Committee

Cayuga SWCD receives $720,898 state grant for cover crops on 11 farms

The Public Works Committee will review updates from Water & Sewer, Buildings and Grounds, Highway, and Soil & Water departments, including fall clean‑up, road maintenance, and a $720,898 state grant for cover‑crop implementation on 11 farms. The committee will consider three resolutions authorizing the County Highway Superintendent to fill a Motor Equipment Operator Medium position, a Motor Equipment Operator Heavy position, and a Senior Stores Clerk position. No other agenda items are listed.

grantshighwaystaffingagriculturebudget
✓ Decided: Committee authorized three highway department staffing positions

The Public Works Committee approved the September 9, 2025 minutes unanimously. It authorized the Highway Superintendent to fill a Motor Equipment Operator Medium position, a Motor Equipment Operator Heavy position, and a Senior Stores Clerk position, each with unanimous support. The meeting was adjourned at 5:17 PM.

Tue Oct 14, 2025

Judicial & Public Safety Committee

County seeks $689,655 ESInet readiness grant for 911 network

The Judicial & Public Safety Committee will vote on several resolutions, including authorizing the chair and 911 administrator to apply for a $689,655 Emergency Services IP Network (ESInet) readiness grant. It will also approve a $250,000 fund transfer to sustain the Assigned Counsel Program, a contract with Thomson Reuters for Westlaw services, and an $82,197 grant for the District Attorney’s Gun Involved Violence Elimination (GIVE) initiative. Additional items include purchasing four mobile radios for sheriff patrol cars and creating new deputy positions in the county jail.

public-safetyemergency-servicesgrantslegal-aidlaw-enforcementbudget
✓ Decided: County approves $82,197 grant for gun‑involved violence elimination program

The Judicial & Public Safety Committee approved the September 9, 2025 minutes and appointed Andrew Rotko to the Fire Advisory Board (term 10/29/25‑12/31/25). The committee unanimously passed eight resolutions, including authorizing an ESInet readiness grant application, transferring Assigned Counsel funds, signing a Westlaw contract, awarding an $82,197 GIVE grant to the District Attorney’s Office, purchasing four mobile radios, creating up to ten part‑time deputy custody positions, and renewing a Lexipol policy agreement.

Tue Oct 14, 2025

Human Resources & Civil Services Commission

Cayuga County Civil Service Commission to update eligible lists and job specifications

The Commission will review the establishment, extension, and expiration of eligible lists for various county roles. The body is also considering the adoption and amendment of class specifications and new position duty statements. Other business includes personnel requests for probation waivers, transfers, and reinstatements.

civil-serviceemploymentgovernment-administrationhiring
✓ Decided: Commission updated civil service rules and extended several eligible exam lists

The Cayuga County Civil Service Commission approved rule changes to align county regulations with New York State Civil Service rulings. It extended the eligible lists for five exams and expired two others, all by unanimous vote. The commission also adopted new class specifications for public‑health positions and approved new position duty statements.

Thu Oct 9, 2025

Planning & Economic Development Committee

Planning & Economic Development Committee to review department updates

The committee will receive updates on various municipal planning projects, including land use regulations for the Town of Conquest and short-term rental research for the Village of Fair Haven. The meeting also covers grant implementation for the Village of Moravia and downtown revitalization efforts in Weedsport.

zoningeconomic-developmentgrantsland-userecyclingmunicipal-planning
✓ Decided: Committee unanimously approved September 11, 2025 meeting minutes

The Planning & Economic Development Committee approved the September 11, 2025 minutes with all members in favor. The committee reappointed three members—Dan Welch, Joe Clare, and William Andre—to the Cayuga‑Cortland Workforce Development Board for terms ending September 30, 2027. Additional updates were provided on ongoing land‑use, grant, and environmental projects, but no further actions were decided.

Thu Oct 9, 2025

Legislature

Legislature reviews 2026 budgets for Office for the Aging and Social Services

The Cayuga County Legislature will consider budget presentations for the Office for the Aging and the Department of Social Services. The Office for the Aging proposes a total revenue of $1,949,066 with a request for $92,172 less than the 2025 approved budget and includes $10,000 for temporary help and $18,000 for a contracted dietician. The Department of Social Services proposes a $5,640,000 Safety Net budget for 2026, a 7.75% increase in local share costing $3,335,000. Both agencies will discuss funding sources, cost changes, and service impacts for seniors and vulnerable residents.

budgetagingsocial-serviceshealthsenior-caresafety-net
✓ Decided: Legislature adjourned meeting after budget presentations

The meeting was adjourned at 7:33 PM after a motion by Winslow, seconded by Muldrow, passed with all members in favor. No other substantive actions or approvals were recorded during the session.

Thu Oct 9, 2025

People with Development Disabilities Sub-Committee

Cayuga County People with Developmental Disabilities Subcommittee meets October 9

The subcommittee will meet to review agency reports and conduct general business. The agenda consists of procedural items and reports from local service providers.

disabilitiescommunity-servicessocial-services
Thu Oct 9, 2025

Government Operations Committee

County to switch door access contract, saving thousands annually

The Government Operations Committee reviewed updates from the Board of Elections, the County Clerk’s finances, and several IT initiatives. A key item was the Door Access Control System upgrade, which will replace the Linstar contract with a time‑and‑materials agreement with Doyle Securities, projected to save the county thousands of dollars each year. The committee also received a fiscal update on the $4 million DREAMS records‑digitization project and noted progress on the AI policy and Windows 11 rollout.

door-accesscontractsbudgetitelectionsrecordsai-policy
✓ Decided: Committee approved September 2025 meeting minutes

The Government Operations Committee met on October 9, 2025. The committee approved the September 16, 2025 minutes by unanimous vote. No other actions were formally decided; the remainder of the meeting consisted of departmental updates and presentations.

Wed Oct 8, 2025

Legislature

County IT budget adds $625,000 for dark fiber and software upgrades

The Cayuga County Legislature will review the 2026 budget, covering finance, information technology, and real property tax services. Key items include approving a $140,000 increase for dark fiber network upgrades at sites such as 63 Genesee St and Auburn Fire, and a $485,000 increase for software centralization across public safety, HR, highway, and legal systems. The Real Property Tax Services department proposes a 32% revenue increase of $93,000 and adjustments to assessment fees and contract expenditures.

budgetitinfrastructuretaxfinance
✓ Decided: Legislature voted to adjourn the meeting at 6:14 PM

The only action taken was a motion to adjourn the special legislature meeting. Winslow moved to adjourn, Pecher seconded, and all legislators present voted in favor. The meeting ended at 6:14 PM.

Thu Oct 2, 2025

Water Quality Management Agency (WQMA)

Cayuga County Water Quality Management Agency to review agency and lake reports

The agency will meet to discuss updates from various county departments and lake associations. The agenda includes reports from working groups focused on invasive species and communication and outreach.

water-qualityinvasive-speciesenvironmentcounty-government
✓ Decided: WQMA unanimously accepted September 4 minutes and adjourned

The agency approved the September 4, 2025 meeting minutes without dissent. A motion to adjourn the October 2 meeting was also passed unanimously. No other substantive actions were decided.

Wed Oct 1, 2025

Alcohol & Substance Use Sub-Committee

Cayuga County Alcohol & Substance Use Sub-Committee meeting scheduled for Oct. 1

The Alcohol & Substance Use Sub-Committee will meet to review agency and director reports. The agenda consists of procedural items and public comment.

public-healthsubstance-usecommunity-services
✓ Decided: Subcommittee approved a one-year resolution to continue Nick’s Ride peer services

The subcommittee approved the July 2, 2025 meeting minutes. A one-year resolution was approved to support Nick’s Ride’s peer services program. The meeting was adjourned by motion. No other business was taken.

Thu Sep 25, 2025

Legislature

County seeks grant for Deauville Island bridge replacement

The Cayuga County Legislature will consider two applications to the Northern Border Regional Commission Catalyst Program. One seeks funding to replace a critical access bridge to Deauville Island at Emerson Park, and the other seeks funding for a Countywide Housing Market Study.

governmentinfrastructurezoningbudgethousingroadsgrant
✓ Decided: County Legislature approved two applications for bridge replacement and housing study

The Cayuga County Legislature adopted Resolution 342‑25, authorizing the Parks & Trails Department to apply for a Northern Border Regional Commission Catalyst grant to replace the Deauville Island bridge, with a 20% match from Capital "H" Project No. 21‑02. It also adopted Resolution 343‑25, authorizing the Planning Department to apply for a Catalyst grant for a countywide housing market study, using a $50,000 match from the Auburn Housing Authority and other organizations. Both resolutions were approved by the members present. The meeting was then adjourned.

Thu Sep 25, 2025

Community Services Board

Community Services Board to review youth needs assessment data

The Community Services Board will meet to review the Director's and financial reports. The agenda includes a data overview of the Cayuga County Systems of Care Parent/Youth Needs Assessments. The board will also receive reports from subcommittees regarding mental health, alcohol and substance use, and people with developmental disabilities.

community-servicesyouth-servicesmental-healthsubstance-usedisability-services
✓ Decided: Board approved June 2025 minutes and adjourned the meeting

The board approved the June 2025 meeting minutes as submitted. The meeting was then adjourned. No other substantive actions were taken.

Thu Sep 25, 2025

Health Insurance Consortium Board of Directors

Board will discuss renewal of the municipal agreement

The Cayuga Health Insurance Consortium Board will approve the consent agenda covering previous minutes and financials. They will review the 2023 and 2024 audit presented by EFPR Group CPAs PLLC. USI will provide updates on medical and dental financial claims and discuss rate renewal. New business includes a discussion on renewing the municipal agreement.

health-insurancefinanceauditboardagreements
✓ Decided: Board approved a 14% increase in 2026 medical and Rx rates

The board approved the consent agenda and prior minutes. It set the 2026 medical and prescription drug rates to rise 14% and kept dental rates unchanged at 0%. The extension of the Consortium Municipal Agreement was postponed for further discussion at the October meeting. The meeting was then adjourned.

Tue Sep 23, 2025

Legislature

Renew joint assessment service agreements with Moravia, Niles, and Sempronius

The Cayuga County Legislature will vote on resolutions to renew joint services agreements for optional county assessment services with the Towns of Moravia, Niles, and Sempronius, each generating annual revenue for the county. The Legislature will also consider health‑human services resolutions, including a $25,000 NYS OTDA grant contract with CAP and a Homeland Security grant for technical rescue equipment (FEMA Project #TR22-1002‑E00). Additional items include public‑works staffing authorizations and public‑safety contracts.

joint-servicesassessmenthealthpublic-workspublic-safetyfunding
✓ Decided: County approves $414,119 Youth Employment Program funding

The Cayuga County Legislature approved several resolutions, including renewing joint assessment service agreements with the towns of Moravia, Niles and Sempronius, authorizing the hire of a Deputy County Treasurer II, and accepting $25,000 for domestic‑violence services and $414,119 for a Youth Employment Program. All joint‑services resolutions passed with unanimous support. The Deputy Treasurer II appointment was approved with four members voting against. The domestic‑violence and youth‑employment funding resolutions were adopted with unanimous support.

Tue Sep 23, 2025

Board of Health

Board reviews public health updates and approves fiscal claims

The Cayuga County Board of Health will consider approval of the August 26, 2025 meeting minutes. The board will also approve fiscal claims presented by the Fiscal Manager. Public health matters will be discussed, including a hearing and consents, department updates, and reports on communicable disease, immunizations, and COVID-19 vaccines. The meeting will conclude with an adjournment.

public-healthboard-of-healthimmunizationcovid-19administration
Thu Sep 18, 2025

General Municipal Law 239-l, m & n Review Committee

Committee to review zoning amendment for Town of Cato

The Cayuga County GML 239-l, m & n Review Committee will meet to review local actions for potential intermunicipal or countywide impacts. The primary item for consideration is a zoning amendment local law from the Town of Cato.

zoningtown-of-catoland-useintermunicipal-review
✓ Decided: Committee approved prior minutes and ruled Cato zoning amendment local

The committee approved the minutes from the August 21, 2025 meeting by unanimous AYE vote. It also determined that the Town of Cato's proposed zoning amendment is a local concern only, with no intermunicipal impact, and approved that finding by unanimous AYE vote. The meeting adjourned at 9:03 AM.

Thu Sep 18, 2025

Mental Health Sub-Committee

Mental Health Subcommittee meeting to review reports and discuss plans

The Cayuga County Community Services Board Mental Health Subcommittee will review and approve the minutes from the previous meeting. It will hear brief public comments, receive presentations, and get updates from the director, the Local Services Plan, the Mental Health Task Force, and several agency reports. The meeting will also address any old and new business items before adjourning.

mental-healthcommunity-servicespublic-hearingreportsplanning
✓ Decided: Mental Health Subcommittee meeting cancelled due to lack of quorum

The September 18, 2025 meeting of the Cayuga County Community Services Board Mental Health Subcommittee was cancelled because a quorum was not present. No decisions were made.

Wed Sep 17, 2025

Water & Sewer Authority Board

Water & Sewer Authority to discuss waterline projects and sewer protection plans

The Board will review financial reports and receive updates on several infrastructure projects. Discussions include water contract negotiations with the City of Auburn and sanitary sewer planning for the Cayuga Lake Protection Plan.

water-infrastructuresewerpublic-worksenvironmental-protection
✓ Decided: Board unanimously raises water relevy fee to $250 for FY2026

The board voted unanimously to increase the water relevy fee from $100 to $250 effective Jan. 1, 2026. It approved the $8,100 Cornell Electrical Solutions quote for electrical work on the Genesee Street waterline. The board also approved moving forward with funding for the North Street waterline extension, and approved a third letter and postcard to residents of proposed sewer district #3.

Tue Sep 16, 2025

Ways & Means Committee

Ways & Means Committee to approve $25,000 state health funding and joint service renewals

The Ways & Means Committee will consider a series of resolutions covering joint services agreements, health program funding, policy updates, and staffing actions. Key items include renewing assessment service agreements with the towns of Moravia, Niles, and Sempronius; accepting $25,000 from NYS OTDA for a social services contract; and adopting new county contracts and travel policies. The committee will also address hiring positions in public works and the sheriff’s office, and approve a grant for the Ward O’Hara Agricultural Museum log cabin replacement.

joint-serviceshealth-fundingpolicyhiringgrant
✓ Decided: County approves $25,000 OTDA grant and multiple service contracts

The Ways & Means Committee approved a series of resolutions, including acceptance of a $25,000 OTDA grant and a contract with CAP, youth employment program funding, and several mental‑health service contracts. It also approved a grant for the Ward O’Hara Agricultural Museum, declared highway equipment surplus, and adopted new policies on grants, travel, and contracts. All motions passed with unanimous support except where noted.

Tue Sep 16, 2025

Government Operations Committee

Committee reviews DREAMS Project $4 M budget and $2.66 M spent

The Government Operations Committee will receive updates on county election processing, clerk and DMV finances, and major IT and infrastructure projects. Highlights include the DREAMS Project fiscal status, a door access control system upgrade, and the migration of mobile device management to Jamf. No formal actions or approvals are listed on the agenda.

budgetrecordsitinfrastructureelectionsdmvprojects
✓ Decided: Committee unanimously approved August 14, 2025 meeting minutes

The Government Operations Committee approved the minutes from the August 14, 2025 meeting. The motion was made by Mark Strong, seconded by Heidi Nightengale, and all legislators present voted in favor. No other actions were taken during this session.

Thu Sep 11, 2025

Planning & Economic Development Committee

Committee receives updates on $1 M housing grant and multiple local projects

The Planning & Economic Development Committee will hear department updates on a range of initiatives, including the $1,000,000 County Infrastructure Grant for the Bluefield Pointe housing project, land‑use planning for the Town of Conquest, zoning amendments for Mentz, the Moravia NY Forward Small Project Grant Fund, and ongoing recycling and solid‑waste programs. No formal decisions are listed; the meeting is for informational reports on progress, revenues, and upcoming actions.

housinggrantszoningrecyclingwaterplanning
✓ Decided: Committee approved August 1 4 , 2025 minutes

The Planning & Economic Development Committee approved the minutes from August 1 4 , 2025 after a motion by Daly and a second by McNabb‑Coleman, with all members voting in favor. No other actions or votes were recorded during the meeting.

Thu Sep 11, 2025

People with Development Disabilities Sub-Committee

Sub-Committee to receive CSIDD virtual presentation

The People with Developmental Disabilities Sub-Committee will meet to review agency reports and previous minutes. The meeting includes a virtual presentation from CSIDD.

developmental-disabilitiescommunity-servicesagency-reports
✓ Decided: June 2025 subcommittee minutes approved

The subcommittee approved the June 2025 minutes as submitted. The meeting was then adjourned at 12:47 PM. No other substantive actions were taken.

Wed Sep 10, 2025

Health & Human Services Committee

Committee will approve funding for domestic violence, youth jobs, and lead safety

The Health & Human Services Committee will vote on several resolutions authorizing new funding and contracts, including $25,000 for emergency domestic‑violence services, $414,119 for a Youth Employment Program, and a $500,000 state grant for a Lead Rental Registry. It will also approve contracts for child mental‑health diagnostic assessments and create new staff positions to support the lead‑registry program. Additional items include establishing school‑based mental‑health satellite clinics.

human-servicesfundingmental-healthyouth-employmentlead-registrydomestic-violencecontracts
✓ Decided: Committee approves multiple health funding and staffing resolutions

The Health & Human Services Committee approved the August 13, 2025 minutes. It authorized several funding contracts, including $25,000 from NYS OTDA and Youth Employment Program funds. The committee also approved new mental‑health service contracts and created four new positions to support the Lead Rental Registry program. All motions passed unanimously.

Tue Sep 9, 2025

Public Works Committee

✓ Decided: Committee approved several grants, notably a Homeland Security rescue equipment grant

The Public Works Committee approved the minutes from August 12, 2025. It authorized multiple grants and contracts, including a New York State Division of Homeland Security program to fund technical rescue and urban search‑and‑rescue equipment and training. The committee also approved funding for an alternative sentencing program, a GIVE grant for the Probation Department, and several Sheriff‑related contracts and staffing actions.

Tue Sep 9, 2025

Judicial & Public Safety Committee

Cayuga County considers multiple public safety grants and service contracts

The Judicial & Public Safety Committee is reviewing resolutions for probation services, sheriff's office staffing, and emergency equipment. The body is also receiving updates on jail capacity, 911 system repairs, and court arraignment costs.

probationsheriffgrantspublic-safetycourtsemergency-services
✓ Decided: Committee approved funding for Technical Rescue and Urban Search and Rescue equipment.

The Judicial & Public Safety Committee approved the minutes from August 12, 2025. It authorized multiple funding and contract resolutions, including a Homeland Security program for technical rescue equipment, an alternative sentencing agreement, and several probation and sheriff initiatives. All resolutions passed with unanimous support except one where a single member opposed the deputy sheriff vacancy fill. The committee adjourned at 4:57 PM.

Tue Sep 9, 2025

Human Resources & Civil Services Commission

Civil Service Commission to review eligible lists and job specifications

The Commission is meeting to establish, extend, or expire eligible lists for various county positions. The body will also consider the adoption and amendment of class specifications and new position duty statements across multiple departments.

civil-serviceemploymentpublic-healthlaw-enforcementgovernment-administration
✓ Decided: Commission certified multiple permanent civil service appointments

The Cayuga County Civil Service Commission approved the certification of permanent appointments for positions in the District Attorney, Emergency Management, Mental Health, Public Health, and Social Services offices. The commission also adopted state‑mandated rule changes, extended and expired several eligible exam lists, adopted and amended class specifications, and approved new position duty statements. All motions were approved unanimously.

Thu Sep 4, 2025

Water Quality Management Agency (WQMA)

Water Quality Management Agency to receive agency and lake reports

The Water Quality Management Agency will meet to review updates from county departments and lake associations. The session includes reports from working groups on communication and invasive species.

water-qualityenvironmentinvasive-specieslake-management
✓ Decided: WQMA approved July 10 minutes and unanimously adjourned the meeting

The agency accepted the minutes from the July 10, 2025 WQMA meeting with a unanimous vote. The meeting was then adjourned by unanimous consent.

Wed Sep 3, 2025

Alcohol & Substance Use Sub-Committee

Cayuga County Alcohol & Substance Use Sub-Committee to meet September 3

The Alcohol & Substance Use Sub-Committee will meet to review agency reports and communications. The agenda consists of procedural items and reports.

healthsubstance-usecommunity-services
✓ Decided: July 2025 minutes approved by the Alcohol & Substance Use Subcommittee

The subcommittee approved the draft July 2025 minutes after a motion by Caroline Dixon and a second by Alexa Hicks; the motion carried. The meeting was then adjourned on a motion by Alexa Hicks, seconded by Caroline Dixon; the motion carried. No other substantive actions were taken.

Wed Sep 3, 2025

Water & Sewer Authority Board

Water & Sewer Authority Board to review Cayuga Lake Protection Project

The Board will review the agenda and discuss the Cayuga Lake Protection Project and public information. The meeting also includes a review of the August 26, 2025, public hearing.

watersewerenvironmental-protectionpublic-hearing
✓ Decided: Board held informational meeting on Cayuga Lake Protection Project, no decisions made

The board presented an update on the Cayuga Lake Protection Project, noting that the district formation will not proceed until funding is secured and a permissive referendum passes. The project is estimated to cost $33 million to construct, with an anticipated $2,000 per year O&M charge for residents. Attendees discussed road‑closure impacts, septic‑system contributions to lake algae, and voting eligibility for the referendum. No formal actions or votes were recorded.

Thu Aug 28, 2025

Health Insurance Consortium Board of Directors

Health Insurance Consortium Board to discuss rate renewals

The Board of Directors will review medical and dental financial claims and the balance sheet. Members will also discuss rate renewals and receive updates on wellness and marketing.

health-insurancefinancialsbenefits
✓ Decided: Board approved consent agenda and previous minutes

The board approved the consent agenda, the prior meeting minutes, and the financial statements. The meeting was formally adjourned at 11:39 a.m. No other decisions were made.

Wed Aug 27, 2025

Parks & Trails Commission

Commission to award contract for networked charging stations at Emerson Park

The Parks & Trails Commission is meeting to award a contract for electric vehicle charging stations and authorize carpeting replacement at the Ward O’Hara Agricultural Museum. The body will also receive updates on design projects and trail maintenance.

parkselectric-vehiclesinfrastructurecontractsmuseums
✓ Decided: Commission lacked quorum, no decisions were made

The Cayuga Parks & Trails Commission meeting on August 27, 2025 did not reach a quorum, so no resolutions or contracts were approved, denied, or tabled. The agenda items and project updates were discussed, but no formal actions were taken.

Tue Aug 26, 2025

Legislature

Cayuga County Legislature to hold hearings on sewer district and local law

The legislature will conduct public hearings regarding the formation of County Sewer District No. 3 and amendments to Local Law No. 3 of 1994. The body is also considering various personnel appointments, budget amendments, and public safety contracts.

sewerszoningbudgetpublic-safetycannabis-taxpersonnel
✓ Decided: County Legislature approves cannabis tax revenue and extends hiring freeze

The Cayuga County Legislature authorized the Finance Director to accept adult‑use cannabis sales tax revenue and amended the 2025 budget to add $175,000 to both revenue and appropriation accounts. It also extended the county‑wide hiring restriction through October 31 2025, with one legislator voting against. Additional actions included reappointing the Director of Real Property Services, approving the purchase of three tax‑foreclosed parcels, authorizing a health‑department MOU with the Sheriff’s Department, and accepting $300,000 of federal Flexible Fund for Family Services funding.

Tue Aug 26, 2025

Board of Health

Cayuga Board of Health meets to approve July minutes and claims

The Cayuga County Board of Health will convene on August 26, 2025, at 12:15 PM to conduct routine business including approving the minutes from the July 22 meeting and claims approved by the fiscal manager. Department heads will provide updates on public health services, community health, and education programs.

healthpublic-healthboard-meetingclaimsminutes
✓ Decided: Board of Health unanimously approves minutes, claims, and consent orders

The Cayuga County Board of Health approved the July 22, 2025 meeting minutes. It also approved the recent financial claims and the hearing and consent orders for the Tacos Guanajuato mobile food service and the Knapp Property. The meeting was then adjourned.

Thu Aug 21, 2025

General Municipal Law 239-l, m & n Review Committee

Committee reviews three local laws on zoning, junkyards, and subdivisions

The Cayuga County GML 239-l, m & n Review Committee meets to evaluate three local laws from the Town of Montezuma and Town of Sennett, as well as a comprehensive plan update from the Village of Cayuga. The committee will assess potential intermunicipal or countywide impacts and may approve, disapprove, or request additional material.

zoningcomprehensive-planjunkyardsubdivisionlocal-law-review
✓ Decided: Committee approved four local law actions, all without changes

The Cayuga County GML 239‑l, m & n Review Committee voted to approve four local law proposals submitted by the Village of Cayuga and the towns of Montezuma and Sennett. Each motion was carried with an all‑aye vote and no changes were recommended. The actions were deemed to have no intermunicipal concerns and are considered local matters only.

Wed Aug 20, 2025

Water & Sewer Authority Board

Water & Sewer Authority board meets to review contracts and projects

The Cayuga Water & Sewer Authority Board reviews draft minutes, financial reports, and updates on waterline projects, sewer plans, and contract negotiations. No formal decisions are listed on this procedural agenda.

watersewercontractsfinanceprocedural
✓ Decided: CCWSA approved $7,500 for water‑hammer mitigation services

The board unanimously approved routine items including the agenda, prior meeting minutes and payment of open invoices. It also approved a $7,500 allocation for water‑hammer mitigation, adopted new vision and mission statements, and scheduled a public informational meeting on September 3 2025 about the proposed sewer district. Additionally, the board authorized an executive session and adjourned the meeting.

Tue Aug 19, 2025

Ways & Means Committee

Ways & Means committee to vote on cannabis tax, property purchases, and hiring limits

The Cayuga County Ways & Means Committee will review and vote on several resolutions, including accepting adult-use cannabis sales tax revenue, purchasing tax-foreclosed properties, and extending hiring restrictions. The committee will also hear departmental updates on tax collection, foreclosure processes, and financial audits.

taxationcannabisproperty-purchaseshiring-policyforeclosuresecuritybudgetaudit
✓ Decided: Committee approves cannabis tax, foreclosed property purchase, and health contracts

The Ways & Means Committee approved the minutes from July 15, 2025. It adopted several resolutions, including authorizing the Finance Director to accept adult‑use cannabis sales tax and approving the purchase of a tax‑foreclosed property. Additional actions approved contracts for cleaning services, museum carpet replacement, EV charging stations, and a vehicle‑policy amendment.

Thu Aug 14, 2025

Planning & Economic Development Committee

Planning committee reviews housing grants, zoning updates, and lake restoration projects

The Cayuga County Planning & Economic Development Committee receives updates on multiple infrastructure and housing-related projects, including a county grant program for new housing, zoning amendments for the Town of Mentz, and land-use planning for the Town of Conquest. The committee also hears about water quality initiatives, including Owasco Lake restoration and Cayuga Lake Scenic Byway planning.

housingzoningwater-qualitygrantsinfrastructureland-useeconomic-development
✓ Decided: Joe Kinsella appointed to CCPUSA for remainder of term ending Dec 31 2025

The Planning & Economic Development Committee approved the July 10 2025 meeting minutes unanimously. The committee also appointed Joe Kinsella to the Cayuga County Public Utility Service Agency to serve the unexpired term of Jeff Eades (1‑1‑22 to 12‑31‑25). No other substantive actions were taken.

Thu Aug 14, 2025

Government Operations Committee

Government Operations Committee reviews department updates and DREAMS project

The committee is reviewing monthly operational reports from the Board of Elections, County Clerk, and IT department. Discussions include the progress of the DREAMS digitization project and various IT infrastructure upgrades.

government-operationsdigitizationit-infrastructurebudgetcounty-clerkdmv
✓ Decided: Committee approved July 10, 2025 minutes unanimously

The Government Operations Committee approved the minutes from the July 10, 2025 meeting. The motion was made by Nightengale, seconded by Daly, and all members voted in favor. No other substantive actions were decided during this session.

Wed Aug 13, 2025

Health & Human Services Committee

Committee approves $59,229 reimbursement for health department services

The Health & Human Services Committee will approve minutes from the July 9 meeting and consider resolutions to reimburse the Sheriff's Department and County Attorney's Office for public health services, accept $300,000 in federal funding, and authorize contracts for energy assistance and software.

healthbudgetsocial-servicescontractsappointmentsreimbursementfunding
✓ Decided: Committee approves multiple health and social services contracts and budget changes

The Health & Human Services Committee approved the July 9, 2025 minutes and authorized several reimbursements, contracts, and budget amendments. Key actions include accepting full federal funding for family services, contracting with Community Action Programs for HEAP outreach and rapid‑rehousing, and adjusting the mental‑health budget. All motions passed unanimously except one abstention on the mental‑health budget amendment.

Tue Aug 12, 2025

Public Works Committee

Public Works Committee to consider cleaning contracts and highway staffing

The committee is reviewing department updates on water, sewer, and highway projects. Members will consider resolutions for building cleaning contracts and filling four motor equipment operator positions.

contractshiringsewerroadsfacilities-maintenance
✓ Decided: County approves $500,000 ARPA transfer for Cayuga Lake Protection Plan

The committee unanimously approved a $500,000 ARPA fund transfer for the Cayuga Lake Protection Plan. It recorded that the project received a $2.5 million community project grant. The board also authorized cleaning‑service contracts for several county buildings and referred four highway staffing positions to the full Legislature. The July 8, 2025 minutes were approved and the meeting was adjourned.

Tue Aug 12, 2025

Judicial & Public Safety Committee

Cayuga County considers 911 center security upgrades and staffing increases

The Judicial & Public Safety Committee is reviewing several resolutions to expand 911 and Sheriff's Office staffing. The body is also discussing contracts for 911 tower security and HVAC maintenance, as well as updates on public safety grants.

public-safety911sheriffgrantsstaffingcourts
✓ Decided: Committee approved new security cameras, CAD system, and multiple staffing hires

The Judicial & Public Safety Committee authorized a contract with Lantek Security & Automation to install security cameras at 911 tower sites and the 911 Center. It also approved a contract with Motorola Solutions for a Computer Aided Dispatch, mapping, records management and mobile services. The committee created three budgeted Emergency Services (HELP) positions, filled a vacant dispatcher role, and approved HVAC maintenance with Postler and Jaeckle. Sheriff hiring resolutions and a media agreement for the STOP DWI program were also adopted, with all votes in favor except two where one member opposed.

Tue Aug 12, 2025

Human Resources & Civil Services Commission

Cayuga County approves new eligible lists for 23 job openings

The Cayuga County Civil Service Commission held a regular meeting to review and approve new eligible lists for multiple job openings across county departments. The commission also discussed rule changes approved by the NYS Civil Service Commission and received an administrative report on hiring, training, and employee recognition activities.

civil-servicehiringjob-openingspublic-healthpolicetraining
✓ Decided: Commission approved new position duties for six public jobs

The Civil Service Commission unanimously approved the minutes from the July 8, 2025 meeting. It extended the eligible exam lists for several positions and expired other eligible lists as specified. The commission also approved new position duties statements for an Environmental Health Technician, Student Aide, School Crossing Guard, Laborer, Motor Equipment Operator, and Police Officer. The next meeting was scheduled for September 9, 2025.

Wed Aug 6, 2025

Water & Sewer Authority Board

Water & Sewer Authority to discuss Cayuga Lake Protection Project

The Board of Directors will meet to review the agenda and discuss the Cayuga Lake Protection Project in the Town of Throop.

watersewerenvironmental-protection
✓ Decided: Board approved water service start for Town of Throop on Aug 17, 2025

The board entered an executive session to discuss litigation with the Town of Throop, then adjourned that session. The board confirmed it will turn on water service for the Town of Throop on August 17, 2025. The meeting was then adjourned.

Thu Jul 24, 2025

Community Services Board

Community Services Board to vote on Nominating Committee follow-up

The Community Services Board will meet to review financial reports and receive updates from subcommittees. The board is scheduled to hold a vote regarding a July 14, 2025, Nominating Committee follow-up.

community-servicesmental-healthsubstance-usedisability-services
✓ Decided: Board approved June 2025 minutes and adjourned the meeting

The board approved the June 2025 minutes after a motion by Shannon Abate, seconded by Elizabeth Signorelli. The meeting was then adjourned at 12:58 PM following a motion by Andrea Hansen, seconded by Michelle VanGiesen. No other substantive actions were taken.

Thu Jul 24, 2025

Health Insurance Consortium Board of Directors

Health Insurance Consortium Board to discuss rate renewals

The Board of Directors will review medical and dental financial claims and balance sheet updates from USI. Members will also discuss rate renewals and receive updates on wellness, marketing, and Article 47.

health-insurancefinancebenefits
✓ Decided: Board approved consent agenda and adjourned the meeting

The board voted to approve the consent agenda, previous minutes, and financial reports. The meeting was then adjourned at 11:35 a.m.

Wed Jul 23, 2025

Parks & Trails Commission

Parks Commission reviews equipment purchases and facility repairs

The Commission is reviewing several June resolutions regarding equipment and facility upgrades. The body is also discussing ongoing design projects at Emerson Park and funding for an accessible kayak launch at Owasco Flats.

parkstrailsgrantsinfrastructureemerson-park
✓ Decided: Commission authorized park purchases, contracts and noted a board resignation

The commission approved several June resolutions authorizing a Kubota RTV purchase, a land‑water conservation reaffirmation, replacement of Emerson Park pavilion emergency exit doors, window film installation at Sterling Nature Center, and acceptance of the NYS SWIMS Grant. The renewal of the A&M Catering contract was approved and is awaiting vendor execution. The board noted the resignation of Joseph Deforest and the meeting was adjourned unanimously.

Tue Jul 22, 2025

Legislature

Cayuga County Legislature to consider Nucor Steel tax settlement and bridge projects

The Legislature is deciding on a tax assessment settlement with Nucor Steel Auburn, Inc. and funding for two bridge replacements. The body is also discussing the 2025-2026 budget for Cayuga Community College and the creation of six caseworker positions.

taxesinfrastructurebudgetsocial-serviceseducation
✓ Decided: County Legislature approves Nucor Steel tax settlement and related actions

The Legislature approved the settlement of Nucor Steel’s tax assessment case, authorizing the Special Counsel to finalize the agreement and directing the Treasurer to update tax records. It also approved the purchase of a tax‑foreclosed parcel at 2696 Jefferson St for $11,075.58, transferred $111,036 of insurance costs to the appropriate departments, and authorized the filling of a Social Services Attorney vacancy. The body created six non‑competitive Help Program caseworker positions, approved a contract with CiTi BOCES for audiology services, and authorized the Health Director to accept Juul settlement funds.

Tue Jul 22, 2025

Board of Health

Cayuga County Board of Health to review department and clinic reports

The Board of Health will meet to approve claims and review updates from various health departments. The agenda includes reports on communicable diseases, immunizations, and the MCH Program.

public-healthimmunizationswicenvironmental-health
✓ Decided: Board approved hearing and consent orders for multiple facilities

The Board of Health approved the minutes from the June 24, 2025 meeting, approved recent financial claims, and approved the hearing and consent orders for several establishments. All motions passed with unanimous support from members present.

Thu Jul 17, 2025

Mental Health Sub-Committee

Mental Health Subcommittee to hold elections for Chair and Vice Chair

The Cayuga County Community Services Board Mental Health Subcommittee will meet to discuss the Local Services Plan and the Mental Health Task Force. The body will also hear reports from several behavioral health and counseling agencies.

mental-healthcommunity-servicespublic-healthgovernment-administration
✓ Decided: Emily Hitchcock elected Chair and Meghan Rusco Vice Chair of Mental Health Subcommittee

The subcommittee approved the June 18, 2025 minutes. Emily Hitchcock was elected Chair and Meghan Rusco was elected Vice Chair. No other substantive actions were taken at this meeting.

Thu Jul 17, 2025

General Municipal Law 239-l, m & n Review Committee

Committee to review concrete facility and solar array site plans

The Cayuga County GML 239-l, m & n Review Committee will meet to evaluate local actions for potential intermunicipal or countywide impacts. The body will review site plans for two projects in the towns of Sennett and Scipio.

zoningsite-planssolar-energyindustrial-developmentintermunicipal-review
✓ Decided: Committee approved prior minutes and two town site‑plan proposals

The committee approved the minutes from the June 18, 2025 meeting. It approved the Town of Sennett’s concrete‑mix facility site plan without changes. It approved the Town of Scipio’s solar‑array site plan, noting it is a local‑only matter. All motions passed with unanimous AYE votes.

Wed Jul 16, 2025

Water & Sewer Authority Board

Water & Sewer Authority to review waterline and sewer projects

The Board will review financial reports and receive updates on several infrastructure projects. The meeting includes reports from the Director, Attorney, Advisor, and Engineer.

water-infrastructuresewercontractspublic-works
✓ Decided: Board unanimously approved signing the NBRC resolution

The board accepted the June 18 and July 2 meeting minutes without opposition. A motion to pay open invoices, including one from M. Colopy, was unanimously approved. The board also approved the attorney’s NBRC resolution for the chairman to sign. The meeting was then adjourned unanimously.

Tue Jul 15, 2025

Ways & Means Committee

Ways & Means Committee to consider Nucor Steel tax settlement

The committee will review budget presentations from several departments and consider resolutions regarding tax foreclosures and infrastructure. A key item is a proposed settlement for tax certiorari proceedings involving Nucor Steel Auburn, Inc.

budgettaxesinfrastructureroadspublic-safety
✓ Decided: Ways & Means Committee approves college budget and key property and public works actions

The committee approved the June 17, 2025 minutes and authorized the purchase of a tax‑foreclosed property. It settled the Nucor Steel assessment case, approved the 2025‑2026 budget for Cayuga Community College, and created six new caseworker positions in Social Services. The committee also accepted Juul Settlement funds, funded the Dunning Avenue culvert replacement, and contracted UPS maintenance for the Backup 911 Center.

Thu Jul 10, 2025

Water Quality Management Agency (WQMA)

WQMA to hear presentation on volunteer water quality monitoring

The Water Quality Management Agency will receive a presentation from the Community Science Institute regarding volunteer monitoring in the Cayuga Lake Watershed. The meeting also includes reports from agency working groups, county departments, and lake associations.

water-qualityenvironmentcayuga-lakevolunteer-monitoringwatershed-management
✓ Decided: WQMA cancels August meeting and approves prior minutes

The agency accepted the June 5, 2025 meeting minutes after a motion by Dan Welch and a second by Ann Robson, passing unanimously. A motion by Doug Kierst to cancel the August meeting was seconded by Keith Batman and also passed unanimously. The board then adjourned the July 10 meeting unanimously.

Thu Jul 10, 2025

Planning & Economic Development Committee

Cayuga County receives $1 million grant for Auburn housing infrastructure

The Planning & Economic Development Committee is reviewing department updates on various municipal grants, land use regulations, and environmental projects. The body is tracking the administration of housing and small business funds and the progress of local zoning amendments.

housingzoninggrantsinfrastructureenvironmenteconomic-development
✓ Decided: Planning & Economic Development Committee approved June 12 minutes, no other actions

The committee approved the minutes from the June 12, 2025 meeting after a motion by Winslow and a second by Daly, with all members in favor. No additional resolutions, approvals, or denials were recorded. The meeting consisted mainly of departmental updates and no further decisions were made.

Thu Jul 10, 2025

People with Development Disabilities Sub-Committee

Cayuga County People with Developmental Disabilities Subcommittee meets July 10

The subcommittee will meet to review agency reports and conduct general business. The agenda consists of procedural items and reports from service providers.

disability-servicescommunity-servicescounty-government
Thu Jul 10, 2025

Government Operations Committee

Government Operations Committee reviews department updates and records projects

The committee received operational updates from the Board of Elections, County Clerk, and IT departments. Discussions focused on voter registration data, DMV revenue, and the progress of a $4 million records digitization project.

electionsbudgetitrecords-managementdmvgovernment-operations
✓ Decided: Committee approved June 12, 2025 meeting minutes

The Government Operations Committee approved the minutes from the June 12, 2025 meeting. The motion was made by Nightengale, seconded by Daly, and all members voted in favor.

Wed Jul 9, 2025

Health & Human Services Committee

Committee considers hiring social services staff and contracting audiological services

The Health & Human Services Committee is reviewing resolutions to fill a Social Services Attorney position and create six Caseworker positions. The body is also discussing a contract for preschool audiological services and the acceptance of Juul Settlement funds.

social-servicespublic-healthhiringcontractssenior-services
✓ Decided: Committee approves contracts, hires, and settlement acceptance

The Health & Human Services Committee approved the June 11 minutes and appointed Donna Sowles to the Board of Health. It authorized the chair and public health director to contract with CiTi BOCES for audiological services for children and to accept Juul Settlement funds. The committee also approved hiring a Social Services Attorney and creating six new caseworker positions in the Department of Social Services.

Tue Jul 8, 2025

Public Works Committee

Public Works Committee considers $1.3 million culvert replacement on Dunning Ave

The committee is reviewing department updates on water, sewer, and highway maintenance. Members are considering resolutions to fund bridge and culvert replacements using Bridge NY funds.

roadssewerbridgesbudgetwater
✓ Decided: Committee approved funding for two bridge replacement projects

The Public Works Committee approved the June 10, 2025 minutes. It unanimously approved a bundled resolution authorizing 100% funding for the Dunning Avenue culvert replacement over Crane Brook and the N Division Street bridge replacement over the Owasco Outlet. The resolutions also allow reimbursement from federal, state, or Bridge NY funds and authorize the Chair of the Legislature to execute agreements.

Tue Jul 8, 2025

Human Resources & Civil Services Commission

Cayuga County Civil Service Commission to review eligible lists and job specifications

The Commission is meeting to establish and extend eligible lists for various county positions. The body will also consider adopting or amending class specifications and reviewing new position duties statements.

civil-serviceemploymentgovernment-administrationhiring
✓ Decided: Commission extended eligible lists for 16 positions and approved multiple hiring actions

The Cayuga County Civil Service Commission unanimously approved extending the eligible lists for sixteen positions for one year. It also adopted a new class specification for Social Work Assistant (Schools), amended specifications for several library and fire‑coordinator positions, approved new duties statements for five new positions, and approved reinstatements for two employees. The next meeting was scheduled for August 12, 2025.

Tue Jul 8, 2025

Judicial & Public Safety Committee

Cayuga County considers 911 maintenance and probation budget transfers

The Judicial & Public Safety Committee is reviewing department updates and three resolutions. Key items include a maintenance contract for the Backup 911 Center and a budget transfer for probation GPS monitoring.

public-safety911probationsheriffbudgetemergency-services
✓ Decided: Committee approves UPS maintenance contract and key budget and staffing changes

The Judicial & Public Safety Committee approved the June 10, 2025 minutes. It passed three resolutions: authorizing a transfer of funds in the Probation Budget, changing the Sheriff’s Employees Association contract to allow qualified lateral transfers, and authorizing a one‑year UPS maintenance contract with Gruber Power Services. All motions were adopted, with the budget transfer passing 2‑3 and the others unanimously.

Wed Jul 2, 2025

Alcohol & Substance Use Sub-Committee

Cayuga County Alcohol & Substance Use Sub-Committee Meeting

The Alcohol & Substance Use Sub-Committee will meet to conduct regular business. The agenda consists of procedural items, including agency reports and a director's report.

community-servicessubstance-usepublic-health
✓ Decided: June 2025 subcommittee minutes approved

The subcommittee approved the draft minutes from the June 4, 2025 meeting after a motion and second. The meeting was then adjourned on a motion. No other substantive actions were taken.

Wed Jul 2, 2025

Water & Sewer Authority Board

Water & Sewer Authority to review insurance renewal and infrastructure projects

The Board will discuss financial matters including insurance renewal and receive updates on water and sewer projects. The meeting includes reports from the director, attorney, advisor, and engineer.

watersewerinfrastructureinsurancecontracts
✓ Decided: Board approved new insurance contract with Trident Public Risk

The board unanimously approved switching the water authority’s insurance carrier to Trident Public Risk, accepting a quote that lowers the premium to $24,923 per year. They also unanimously approved signing a letter of engagement with Bond, Schoeneck, & King and amended the Northern Border Regional Commission paperwork. An executive session on litigation was opened, later adjourned, and the meeting was adjourned at 2:21 PM.

Thu Jun 26, 2025

Community Services Board

Community Services Board to meet June 26

The Community Services Board will meet to review financial reports and receive updates from various subcommittees. The agenda consists of procedural items and standing reports.

community-servicesmental-healthsubstance-usedisability-services
✓ Decided: Sumner Youngs nominated to the Mental Health Subcommittee

The board approved the May 22 meeting minutes as submitted. A motion to nominate Sumner Youngs to the Mental Health Subcommittee was carried. An executive session was called to discuss a personnel appointment. The meeting was adjourned at 1:05 pm.

Thu Jun 26, 2025

Health Insurance Consortium Board of Directors

Health Insurance Consortium Board to review financial claims and balance sheets

The Board of Directors will meet to approve previous minutes and financials. The session includes updates from USI regarding medical and dental financial claims and the current balance sheet.

health-insurancefinanceclaimsboard-meeting
✓ Decided: Board approved new wellness program and high‑deductible health plan options

The board approved the consent agenda and prior minutes. It adopted the Suggested Wellness Program for 2025‑2026 to streamline member services. It also approved offering High‑Deductible Health Plans to members during open enrollment. The meeting was adjourned at 11:26 a.m.

Wed Jun 25, 2025

Parks & Trails Commission

Parks Commission to authorize equipment purchase and grant acceptance

The Parks & Trails Commission is meeting to vote on several authorizations, including equipment purchases and a state grant. The body will also review project updates for Emerson Park and the Sterling Nature Center.

parksgrantsequipmentinfrastructurenature-centers
✓ Decided: Commission approved equipment purchase, facility upgrades, and grant acceptance

The March meeting minutes were not approved because there was no quorum. In June, the commission authorized the purchase of a Kubota RTV, the replacement of Emerson Park pavilion emergency exit doors, the installation of window film at Sterling Nature Center, the execution of a land‑ and water‑conservation reaffirmation, and the acceptance of a NYS SWIMS grant with a contract to the NYS Department of State.

Tue Jun 24, 2025

Legislature

Cayuga County considers $7 million broadband project and tax levy override

The Legislature will hold a public hearing on a local law to override the tax levy limit. Members are also deciding on a $7 million broadband infrastructure project and various county department contracts.

broadbandtaxesinfrastructurepublic-healthcontracts
✓ Decided: Legislature approves multiple contracts and staffing hires, including $76,937 health grant

The Cayuga County Legislature approved a series of contracts for employee assistance, vending services, nursing, public‑health preparedness, senior aide services, and two staffing positions in the Social Services department. All motions passed with unanimous support except one dissent on the Employee Assistance Program contract. The public‑health grant authorizes up to $76,937 for preparedness activities for FY 2025‑2026.

Tue Jun 24, 2025

Board of Health

Cayuga County Board of Health to review admin fee adjustments and license relinquishment

The Board of Health will meet to approve claims and an administrative fee scale adjustment. The body will also discuss the relinquishment of an LHCSA license and state and federal budget impacts.

public-healthfeeslicensingbudgetenvironmental-health
✓ Decided: Board approved 2025 immunization fee increase to $25 and LHCSA license relinquishment

The Board unanimously approved the May 27, 2025 minutes, recent expense claims, and the 2025 immunization fee scale, raising the fee from $18 to $25. Members nominated Donna Sowles for the vacant Board seat, with the appointment to be considered at the July Legislative meeting, and approved the Department’s request to relinquish its LHCSA license. Additional actions included approving the Healthy Neighborhoods budget, approving several environmental‑health hearing and consent orders, and entering then exiting an executive session.

Wed Jun 18, 2025

Mental Health Sub-Committee

Mental Health Subcommittee to discuss hoarding awareness and agency reports

The Cayuga County Community Services Board Mental Health Subcommittee will meet to hear presentations on hoarding awareness and agency report updates. The body will also review the Local Services Plan and a prospective new team leader for the Mental Health Task Force.

mental-healthpublic-healthcommunity-serviceshoarding-awareness
✓ Decided: May 2025 minutes approved by the Mental Health Subcommittee

The subcommittee approved the draft minutes from the May 2025 meeting after a motion by Caroline Dixon, seconded by Sumner Youngs. The meeting was then adjourned by a motion from Meghan Rusco, seconded by Caroline Dixon. No other business was acted upon.

Wed Jun 18, 2025

General Municipal Law 239-l, m & n Review Committee

Cayuga County reviews local laws and site plans for several towns and villages

The GML 239-l, m & n Review Committee is meeting to evaluate local actions for potential intermunicipal or countywide impacts. The committee will determine if proposed actions are of local concern or require recommendations for approval or disapproval.

zoningland-usesolarinfrastructureindustrial-development
✓ Decided: Committee approved land use actions: solar moratorium, warehouses, cell towers

The Cayuga County GML 239‑l, m & n Review Committee approved several local actions. It recommended approval of the Town of Conquest land‑use regulation, the Village of Cayuga solar moratorium, and warehouse projects in the Town of Aurelius. It also approved two cell‑tower special‑use permits in the Town of Sterling and requested additional materials for the Village of Moravia gas‑storage site plan. All motions passed with unanimous AYE votes.

Wed Jun 18, 2025

Water & Sewer Authority Board

Water & Sewer Authority to review insurance quotes and employee policies

The Board will review accounts payable and insurance quotes from Andy Tehan. Members will discuss updates to the employee handbook and social media policy. The meeting includes updates on several waterline and sewer projects.

watersewerpersonnel-policyinfrastructureinsurance
✓ Decided: CCWSA approved becoming a non‑voting member of the OLWC

The board unanimously approved the minutes from May 21 and May 27, 2025, and approved payment of all open invoices. It also unanimously tabled discussion of the insurance renewal until the July 2 special meeting and unanimously approved CCWSA becoming a non‑voting member of the Owasco Lake Watershed Consortium. The board entered and exited an executive session and adjourned the meeting.

Tue Jun 17, 2025

Ways & Means Committee

Ways & Means Committee to review county contracts and department updates

The committee is deciding on several service contracts, including employee assistance and vending services. Members will also receive updates on tax collections, foreclosure processes, and various department relocations.

contractspersonneltax-collectionpublic-worksgovernment-operations
✓ Decided: Ways & Means Committee approved health contracts, datacenter upgrade, lease extension

The committee approved several health service contracts, a datacenter infrastructure purchase, and a lease extension for county office space. All motions passed with either unanimous support or with a single dissent. The approvals include employee assistance services, vending contract extension, and hiring of emergency dispatchers.

Thu Jun 12, 2025

Planning & Economic Development Committee

Planning Committee reviews $9.7 million DRI grant projects

The committee is reviewing updates on the implementation of Downtown Revitalization Initiative (DRI) grants for the villages of Cayuga, Union Springs, and Aurora. The body is also discussing land use regulations for the Town of Conquest and zoning amendments for the Town of Mentz.

zoningeconomic-developmentgrantsplanninginfrastructure
✓ Decided: Approved May 8 minutes and appointed three board members

The committee approved the May 8, 2025 meeting minutes with all members in favor. It appointed Cathy Peluso and Brian Muldrow to the Cayuga Cortland Workforce Development Board for terms from June 24, 2025 to June 23, 2027. It also appointed Ray DeJohn to the Cayuga County Planning Board.

Thu Jun 12, 2025

People with Development Disabilities Sub-Committee

Cayuga County People with Developmental Disabilities Subcommittee Meeting

The subcommittee will meet to review agency reports and conduct general business. The agenda consists of procedural items and reports from local service providers.

developmental-disabilitiescommunity-servicesagency-reports
✓ Decided: Subcommittee approved April 2025 minutes and adjourned the meeting

The committee approved the April 2025 minutes as submitted after a motion and second. The Daytime Mobile Crisis program was reported as having received $138,000 funding through an OMH grant. No new or old business was taken up. The meeting was adjourned at 12:39 PM.

Thu Jun 12, 2025

Government Operations Committee

Committee considers relocating primary County datacenter

The Government Operations Committee is reviewing a resolution to purchase network connectivity and infrastructure to move the primary County datacenter. The current location in the Cayuga County Office Building is closed due to health and safety concerns.

it-infrastructuregovernment-operationsveterans-affairselectionspublic-safety
✓ Decided: Committee authorized CIO to purchase network connectivity for datacenter move

The committee approved the June 12 meeting minutes unanimously. It approved eight appointments to the Veteran’s Advisory Board. The Cayuga County Spending Policy was amended by unanimous vote. The committee also authorized the Chief Information Officer to purchase network connectivity and infrastructure for relocating the primary county datacenter.

Thu Jun 12, 2025

Legislature

Cayuga County Legislature to appoint new District 10 legislator and department head

The Cayuga County Legislature is meeting to fill two key vacancies and approve infrastructure and emergency software updates. The body will vote on appointing a new legislator for District 10 and a Superintendent of Buildings and Grounds.

appointmentsbroadbandemergency-servicesgovernment-administrationbudget
✓ Decided: Cayuga County appointed Amy Sargent to fill District 10 legislator seat

The Legislature approved four resolutions. Kevin VanBeveren was appointed Superintendent of Buildings & Grounds with a $100,000 salary. The CNYNET broadband network project was classified as a Type II SEQRA action. $90,240 was transferred to fund additional 911 backup software. Amy Sargent was appointed to serve as Legislator for District 10 through December 31, 2025.

Wed Jun 11, 2025

Planning Board

Cayuga County Planning Board to meet June 11

The board will meet to conduct internal business and review county planning updates. The session includes a review of minutes from the GML 239-l, m & n Committee and local status reports.

planningcounty-governmentprocedural
✓ Decided: Planning Board unanimously approves March 19 meeting minutes

The board approved the minutes from the March 19, 2025 meeting after a motion by David Lipiska and a second by Deborah Ross. All members voted AYE and the motion carried. No other actions were decided; the remainder of the meeting consisted of project and status updates.

Wed Jun 11, 2025

Health & Human Services Committee

Health & Human Services Committee to review health and social service contracts

The committee is deciding on several staffing fills and service contracts for public health, social services, and the Office for the Aging. The meeting includes updates on public health budget impacts and senior citizen services.

public-healthsocial-servicessenior-servicescontractsbudgetstaffing
✓ Decided: County approved multiple senior care and public‑health service contracts

The committee unanimously approved a bundle of resolutions authorizing contracts with Access to Home and Turner’s Helping Seniors LLC to provide aide services for seniors. It also approved contracts for personal care services, a public‑health preparedness agreement with HRI, and RN services for a preschool special‑education student. Additional approvals included hiring seasonal clerks, a head social‑welfare examiner, and accepting Summer Youth Employment Program funding, followed by motions to enter and exit executive session and to adjourn.

Tue Jun 10, 2025

Public Works Committee

Public Works Committee to consider lease extension and HVAC repairs

The committee will review resolutions for a building lease extension and HVAC maintenance. The meeting also includes department updates on water, sewer, highway, and soil and water projects.

leasinghvacpavingsewerwater-managementroads
✓ Decided: Committee approved additional paving funds and building lease extensions

The Public Works Committee approved the minutes from May 13, 2025. It authorized the acceptance of additional paving funds. It approved a twelve‑month lease extension for the third‑floor of 2 State Street in Auburn. It also approved a repair contract for the HVAC unit at the Hardenburgh Building. All motions passed unanimously.

Tue Jun 10, 2025

Judicial & Public Safety Committee

Committee considers filling five public safety vacancies

The Judicial & Public Safety Committee is reviewing resolutions to fill two Supervising Emergency Services Dispatcher positions and three Deputy Sheriff (Custody) positions. The meeting also includes departmental updates on 911 staffing, jail populations, and legal grant funding.

public-safetystaffing911sheriffbudgetgrants
✓ Decided: Sheriff authorizes hiring three deputies; 911 approves two dispatcher positions

The committee approved the prior meeting minutes from May 13, 2024. It authorized filling two full‑time Supervising Emergency Services Dispatcher positions under resolutions JP‑1 and JP‑2. It also authorized the Sheriff to fill three vacant Deputy Sheriff (Custody) positions under resolution JP‑3. The meeting was adjourned at 4:25 PM.

Tue Jun 10, 2025

Human Resources & Civil Services Commission

Cayuga County Civil Service Commission to review eligible lists and job duties

The commission is meeting to establish and expire various civil service eligible lists. The body will also review amendments to class specifications and new position duty statements for local municipalities.

civil-serviceemploymentgovernment-administrationhiring
✓ Decided: Commission extended some eligible exam lists and expired others

The commission voted unanimously to extend the eligible lists for the 2024 Library Assistant (Online T&E) and Senior Network Administrator exams for one year, and to expire the eligible lists for Account Clerk Typist, Early Intervention Services Coordinator, Health Home Care Manager, Social Worker, Staff Social Worker (CMH), and Staff Social Worker (Jail). It also amended the class specification for Deputy Sheriff (Navigation) and approved new position duties statements for a Building Inspector & Code Enforcement Officer in Fair Haven and a Laborer in Port Byron. The commission accepted an exempt classification review for a Secretary to District Superintendent position and scheduled the next meeting for July 8 2025.

Thu Jun 5, 2025

Water Quality Management Agency (WQMA)

Water Quality Management Agency to receive invasive species update

The agency will hear a presentation on invasive species in Cayuga County from Michele Wunderlich. The meeting includes reports from various county departments, lake associations, and partner organizations.

water-qualityinvasive-speciesenvironmentcayuga-county
✓ Decided: WQMA approved May 1 minutes and adjourned the June 5 meeting

The agency voted to accept the May 1, 2025 meeting minutes as written, with a unanimous vote. A motion to adjourn the June 5, 2025 meeting was also passed unanimously. No other formal actions requiring a vote were recorded.

Wed Jun 4, 2025

Alcohol & Substance Use Sub-Committee

Alcohol & Substance Use Sub-Committee meeting scheduled for July 2, 2025

The Alcohol & Substance Use Sub-Committee will meet to conduct routine business. The agenda consists of procedural boilerplate items.

community-servicessubstance-usepublic-health
Fri May 30, 2025

Human Resources & Civil Services Commission

Commission to consider caseworker transfer from Oswego County

The Cayuga County Civil Service Special Commission is meeting to discuss personnel matters. The primary item is a request from Social Services regarding a staff transfer.

civil-servicepersonnelsocial-servicesemployment
✓ Decided: Commission approved transfer of Oswego County caseworker

The commission opened the special meeting at 8:03 a.m. by unanimous motion. It approved the Social Services request to transfer a caseworker from Oswego County, directing staff to notify the appointing authority. The meeting was adjourned at 8:12 a.m. by unanimous vote.

Wed May 28, 2025

Parks & Trails Commission

Parks commission to vote on fireworks, catering, and playground grant

The Cayuga County Parks Commission will vote on April resolutions including a new fireworks display contract, a catering renewal, and a lift-station maintenance agreement. The meeting will also receive updates on park projects, fundraising efforts by Friends groups, and trail maintenance across multiple locations.

parksfireworkscateringtrailsfundingmaintenancegrant
✓ Decided: Commission backs completion of disc golf signage project

The commission approved the March meeting minutes by unanimous vote. It expressed support for moving forward with the disc golf signage project, encouraging donations for the signage. The meeting was then adjourned by a motion and second with all members in favor.

Tue May 27, 2025

Legislature

Legislature to vote on salary increases, hiring freeze, and $513K mortgage tax payout

The Cayuga County Legislature will decide on salary increases for elected and appointed officers, implement a hiring freeze through August 31, and distribute $513,664.05 in mortgage tax revenue to local municipalities. The meeting also includes votes on renewing contracts for homeless housing and rabies program funding, as well as IT and pest control service agreements.

salary-increaseshiring-freezemortgage-taxrabies-programhomeless-servicesit-contractspest-controlcayuga-county
✓ Decided: County approves $513,664.05 mortgage tax distribution to local municipalities

The Cayuga County Legislature approved the distribution of $513,664.05 in mortgage tax revenues to the City of Auburn and various towns and villages. It also authorized an emergency contract with Sessler Environmental Services for building access, adopted hiring restrictions for county staff, and approved funding for a two‑year rabies program and a rental supplement program. Additionally, the Legislature approved the filling of a vacant caseworker position and ratified the minutes from April 2 and 22, 2025.

Tue May 27, 2025

Board of Health

Cayuga Board of Health to approve April minutes and claims

The Cayuga County Board of Health will hold its May 27, 2025 meeting to approve the minutes from the April 22 meeting and review department updates. No major decisions or policy changes are listed on the agenda.

healthpublic-healthboard-meetingprocedural
✓ Decided: Board approved hearing and consent orders for multiple properties

The Board of Health approved the minutes from the April 22, 2025 meeting. It also approved the April 2025 financial claims presented by the Fiscal Manager. The Board approved the hearing and consent orders for several establishments and properties listed in the agenda. The meeting was then adjourned.

Tue May 27, 2025

Water & Sewer Authority Board

Water & Sewer Authority to discuss contractor rate increase and sewer map plan

The Board of Directors will meet to review a rate increase for contractor Jay Sawyer. The board will also discuss the Map Plan Report for the Cayuga Lake Protection Plan regarding the sanitary sewer on Honoco Road.

water-sewercontractsinfrastructuresanitary-sewer
✓ Decided: Board unanimously approved updated Cayuga Lake Protection Plan map report

The board approved a rate increase for contractor Jay Sawyer, raising his pay to $36 per hour. The May 2025 version of the Cayuga Lake Protection Plan Sanitary Sewer Map Plan Report was approved after corrections and cost additions. The board entered and later adjourned an executive session on litigation matters before adjourning the meeting.

Thu May 22, 2025

Community Services Board

Cayuga County Community Services Board meets May 22 with public comment period

The Cayuga County Community Services Board will convene at noon in Auburn to review minutes, hear public comments, receive the director’s report, and hear subcommittee updates on alcohol/substance use, developmental disabilities, mental health, and nominations.

community-servicespublic-hearingmental-healthsubstance-usedevelopmental-disabilities
✓ Decided: Board approved April meeting minutes and adjourned

The board approved the minutes from the April 24, 2025 meeting after a motion by Timothy Donovan and a second by Sumner Youngs; the motion carried. The board then adjourned the meeting by a motion from Andrea Hansen, seconded by Stephen Smith; the motion carried.

Thu May 22, 2025

Health Insurance Consortium Board of Directors

Board to review 2025 health-insurance claims and explore Article 47 changes

The Cayuga Health Insurance Consortium Board of Directors will meet on May 22, 2025, to approve the consent agenda (previous minutes and financials), receive updates on medical and dental claims, and hear wellness and marketing reports. The board will also explore potential changes under Article 47.

health-insuranceclaimswellnessmarketingarticle-47
✓ Decided: Board approved consent agenda, minutes and financials; adjourned meeting

The board voted to approve the consent agenda, the prior meeting minutes, and the financial statements. The motion was carried. A motion to adjourn the meeting was then made and also carried. No other actions were decided.

Wed May 21, 2025

Water & Sewer Authority Board

Water & Sewer Authority to discuss rate increase for contractor Jay Sawyer

The Board will review financial reports and a proposed rate increase for contractor Jay Sawyer. Members will also receive updates on the Genesee Street Waterline Project and the Cayuga Lake Protection Plan regarding the Honoco Road sanitary sewer.

water-sewercontractsinfrastructuresanitary-sewer
✓ Decided: Board approved Eagle Drive sewer line agreement (one abstention)

The board unanimously approved the draft minutes from April 16, 2025 and authorized payment of open invoices. A motion to approve the Eagle Drive sewer line agreement was carried with one abstention. The board also unanimously entered and later adjourned an executive session, and then adjourned the meeting.

Tue May 20, 2025

Ways & Means Committee

Cayuga County Ways & Means Committee considers hiring restrictions

The committee is discussing the implementation of hiring restrictions for all county departments to control spending. The body is also reviewing the distribution of $513,664.05 in mortgage tax collections to local municipalities.

budgethiringtaxesforeclosurescontracts
✓ Decided: County Treasurer authorized to pay mortgage tax, unanimous approval

The Ways & Means Committee approved the April 15, 2025 minutes and adopted a series of resolutions covering finance, hiring, health, IT, planning, and public works. All motions passed unanimously. Key actions include authorizing the Treasurer to pay mortgage tax, implementing hiring restrictions for social‑service staff, and entering multi‑year agreements for health and IT services.

Thu May 15, 2025

General Municipal Law 239-l, m & n Review Committee

County committee reviews solar project, warehouse expansion, and zoning changes

The Cayuga County GML 239-l, m & n Review Committee will review five local actions for potential intermunicipal or countywide impacts. Items include a comprehensive plan local law from the Town of Locke, a zoning amendment from the Town of Aurelius, a car dealership site plan from the Town of Sennett, a solar project site plan and special use permit from the Town of Victory, and a warehouse expansion site plan and special use permit from the Town of Ira. The committee will decide whether each action is of local concern only or requires recommendations.

zoningplanningcomprehensive-plansolarwarehousecar-dealershipintermunicipal-review
✓ Decided: Committee approved Town of Aurelius zoning amendment with changes

The Cayuga County GML 239‑l, m & n Review Committee unanimously approved five actions and requested additional materials for one. It found the Town of Locke comprehensive plan to be a local‑only matter and approved it. It approved the Town of Aurelius zoning amendment, noting required changes, and also approved site‑plan actions for the Town of Sennett car dealership and the Town of Ira warehouse expansion. For the Town of Victory solar project, the committee asked for further documentation before any approval.

Thu May 15, 2025

Mental Health Sub-Committee

Mental Health Subcommittee to hear school mental health programs update

The Cayuga County Community Services Board Mental Health Subcommittee will meet to discuss the Local Services Plan, receive a presentation on school mental health programs, and hear from a new Mental Health Task Force team leader. Agency reports from Behavioral Health Unit, Cayuga Counseling Services, and others will be reviewed. New business includes receiving a Proclamation from the Legislature, approval of a Vice-Chairwoman, and an update on Mental Health Awareness Pins.

mental-healtheducationtask-forcelocal-servicesagency-reportspublic-healthcounty
✓ Decided: Emily Hitchcock approved as Mental Health Subcommittee Vice‑Chairwoman

The subcommittee approved the April 17, 2025 minutes. Emily Hitchcock was approved as Mental Health Subcommittee Vice‑Chairwoman. Michael Slomski was noted as the new Mental Health Task Force team leader. The meeting was adjourned at 1:03 p.m.

Wed May 14, 2025

Health & Human Services Committee

Committee to vote on $268,767 rental supplement and $103,075 homeless housing contract

The Health & Human Services Committee will approve minutes, appoint Sumner Young to the Mental Health Subcommittee, hear department updates from Health, Social Services, Aging, and Youth Bureau, and vote on five resolutions. Notable decisions include accepting $268,767 for the Rental Supplement Program, renewing a $103,075 contract with Rescue Mission for homeless family housing, and contracting psychologists for competency evaluations.

healthsocial-servicesmental-healthhousingchildrenbudgetappointmentscontracts
✓ Decided: Committee approved multiple health, social services and mental health resolutions

The committee approved the April 9, 2025 minutes and appointed Sumner Young to the Mental Health Sub‑Committee. It also approved five resolutions covering a health agreement, a budget amendment, a caseworker vacancy, a housing contract renewal, and a psychologist contract. The meeting was adjourned at 4:50 PM.

Tue May 13, 2025

Public Works Committee

Committee to vote on 3-year snow removal pact with Onondaga County

The Public Works Committee will hear department updates on water, sewer, highway, and soil/water projects, and vote on one resolution authorizing a 3-year agreement with Onondaga County for snow and ice removal on county roads. Also discussed: a $500,000 ARPA transfer and $2.5 million grant for a Cayuga Lake shoreline sewer project serving 450 homes.

public-workssnow-removalsewer-projecthighwaywatersoil-and-watercayuga-lake
✓ Decided: Approved 3‑year snow removal agreement with Onondaga County

The Public Works Committee approved the minutes from the April 8, 2025 meeting unanimously. It also adopted Resolution 5-25-PW-1, authorizing the Chair of the Legislature to enter a three‑year snow and ice removal agreement with Onondaga County, with all members voting in favor.

Tue May 13, 2025

Judicial & Public Safety Committee

Cayuga County considers new 911 staffing and jail phone contract

The Judicial & Public Safety Committee is reviewing several staffing authorizations for the 911 Center and District Attorney's office. The body is also considering a contract for the management of telephone and tablet systems at the county jail.

public-safety911jailstaffingcontracts
✓ Decided: Committee approves new 911 positions, budget tweak, and jail phone system deal

The Judicial & Public Safety Committee approved the minutes from April 8, 2024. It authorized creation of a new Emergency Services (HELP) position and a Supervising Emergency Services Dispatcher position, and approved a budget adjustment for domestic‑violence training in the E‑911 budget (vote 2‑of‑3). The committee also amended a resolution to let the District Attorney fill a vacant assistant or law associate role and approved a contract with Global Tel*Link for the county jail’s telephone system and tablets. All motions passed unanimously unless otherwise noted.

Tue May 13, 2025

Human Resources & Civil Services Commission

Commission to adopt NYS-approved rules, consider eligible lists and removals

The Cayuga County Civil Service Commission will meet on May 13, 2025, to handle routine personnel matters including adoption of a rules change approved by NYS Civil Service, establishment and extension of eligible lists for several positions, and approval of new position duties. The commission will also discuss disciplinary actions and communications including requests to remove candidates from law enforcement eligible lists and an executive order related to a correction officer strike.

civil-serviceeligible-listspersonnelrules-changesdisciplinary-actionsrecruitmentdeputy-sheriffemergency-services
✓ Decided: Commission extended several eligible exam lists for one year

The Cayuga County Civil Service Commission approved updates to county civil service rules, extended five eligible exam lists for one year, and adopted a new class specification for the HELP Program caseworker. It also approved new position duty statements for three roles, accepted an exempt classification review, and took actions on several disciplinary and reinstatement requests.

Thu May 8, 2025

Planning & Economic Development Committee

Committee to vote on consultant contract for Moravia NY Forward grant

The Planning Committee will receive updates on ongoing department projects and vote on a resolution to award a consultant contract for the Village of Moravia's NY Forward Small Project Grant Fund. Other updates include progress on the Town of Conquest land use regulations nearing adoption, Cayuga Lake Route 90 DRI grant implementation, and various water quality and environmental planning initiatives.

planningeconomic-developmentgrantsland-usezoningwater-qualityrecyclingsolar
✓ Decided: Planning Committee approved April 10, 2025 minutes unanimously

The Planning & Economic Development Committee approved the minutes from the April 10, 2025 meeting. The motion was made by Elane Daly, seconded by Tom Winslow, and all members voted in favor. No appointments or other actions were taken during the session.

Thu May 8, 2025

People with Development Disabilities Sub-Committee

Cayuga developmental disabilities subcommittee hears agency updates

This regular meeting of the Cayuga County People with Developmental Disabilities Subcommittee includes agency reports from ARISE, Cayuga Centers, DDRO, Exceptional Family Resources, Gavras Center, Mozaic, and Unity House. The agenda is procedural with no specific votes or financial items.

developmental-disabilitiescayuga-countycommunity-servicesagency-reportssubcommittee
✓ Decided: People with Developmental Disabilities subcommittee meeting cancelled

The May 8, 2025 subcommittee meeting was cancelled because a quorum was not present. No actions were taken or decisions recorded.

Thu May 8, 2025

Government Operations Committee

Committee to vote on $108,333 IT services contract with City of Auburn

The Government Operations Committee will consider a resolution authorizing a 13-month, $108,333 IT managed services contract with the City of Auburn. The agenda also includes updates on elections processing, county office relocations, and ongoing technology projects such as door access upgrades, domain migration, and network infrastructure.

itcybersecuritycontractselectionscounty-officestechnologygovernment-operations
✓ Decided: Committee approved IT Managed Services agreement with Auburn

The Government Operations Committee approved the April 10, 2025 meeting minutes. It also approved Resolution 5-25-GO-1, authorizing the Chairman and the CIO to enter an IT Managed Services agreement with the City of Auburn. The meeting was then adjourned. No other substantive actions were taken.

Wed May 7, 2025

Alcohol & Substance Use Sub-Committee

Alcohol & Substance Use Sub-Committee holds routine procedural meeting

This meeting of the Cayuga County Community Services Board Alcohol & Substance Use Sub-Committee consists entirely of procedural items such as roll call, public comment, minutes review, and agency reports. No specific decisions, proposals, or financial actions are listed on the agenda.

alcohol-substance-usecommunity-servicesproceduralcayuga-county
✓ Decided: Alexa Hicks was appointed Vice Chair of the Alcohol & Substance Use Subcommittee

The subcommittee approved the March 5, 2025 meeting minutes. A motion nominated Alexa Hicks for Vice Chair, which was carried, appointing her to that role. The meeting then adjourned. No other business was decided.

Thu May 1, 2025

Water Quality Management Agency (WQMA)

Regular WQMA meeting with working group and agency updates

This is a regular meeting of the Cayuga County Water Quality Management Agency. The agenda includes old business, new business (unspecified), and reports from working groups on communications and invasive species. Updates are scheduled from county agencies, lake associations, and partner organizations. No specific decisions or proposals are listed.

water-qualitylake-managementenvironmental-healthinvasive-speciescayuga-countynew-yorkwatersheds
✓ Decided: WQMA accepted prior minutes and adjourned the May 1 meeting

The agency unanimously approved the April 3, 2025 meeting minutes. A motion to adjourn the May 1, 2025 session also passed unanimously. No other formal votes or approvals were recorded.

Thu Apr 24, 2025

Community Services Board

Cayuga Community Services Board to vote on nomination, review reports

The Cayuga County Community Services Board will hold a regular meeting with roll call, approval of March minutes, and public comment. The board will receive a director's report, financial reports, and subcommittee updates on mental health, developmental disabilities, and alcohol/substance use. A vote on a nomination from the Nominating Committee is scheduled. The agenda is largely procedural with no specific financial amounts or policy proposals listed.

community-servicesmental-healthdevelopmental-disabilitiessubstance-usenominationspublic-hearingboard-meeting
✓ Decided: Board approves March minutes and appoints Sumner Youngs to Mental Health Subcommittee

The board approved the minutes from the March 26, 2025 meeting. Sumner Youngs was nominated and approved for the Mental Health Subcommittee, with Sumner abstaining. The meeting was adjourned at 12:55 pm.

Thu Apr 24, 2025

Health Insurance Consortium Board of Directors

Board to review 2024 health utilization and financial claims data

The Cayuga County Health Insurance Consortium Board of Directors will meet to approve previous minutes and financials, review 2024 utilization and clinical data from Excellus BCBS, and receive medical and dental financial claims updates from USI. The board will also discuss wellness and marketing updates under old business.

health-insuranceconsortiumclaims-reviewutilization-reviewboard-of-directorscayuga-county
✓ Decided: Board approved consent agenda and adjourned the meeting

The board voted to approve the consent agenda, previous minutes, and financial statements, and the motion carried. The meeting was then adjourned by a motion that also carried. No other substantive actions were decided.

Wed Apr 23, 2025

Parks & Trails Commission

Commission to consider bridge replacement grant application

The Cayuga County Parks Commission will vote on several resolutions authorizing grant applications and contracts, including a request for support of the Deauville Island bridge replacement project and a wastewater engineering planning grant. The meeting also includes updates on Emerson Park projects, trail maintenance, and agreements with local organizations.

parksgrantscontractsinfrastructurefireworkstrailseventscounty
✓ Decided: No decisions were made because the commission lacked a quorum

The Parks & Trails Commission met on April 23, 2025, but a quorum was not present. As a result, no resolutions, contracts, or other actions were approved, denied, or tabled. All agenda items remain pending for a future meeting.

Tue Apr 22, 2025

Board of Health

Board of Health to discuss Article 6, approve claims, receive updates

The Cayuga County Board of Health will hold a routine meeting covering approval of claims, department updates from multiple divisions, and a presentation on Article 6. No significant policy decisions or public hearings are on the agenda.

healthpublic-healthboard-of-healthbudgetenvironmental-healthwiccommunicable-diseaseimmunization
✓ Decided: Board of Health approves minutes, claims, and environmental hearings

The Cayuga County Board of Health unanimously approved the minutes from the March 25 meeting. The board also approved the presented fiscal claims without discussion. Environmental Health hearings and consent orders were approved, and the meeting was adjourned.

Tue Apr 22, 2025

Legislature

County Legislature to vote on salary increases for elected officials, public hearing set

The Cayuga County Legislature will hold a public hearing and vote on a local law providing salary increases for certain county officers during their term. The board will also consider resolutions supporting the closure of the Seneca Meadows landfill and demanding an audit of NYSEG and RG&E billing practices. Numerous other resolutions cover tax settlements, grants, contracts, and personnel appointments.

local-governmentcounty-legislaturesalariespublic-hearingseneca-meadowsutility-auditgrantsappointments
✓ Decided: County Legislature approves $690,000 lead‑hazard grant and tax settlements

The Cayuga County Legislature voted to settle three property tax assessment disputes, authorizing the Special Counsel to finalize the agreements. It also approved two state grant contracts for the Health Department: a $690,000 Leading with Lead program and an annual $110,881 Drinking Water Enhancement program. All resolutions passed unanimously. New members were appointed to the Fire Advisory Board and the Cayuga‑Cortland Workforce Development Board.

Thu Apr 17, 2025

General Municipal Law 239-l, m & n Review Committee

Committee reviews intermunicipal impacts of local laws and site plans

The Cayuga County GML 239-l, m & n Review Committee will meet to review proposed local actions from four towns for potential intermunicipal or countywide impacts. Items include a setback law in Summerhill, a parking lot site plan and subdivision in Sennett, an accessory dwelling unit in Owasco, and market and warehouse expansions in Ira. The committee may recommend approval, disapproval, or request additional information.

planningzoningintermunicipal-reviewsite-planlocal-lawcayuga-county
✓ Decided: Committee approved all items, requesting more info for Ira warehouse expansion

The committee approved the March 20 minutes and found the proposed setback law, parking lot, accessory dwelling unit, and market expansion to be local concerns only. It determined that the Town of Ira warehouse expansion needs additional materials and took no final action on it. The meeting was then adjourned.

Thu Apr 17, 2025

Mental Health Sub-Committee

Mental Health Subcommittee hears East Hill Medical Services, reviews task force

The Mental Health Subcommittee of the Cayuga County Community Services Board meets to receive a presentation from East Hill Medical Services, review the Local Services Plan, and discuss the status and recruitment for the Mental Health Task Force. Members will also hear agency reports from behavioral health providers and consider a new subcommittee member. A proclamation from the Cayuga County Legislature and distribution of Mental Health Awareness Month pins are on the agenda.

mental-healthsubcommitteecommunity-servicespresentationstask-forcerecruitmentproclamationawareness-month
✓ Decided: Committee approved March minutes and adjourned the meeting

The subcommittee approved the March 30, 2025 meeting minutes after a motion by Beth Dishaw, seconded by Caroline Dixon. The meeting was then adjourned by a motion from Meghan Rusco, seconded by Judi Magee. No other substantive decisions were recorded.

Wed Apr 16, 2025

Water & Sewer Authority Board

Water contract negotiations and sewer project updates on agenda

The Cayuga County Water & Sewer Authority Board will hold a regular meeting to approve draft minutes, review financial reports, and hear updates from committees and staff. Key discussion items include ongoing City of Auburn water contract negotiations, the Genesee Street waterline project, the Cayuga Lake protection plan, and the Eagle Drive/CMI Plant sewer project. The board also plans an executive session on personnel matters.

watersewerinfrastructurecontractspersonnelcayuga-countyboard-meeting
✓ Decided: Board approved Aaron Wilde as salaried Field Manager

The board unanimously approved the March 19, 2025 draft minutes and the open invoices. A motion to enter an executive session on personnel was approved unanimously, followed by unanimous adjournment of that session. The board voted 7‑0‑2 to hire Aaron Wilde as the salaried Field Manager. The next board meeting was scheduled for May 21, 2025.

Tue Apr 15, 2025

Ways & Means Committee

Committee to consider salary increases for county officers and tax settlements

The Cayuga County Ways & Means Committee will hear budget presentations from DSS, Health, Mental Health, Sheriff, and Highway, receive finance updates on sales tax and building spending, and discuss resolutions including settlements of tax assessment disputes (McDonald's and Sholinsky). They will also consider a local law to increase salaries for certain county officers and various contracts for grants, staffing, and park services.

budgettax-assessmentssalariespublic-healthparkscontractsresolutions
✓ Decided: Committee approved settlements for three assessment disputes

The Ways & Means Committee approved the minutes from March 18, 2025. It authorized settlements in three assessment cases involving McDonald’s Corp, McDonald’s Real Estate Co, and Marc Sholinsky. The committee also approved multiple health and human services contracts, grant participation, and staffing hires, as well as veteran service positions and a lease for the Edward T. Boyle Center. Additionally, it adopted a resolution to set the hearing date for a local salary‑increase law and added $35,000 to that resolution.

Thu Apr 10, 2025

Government Operations Committee

✓ Decided: County adopts local law to increase salaries for certain elected and appointed officers

The Government Operations Committee approved the March 13 minutes unanimously. It appointed eight members to the Veterans Advisory Board. The committee approved resolutions GO-1 and GO-2 to fill a vacant part‑time Veteran Service Officer and a part‑time driver position. It also approved GO-3 to set the public hearing date for a salary‑increase local law and adopted GO-4, establishing salary increases for certain county officers, with all votes in favor.

Thu Apr 10, 2025

Planning & Economic Development Committee

Committee receives update on $1M Restore NY grant application for marina redevelopment

The Cayuga County Planning and Economic Development Committee will consider appointments to the Workforce Development Board and hear a presentation on economic development. Staff updates cover ongoing projects including the Route 90 DRI grant, Town of Conquest land use regulations, and several grant-funded initiatives. Most items are informational; no votes on major proposals are scheduled.

planningeconomic-developmentdowntown-revitalizationgrantsland-usesolarworkforce-developmentwater-quality
✓ Decided: Planning Committee approves minutes and appoints new workforce board members

The committee approved the March 13, 2025 meeting minutes unanimously. It also approved four new appointments to the Cayuga Cortland Workforce Development Board, each with a term from April 22, 2025 to April 21, 2027. No other substantive actions were taken.

Thu Apr 10, 2025

People with Development Disabilities Sub-Committee

✓ Decided: Michelle VanGiesen elected Vice Chair of the PWDDSC

The sub‑committee approved the March 2025 minutes after a motion and second. Michelle VanGiesen was nominated and elected to serve as Vice Chair. The meeting was then adjourned following a motion.

Wed Apr 9, 2025

Health & Human Services Committee

Health Committee considers $690,000 lead remediation grant

The Health & Human Services Committee is reviewing several grant agreements and personnel fills. The body is discussing funding for lead hazard remediation and drinking water enhancement, as well as renewing a contract for animal disease control.

healthgrantspublic-safetypersonnelsenior-services
✓ Decided: Committee approved multiple contracts and staffing authorizations, all unanimously

The Health & Human Services Committee adopted ten resolutions authorizing contracts, grant participation, and staff hires, with every motion passing unanimously. It also renewed existing contracts for the Finger Lakes Dog Protection Agency and the Office for the Aging. Two previously pending vehicle‑purchase resolutions were tabled, and the meeting adjourned at 5:21 PM.

Wed Apr 9, 2025

Judicial & Public Safety Committee

Committee to consider accepting $705,292 state grant for emergency communications system

The Cayuga County Judicial & Public Safety Committee will discuss department updates on 911 staffing, jail population, and arraignment costs, and vote on 12 resolutions. Key actions include accepting grants for 911 operations and emergency communications, authorizing a traffic diversion program contract, and approving a temporary 12-hour shift pilot for sheriff's road patrol sergeants.

911emergency-communicationsgrantspolicesheriffdomestic-violencetraffic-safety
✓ Decided: Committee approved multiple public safety grants and contracts, including $25K STRIVE grant

The Judicial & Public Safety Committee approved the March 11, 2024 minutes and appointed Frederick Hess to the Fire Advisory Board. It authorized several grant acceptances, a contract amendment for the District Attorney, a $25,000 STRIVE grant to the Sheriff’s Office, a 12‑hour shift pilot for road patrol sergeants, and a distracted‑driving simulator contract for Auburn High School. All actions passed with unanimous support.

Tue Apr 8, 2025

Public Works Committee

Committee to vote on renewal of engineering contract with Colliers Engineering

The Cayuga County Public Works Committee will vote on three resolutions: renewing an engineering services contract with Colliers Engineering for county projects, authorizing a cleaning contract for Cayuga Community College leased space, and executing a fifth addendum to a lease with the City of Auburn. The committee will also receive updates on water and sewer operations and the Soil and Water Conservation District's activities.

public-worksengineering-servicescontractsleasingcleaningwater-sewercayuga-lakesoil-and-water
✓ Decided: County approved lease addendum with City of Auburn and two contracts

The Public Works Committee approved the March 11, 2025 minutes unanimously. It passed three resolutions: authorizing a one‑year renewal with Colliers Engineering and Design, authorizing a cleaning contract for Cayuga Community College leased space, and authorizing a fifth lease addendum with the City of Auburn; each motion received all votes in favor. The meeting was adjourned at 4:40 PM.

Tue Apr 8, 2025

Human Resources & Civil Services Commission

Commission to amend civil service rules, review eligible lists

The Cayuga County Civil Service Commission will vote on amending its civil service rules and appendices, and on certifying and establishing eligible lists for positions including deputy sheriff and director of community health. It will also consider abolishing vacant positions following layoffs, approve new position duty statements, and discuss the impact of the correctional officer strike under Executive Order 47.3. The meeting includes a public hearing and an HR report on recruitment efforts.

civil-servicerulespositionslayoffscorrectional-officer-strikehiringpublic-hearing
✓ Decided: Commission unanimously adopted civil service rule revisions and updated eligible lists

The commission adopted revisions to the Cayuga County Civil Service Rules and Appendices and directed staff to update them. It certified two permanent appointments and extended several eligible lists while expiring others. New position duties statements were approved, and a leave of absence was granted with vacant positions abolished.

Thu Apr 3, 2025

Water Quality Management Agency (WQMA)

Cayuga County WQMA holds regular quarterly meeting with updates

The Cayuga County Water Quality Management Agency is meeting to receive updates from working groups, agency departments, lake associations, and partner organizations. No specific votes or decisions are listed; the agenda consists entirely of reports and informational items.

water-qualityenvironmentalreportslake-managementcayuga-countyinvasive-speciesworking-groups
✓ Decided: WQMA chair to request County Legislature member appointment to agency

The agency unanimously accepted the March 6, 2025 meeting minutes. It decided to keep the current meeting schedule for now. A unanimous motion directed the WQMA chair to ask the County Legislature chair to appoint a legislator to attend WQMA meetings. The meeting was then adjourned unanimously.

Wed Apr 2, 2025

Legislature

Cayuga County Legislature holds special meeting for executive session on personnel matter

This is a special meeting of the Cayuga County Legislature with only one substantive item: an executive session to discuss the financial or employment history of a particular person. The session is closed to the public. No other business, voting items, or public hearings are on the agenda.

cayuga-countylegislaturespecial-meetingexecutive-sessionpersonnel
✓ Decided: Cayuga County Legislature approves CIO salary raise and IT partnership with Auburn

The Legislature adopted Resolution 141-25, authorizing a CIO salary increase to $160,000 and permitting talks with the City of Auburn for a joint IT management agreement and data‑center co‑location. The resolution also amended the 2025 budget by shifting $35,000 from one salary line to another. The resolution passed with all members in favor except one vote against.

Wed Apr 2, 2025

Alcohol & Substance Use Sub-Committee

Cayuga alcohol/substance meeting cancelled for lack of quorum

The April 2, 2025 meeting of the Alcohol and Substance Use Subcommittee was cancelled because a quorum was not present. No business was conducted.

cancelledmeetingalcoholsubstance-usecayuga-county
✓ Decided: ASU Subcommittee meeting cancelled due to lack of quorum

The Alcohol & Substance Use Subcommittee meeting on April 2, 2025 was cancelled because a quorum was not present. No decisions, approvals, or actions were taken.

Thu Mar 27, 2025

Health Insurance Consortium Board of Directors

Health board to review financial claims, wellness, marketing

The Health Insurance Consortium Board will meet to approve prior minutes and financials, receive updates on medical and dental claims, and review wellness and marketing initiatives. The agenda is largely routine and administrative.

health-insuranceconsortiumboardfinancial-reviewwellnessmarketing
✓ Decided: Board approved consent agenda and previous minutes

The board voted to approve the consent agenda and the prior meeting minutes. The meeting was then adjourned. No other formal actions were recorded.

Wed Mar 26, 2025

Community Services Board

Community Services Board to vote on by-laws revisions at March 26 meeting

The Cayuga County Community Services Board will hold its regular monthly meeting on March 26, 2025, at CAP in Auburn, NY. The board will vote on proposed revisions to its by-laws and receive updates from subcommittees on mental health, developmental disabilities, and alcohol/substance use. Financial reports and a director's report are also on the agenda.

community-servicesby-lawsmental-healthdevelopmental-disabilitiessubstance-abusefinancepublic-comment
✓ Decided: CSB approves OSF allocation change, bylaws revisions and adjourns

The board approved the February 27, 2025 meeting minutes. It modified Cayuga Counseling’s opioid settlement fund allocation, with two members abstaining. The board also approved revisions to the CSB bylaws. The meeting was adjourned at 1:15 pm.

Wed Mar 26, 2025

Parks & Trails Commission

Parks Commission reviews bridge replacement and wastewater grant applications

The Commission is reviewing resolutions for a wastewater engineering planning grant and the Deauville Island bridge replacement project. The body is also discussing infrastructure repairs at Emerson Park and trail maintenance updates.

parksinfrastructuregrantstrailspublic-works
✓ Decided: Commission approved February minutes, no new actions taken

The commission approved the February meeting minutes with all members in favor. No new resolutions, contracts, or projects were approved or denied at this meeting. The meeting was adjourned by unanimous motion.

Tue Mar 25, 2025

Board of Health

Cayuga County Board of Health to review claims and environmental health orders

The Board of Health will meet to approve claims and review minutes from February 25, 2025. The agenda includes reports on communicable diseases, children's special needs programs, and environmental health updates.

public-healthenvironmental-healthbudgetimmunization
✓ Decided: Board approves new officers, minutes, claims, and hearing orders unanimously

The Board approved the February 25 meeting minutes and the recent fiscal claims without dissent. Members voted to accept the nominating committee’s slate of officers, with the new officers taking effect at the April meeting and the president position remaining vacant until Dr. Wasileski assumes the role in August. The Hearing and Consent Orders for various facilities were also approved unanimously.

Tue Mar 25, 2025

Legislature

Emerson Park Pavilion repairs headlined with public hearing and funding vote

The Cayuga County Legislature will hold a public hearing to appropriate funds from the Emerson Park Pavilion Repair Reserve for repairs to the pavilion. The board will also vote on a resolution calling for repeal of the NYS HALT Act on solitary confinement, plus dozens of resolutions covering personnel changes, contracts, budget modifications, grants, and appointments across county departments.

legislaturepublic-hearingemerson-parkhalt-actwind-energygrantspersonnelcontracts
✓ Decided: County authorizes $30K escrow for Agricola Wind Project

The Legislature approved the February 27 minutes unanimously. It appointed members to several county boards and committees. It passed resolutions to abolish six vacant HR positions and to fill an HR associate vacancy. It also authorized a $30,000 escrow account to fund consultant fees for the Agricola Wind Project, with one legislator voting against the measure.

Fri Mar 21, 2025

Human Resources & Civil Services Commission

Civil Service Commission to adopt class specification for Deputy County Clerk III

The Cayuga County Civil Service Commission is holding a special meeting to adopt a class specification for the Deputy County Clerk III position and to review new position duty statements for two County Clerk roles. The agenda contains only administrative personnel actions with no fiscal items or public hearings.

civil-servicepersonnelcounty-clerkclass-specifications
✓ Decided: Commission adopts class specification for Deputy County Clerk III

The Civil Service Commission opened a special meeting at 8:08 a.m. and unanimously approved the adoption of the class specification for the Deputy County Clerk III position. The commission also approved new duties statements for the Deputy County Clerk III and the Index and Recording Clerk positions. The meeting was adjourned at 8:13 a.m. after all motions passed without opposition.

Thu Mar 20, 2025

General Municipal Law 239-l, m & n Review Committee

Aurelius subdivision law and warehouse permit up for county review

The Cayuga County GML 239-l,m,n Review Committee will meet online to review two actions from the Town of Aurelius: a proposed local law amending subdivision regulations, and a site plan and special use permit for a warehouse. The committee will vote on one of several options, ranging from determining no intermunicipal concern to disapproval, and may add comments. They will also consider minutes from the February 20 meeting.

planningzoningsubdivisionswarehousesintermunicipal-reviewaureliuscayuga-county
✓ Decided: Committee approved minutes, a subdivision amendment, and a warehouse permit

The committee unanimously approved the minutes from the February 20, 2025 meeting. It also approved the Town of Aurelius subdivision amendment as a matter of local concern only. Additionally, the committee recommended approving the Town of Aurelius warehouse site plan and special use permit without changes.

Thu Mar 20, 2025

Mental Health Sub-Committee

Mental Health Subcommittee to hear presentation on veterans mental health

The Cayuga County Community Services Board Mental Health Subcommittee will meet to discuss the Local Services Plan and the Mental Health Task Force. The meeting includes a presentation on veterans mental health and reports from several behavioral health agencies.

mental-healthveterans-affairscommunity-servicespublic-health
Wed Mar 19, 2025

Water & Sewer Authority Board

Board to review annual performance and receive updates on water contract and projects

The Cayuga County Water & Sewer Authority board will review required annual evaluations, fiduciary acknowledgments, and performance measurements due March 31. They will also receive financial reports and updates from committees, including the City of Auburn water contract negotiations, the Genesee Street waterline project, the Honoco Road sewer improvements, and the Eagle Drive/CMI Plant sewer. The meeting includes reports from the director, attorney, advisor, and engineer, followed by an executive session.

watersewerboard-meetingannual-reviewscontract-negotiationsinfrastructureauburn-ny
✓ Decided: Board unanimously approved loan application for Cayuga Lake sewer project

The board unanimously approved starting the application for a 0% interest hardship loan for the Cayuga Lake Protection Plan sanitary sewer project and the purchase of a new water meter for the Genesee Street waterline. It also approved routine items such as the meeting minutes, invoice payments, audit findings, committee appointments, and an executive session.

Wed Mar 19, 2025

Planning Board

Cayuga County Planning Board to approve past minutes and discuss planning updates

The Cayuga County Planning Board is holding a regular meeting to approve minutes from November 2024, receive planning updates, and hear local status reports. The agenda is primarily procedural with no significant decisions or public hearings listed.

planningboardcayuga-countyproceduralminuteslocal-government
✓ Decided: Planning board approves minutes, shifts meetings to 5:30 PM

The Cayuga County Planning Board approved the minutes from its November 13, 2024 meeting and voted unanimously to change all future meeting times to 5:30-6:30 PM. The board also received updates on various county planning projects, including a $103,500 grant for a new strategic plan and a $150,000 housing market study.

Tue Mar 18, 2025

Ways & Means Committee

Ways & Means Committee to review Agricola Wind Project funding and county staffing

The committee is considering several resolutions, including an escrow agreement for consultants for the Agricola Wind Project in Venice and Scipio. Members will also review personnel changes across Human Resources and the Treasurer's Office and receive departmental updates on tax collection and facility moves.

wind-energypersonneltaxationcontractsgovernment-operations
✓ Decided: Ways & Means approves wind project escrow, staffing changes, contracts

The Cayuga County Ways & Means Committee approved multiple resolutions including an escrow agreement for consultants on the Agricola Wind Project, several personnel actions, and contracts for services at 63 Genesee Street. A resolution to table vehicle purchases for the Health and Social Services departments passed, and a security services contract for 63 Genesee Street was tabled. The committee also entered executive session for collective negotiations and personnel matters.

Thu Mar 13, 2025

Government Operations Committee

Committee to consider motor vehicle tax, officer raises, $283K mortgage clerk expense

The Cayuga County Government Operations Committee will review three resolutions: authorizing $283,000 annually for mortgage tax clerk expenses, scheduling a public hearing on a local law increasing salaries for certain county officers, and scheduling a public hearing on a local law establishing a Cayuga County Motor Vehicle Tax. The committee also received updates from the Board of Elections, Information Technology, and Veterans Services, covering upcoming primaries, IT infrastructure projects, and veteran outreach.

government-operationsmotor-vehicle-taxsalariesmortgage-taxit-projectselectionsveterans
✓ Decided: Committee approves resolutions on clerk expenses, salary hearing, motor vehicle tax

The Government Operations Committee approved three resolutions: one authorizing County Clerk expenses for a Mortgage Tax Clerk, one setting a public hearing on a local law for salary increases for certain county officers (amended to separate the County Attorney), and one setting a public hearing on a local law establishing a Cayuga County Motor Vehicle Tax. All votes were unanimous. The committee also received updates from departments including the Board of Elections, IT, and Veterans Services.

Thu Mar 13, 2025

Planning & Economic Development Committee

Committee hears updates on Village of Weedsport DRI/NY Forward applications ($10M/$4.5M)

The Cayuga County Planning & Economic Development Committee meets to approve minutes and discuss an appointment to the County Planning Board, along with extensive department updates on ongoing planning, grant, and water quality projects. No final decisions or votes on major items are scheduled; the agenda is largely informational.

planningeconomic-developmentgrantszoningland-usewater-qualityrecyclingagriculture
✓ Decided: Committee approves creating Principal Environmental Planner position

The Cayuga County Planning & Economic Development Committee approved a resolution to create and fill a Principal Environmental Planner position while abolishing an Associate Planner position. The committee also authorized applications for a wastewater engineering planning grant and replacement of lighting in the Emerson Park Pavilion. All resolutions passed unanimously.

Thu Mar 13, 2025

People with Development Disabilities Sub-Committee

People with Developmental Disabilities Subcommittee to review agency forms

The subcommittee will receive reports from eight local agencies and the Director. The body is scheduled to review representative payees for individuals in Cayuga County and examine agency forms.

developmental-disabilitiescommunity-servicessocial-servicescayuga-county
✓ Decided: Subcommittee approves February minutes, amends agency forms

The People with Developmental Disabilities Subcommittee approved the February 2025 minutes as submitted. They reviewed and amended the monthly agency forms, which will be brought to the Community Services Board for approval. Stephen Smith was voted as chair. The review of rep-payees was tabled until the April meeting.

Wed Mar 12, 2025

Health & Human Services Committee

Committee to authorize contracts for septic/water approvals and WIC staffing

The Cayuga County Health & Human Services Committee will consider 15 resolutions covering contracts, personnel, and vehicle purchases for the Health, Social Services, Office for the Aging, Youth Bureau, and Mental Health departments. Notable appointments to the Community Services Board and subcommittees are also on the agenda. Department heads reported minimal updates.

public-healthsocial-servicescontractspersonnelagingyouthmental-healthcounty-government
✓ Decided: Committee approves 15 resolutions on health, social services contracts and hiring

The Health & Human Services Committee approved all 15 resolutions on the agenda, covering contracts for septic system engineering, tuberculosis control, transitional housing, and indigent burials, as well as filling multiple positions and purchasing vehicles. All votes were unanimous. The committee also approved the February 12, 2025 minutes and made several appointments to boards and subcommittees.

Tue Mar 11, 2025

Public Works Committee

Committee to consider filling vacant superintendent and contracts for 63 Genesee St

The Public Works Committee will discuss updates from the Highway and Soil & Water departments and vote on 11 resolutions. Key actions include filling the vacant Superintendent of Buildings & Grounds, hiring a part-time laborer, and authorizing multiple contracts for signage, security, and cleaning at 63 Genesee Street, Auburn. The committee will also consider extending bids and increasing salt expenditure for snow removal.

public-workshiringcontractsbuildings-and-groundshighwaysoil-and-watercayuga-countysnow-removal
✓ Decided: Committee approves 11 resolutions for hiring, contracts, and highway work

The Public Works Committee approved all 11 resolutions on the agenda, covering building maintenance, security, cleaning, and signage contracts for 63 Genesee Street, hiring for Buildings and Grounds, highway material bids, and a lease extension. The committee also received updates from the Highway and Soil & Water departments, including plans for a recycling event, spring roadwork, and agricultural assistance programs. All votes were unanimous except for the lease extension, which had one opposing vote.

Tue Mar 11, 2025

Human Resources & Civil Services Commission

Civil Service Commission to establish eligible lists, amend class spec, consider reinstatements

The Cayuga County Civil Service Commission will meet to approve eligible lists for seven positions, including Conservation District Field Manager and Watershed Coordinator, and to amend the class specification for Probation Supervisor I. The commission will also consider new position duties for Fire Coordinator, Cleaner, and Police Chief, as well as reinstatement and transfer requests from E911, Jail, Cayuga Community College, and Village of Moravia. Notable communications include updates on the NY HELPS program and the Clean Slate Act.

civil-serviceeligible-listsclass-specificationspersonnelemploymentcayuga-county
✓ Decided: Commission approves reinstatements, transfers, and new position duties

The Cayuga County Civil Service Commission approved several personnel actions, including reinstatements from E911 and the Jail, transfers from Cayuga Community College and the Village of Moravia, and new position duties statements for Fire Coordinator, Cleaner (5), and Police Chief. The commission also extended one eligible list, expired eight others, amended the Probation Supervisor I class specification, and approved the 2025 Payroll Certification. All motions passed unanimously.

Tue Mar 11, 2025

Judicial & Public Safety Committee

Committee to consider $187,282 state funding increase for indigent legal services

The Judicial & Public Safety Committee will review department updates from 911, Assigned Counsel, Emergency Services, Sheriff, Probation, and others, and vote on several resolutions. Key actions include a contract amendment adding $187,282.28 for the Assigned Counsel office, acceptance of a $490,000 state grant for Lucas CPR devices and ambulance equipment, and a tabled resolution on sheriff's command staff bargaining unit changes.

judicialpublic-safety911assigned-counselsheriffprobationemergency-servicesgrants
✓ Decided: Committee approves HVAC contract, grants, and new fire coordinator position

The Judicial & Public Safety Committee approved multiple resolutions, including a contract for HVAC maintenance at the backup center, a cleaning contract for the Assigned Counsel Office, and a contract amendment for additional indigent legal services funding. They also authorized grants for the District Attorney's Office and Probation Department, a vocational training agreement with BOCES, and the creation of a Fire Coordinator position. A previously tabled resolution regarding a Sheriff's Employees Association MOA was referred to Ways and Means.

Thu Mar 6, 2025

Water Quality Management Agency (WQMA)

WQMA to consider approving 2025 work plan

The Cayuga County Water Quality Management Agency will meet to discuss and potentially approve its 2025 Work Plan. The agenda includes updates from county agencies, lake associations, and partner organizations on environmental and water quality programs.

water-qualityenvironmentcounty-governmentwork-planlake-reports
✓ Decided: WQMA accepts 2025 Work Plan, approves February minutes

The Cayuga County Water Quality Management Agency met on March 6, 2025, and unanimously approved the minutes from the February 6, 2025 meeting and the 2025 Work Plan. No other formal decisions were made; the rest of the meeting consisted of agency and partner reports on upcoming events and projects.

Wed Mar 5, 2025

Alcohol & Substance Use Sub-Committee

Alcohol & Substance Abuse Sub-Committee meets with no substantive items

This is a procedural meeting of the Cayuga County Community Services Board's Alcohol & Substance Abuse Sub-Committee. The agenda includes roll call, public comment, review of minutes, agency reports, and director's report, but no specific ordinances, contracts, or public hearings are listed for discussion or decision.

alcoholsubstance-abusecayuga-countycommunity-servicesprocedural
✓ Decided: Subcommittee approves February minutes; hears agency reports

The Alcohol & Substance Abuse Subcommittee approved the February 5, 2025 minutes. Members received and reviewed January 2025 reports from Farnham FS, Nick's Ride, the Cayuga County Sheriff's Office, and CHAD. The director's report covered a new suicide prevention coalition, a renamed coordinator position, and the Harm Reduction Center's referral-only schedule. No substantive policy decisions were made; the meeting was procedural and informational.

Thu Feb 27, 2025

Community Services Board

Community Services Board to vote on committee nominations

This is a largely procedural meeting of the Cayuga County Community Services Board. The board will vote on nominations from the Nominating Committee and discuss updates from subcommittees on mental health, developmental disabilities, and substance use. The by-laws workgroup will also report after a review period.

community-servicesnominationsby-lawsprocedural
✓ Decided: CSB approves nominations, leaves board seat vacant until 2026

The Cayuga County Community Services Board approved minutes and several nominations, including Judi Magee to the Mental Health Subcommittee and Sarah Passarello to the CSB. They also decided to leave an unexpired board seat vacant until a new term opens in 2026. No other substantive decisions were made; the meeting was largely procedural.

Thu Feb 27, 2025

Health Insurance Consortium Board of Directors

Financial claims updates for medical and dental plans

The Cayuga County Health Insurance Consortium Board will review and approve prior meeting minutes and financials, and receive a presentation from USI on medical and dental claims, wellness strategies, and marketing strategies. No new or old business items are listed. The meeting is largely procedural with informational updates.

health-insurancefinancial-updatesboard-meetingconsortiumcayuga-countywellnessmarketing
✓ Decided: Health insurance board reviews claims, discusses RX carve-out options

The board approved the consent agenda, previous minutes, and financials. USI presented medical and dental claims updates, noting the medical plan is at 77.8% for 2025 with no large claimants. Discussions covered exploring options to separate prescription drug coverage from the self-insured plan, potential Connect Care 3 enhancements, and contract negotiation transparency. No formal decisions were made on these topics.

Thu Feb 27, 2025

Legislature

Cayuga County Legislature to consider public safety staffing and equipment updates

The Legislature is deciding on multiple personnel appointments and several public safety upgrades, including new patrol vehicles and 911 center staffing. The body is also reviewing contracts for health services and environmental monitoring programs.

public-safetybudgetappointmentshealth-servicesparkslaw-enforcement
✓ Decided: Legislature approves $87,360 in emergency environmental testing for County Office Building

The Cayuga County Legislature approved an emergency resolution authorizing up to $87,360 for environmental testing and assessment at the closed County Office Building, including contracts with Colliers Engineering and Sessler Environmental Services. The board also approved a $1 million grant application for infrastructure supporting a 70-unit housing development, a tax settlement for a Wheat Street property, and several other contracts and appointments. All resolutions passed with majority support, with a few abstentions and one amendment defeated.

Wed Feb 26, 2025

Parks & Trails Commission

Commission to vote on $5 parking fee, seasonal hires, vegetation contract

The Cayuga County Parks Commission will vote on February resolutions authorizing seasonal employee hiring, a vegetation control contract with Tru-green at Emerson Park, and a $5 parking fee for events at park facilities. They will also consider March resolutions to apply for a wastewater engineering planning grant and support for the Deauville Island bridge replacement project. Updates will be given on design projects at Emerson Park, including bridge replacement, roof repair, and HVAC control replacement, as well as trail maintenance and Friends of Emerson Park activities.

park-feesseasonal-employeesvegetation-controlbridge-replacementgrantsdesign-projectsemerson-parktrails
✓ Decided: Parks Commission approves seasonal hires, TruGreen contract, $5 event parking fee

The Cayuga County Parks Commission approved three February resolutions: hiring seasonal employees, contracting with TruGreen for vegetation control at Emerson Park, and implementing a $5 parking fee for events at park facilities. The commission also supported moving forward with local law edits to the County Attorney and authorized applications for wastewater engineering planning and Deauville Island bridge replacement funding.

Tue Feb 25, 2025

Board of Health

Board of Health to weigh revised tobacco law, hearing orders

The Cayuga County Board of Health will consider approval of claims, hear the 2024 Health Department Statistical Report, and discuss a revised local tobacco law and hearing/consent orders from Environmental Health. The board will also receive reports on communicable disease and immunization, as well as corporate compliance.

healthtobaccopublic-healthenvironmental-healthcommunicable-diseaseclaimsboard-of-health
✓ Decided: Board adopts revised by-laws and video-conferencing policy

The Cayuga County Board of Health approved revised by-laws and a revised video-conferencing policy, both required by recent changes in state law. The board also approved claims, hearing and consent orders, and heard reports on programs and operations.

Thu Feb 20, 2025

General Municipal Law 239-l, m & n Review Committee

Solar moratorium, quarry, and horse academy among items up for review

The Cayuga County GML 239-l, m & n Review Committee meets to review six local land-use actions for potential intermunicipal impacts. Items include a zoning amendment in Fair Haven, a solar moratorium in Brutus, a retaining wall in Ledyard, a horse academy and house in Owasco, and a quarry in Springport. The committee will decide on each whether it is of local concern only, recommend approval, recommend changes, or recommend disapproval.

zoningsolar-moratoriumquarryspecial-use-permitintermunicipal-reviewplanningland-use
✓ Decided: Committee requests more info on Springport quarry proposal

The Cayuga County GML 239-l, m & n Review Committee reviewed five municipal referrals. It found no intermunicipal concerns for four proposals (Fair Haven zoning, Brutus solar moratorium, Ledyard retaining wall, Owasco horse academy) and recommended approval for the Ledyard special use permit. The Springport quarry site plan, special use permit, and variance was not approved; the committee requested additional materials and raised concerns about water and environmental impacts.

Thu Feb 20, 2025

Mental Health Sub-Committee

Veterans mental health presentation highlights subcommittee meeting

The Cayuga County Mental Health Subcommittee will hear a presentation on veterans mental health from the county veterans agency director, review agency reports, and discuss subcommittee recruitment. No binding votes or financial decisions are on the agenda.

mental-healthveteranscommunity-servicestask-forcesubcommittee
✓ Decided: Mental health subcommittee meeting cancelled due to lack of quorum

The February 20, 2025 meeting of the Mental Health Subcommittee was cancelled because a quorum was not reached. No decisions were made or items discussed. The minutes were submitted by Secretary Christine Seckner.

Wed Feb 19, 2025

Water & Sewer Authority Board

Water authority to discuss resignation, appointments, and Auburn water contract negotiations

The Cayuga County Water & Sewer Authority Board will review the resignation of A. Coleman and discuss filling vacancies. They will also address annual reviews required by the state, acknowledge fiduciary duties, and receive updates on key projects and the City of Auburn water contract negotiations. An executive session is scheduled to review board interview findings.

watersewerboard-meetingappointmentscontractsinfrastructurecayuga-county
✓ Decided: CCWSA board approves MPR for Cayuga Lake sewer project

The Cayuga County Water & Sewer Authority board approved a resolution for the Map Plan Report for Cayuga Lake Protection Plan sewer district, and approved paying $29,466 in invoices. They also recommended Ed Wagner to fill a board vacancy and approved the January minutes.

Tue Feb 18, 2025

Ways & Means Committee

Committee to consider Wheat Street housing tax settlement and multiple vehicle purchases

The Ways & Means Committee will review department updates on tax collection, year-end finance, and staffing. The committee will consider resolutions including a tax certiorari settlement for Wheat Street housing, acceptance of DOT land, extension of an auction contract, multiple Sheriff's vehicle purchases, and a parking fee policy for county parks.

taxeshousingvehiclesparkspublic-safetycontractsbudget
✓ Decided: Ways & Means approves 25 resolutions, including tax settlement and contracts

The Cayuga County Ways & Means Committee approved 25 resolutions covering tax settlements, contracts, budget amendments, and personnel actions. Notable items include authorizing a settlement in a property tax dispute, extending a real property auction contract, and approving multiple health and public safety measures. One resolution was pulled, one was tabled, and one was referred to the full Legislature.

Thu Feb 13, 2025

Planning & Economic Development Committee

Committee to appoint board members, review DRI grants and land use planning

The Cayuga County Planning & Economic Development Committee will consider appointments to the Agriculture & Farmland Protection Board and Planning Board, approve minutes from the previous meeting, and receive an extensive update on ongoing department projects. Key topics include the implementation of the Cayuga Lake Route 90 Corridor DRI grant, the Town of Conquest land use regulations nearing adoption, and status reports on water quality, recycling, and renewable energy initiatives.

planningeconomic-developmentappointmentsland-usedrirecyclingsolarwater-quality
✓ Decided: Committee approves HABs, stream monitoring, and watershed agreements

The Planning & Economic Development Committee approved several resolutions, including agreements for Cayuga Lake HABs and stream monitoring, an Owasco Watershed monitoring program, a grant application for the County Infrastructure Grant Program, and a public hearing for Emerson Park Pavilion repairs. All resolutions were approved unanimously. The committee also approved appointments to the Agriculture & Farmland Protection Board and Planning Board, and received extensive departmental updates.

Thu Feb 13, 2025

Government Operations Committee

Committee to vote on $64,484 contract for new E-Poll Books

The Government Operations Committee will consider authorizing a $64,483.90 contract with Robis Elections Inc. for new E-Poll Books, funded by a state grant. Members will also receive updates from the Board of Elections, Information Technology, and Veterans Services on recent operations and ongoing projects.

electionstechnologybudgetprocurementveteransfacilities
✓ Decided: Committee approves E-Poll Books contract with Robis Elections

The Government Operations Committee approved a resolution authorizing a contract with Robis Elections, Inc. for E-Poll Books and amending the 2025 budget. The motion passed unanimously. No other formal decisions were made; the meeting consisted of departmental updates and approval of prior minutes.

Thu Feb 13, 2025

People with Development Disabilities Sub-Committee

Cayuga County disabilities subcommittee to hear agency reports, review minutes

The subcommittee will hear updates from multiple agencies serving people with developmental disabilities, including ARISE, Cayuga Centers, and others. The meeting includes approval of November 2024 minutes and a director's report. This is a routine procedural meeting with no major decisions or public hearings listed.

developmental-disabilitiessubcommitteecayuga-countyagency-reportsprocedural
✓ Decided: Subcommittee approves November 2024 minutes, hears agency updates

The People with Developmental Disabilities Subcommittee approved the November 2024 minutes as submitted. No new or old business was discussed, and no substantive policy decisions were made. Agency reports highlighted service openings, a new podcast, and a harm reduction center opening at CCCMHC in March.

Wed Feb 12, 2025

Health & Human Services Committee

Health & Human Services Committee to review health reports and social service contracts

The committee is discussing department updates including health statistics, mental health services in jail, and housing assistance. Members are deciding on several contracts for health hearing officers, child services, and substance use initiatives.

healthsocial-servicesmental-healthbudgetpublic-health
✓ Decided: Committee approves 7 resolutions including new substance use coordinator

The Cayuga County Health & Human Services Committee approved all seven resolutions on its agenda, including contracts for hearing officers, state aid acceptance, a Play Space contract, an APS grant, respite beds, mental health navigators, and creation of a full-time Coordinator of Substance Use Initiatives. Department updates covered health statistics, compliance audits, and social services caseloads, with no decisions made on those items.

Tue Feb 11, 2025

Public Works Committee

Public Works Committee reviews facility repairs and highway budget

The committee received updates on county building maintenance, including the County Office Building and Public Safety Building. Discussions included highway salt budget overages and Soil & Water conservation projects. No resolutions were decided during this meeting.

public-worksfacilitieshighwayssoil-and-waterbudget
✓ Decided: Public Works Committee hears updates, approves prior minutes

The Cayuga County Public Works Committee met on February 11, 2025, and approved the minutes from December 5, 2024. No formal decisions were made; the meeting consisted of departmental updates from Buildings and Grounds, Highway, and Soil and Water. The committee was urged to decide on the future of the County Office Building project.

Tue Feb 11, 2025

Human Resources & Civil Services Commission

Commission to adopt new job classes and establish eligible lists for several positions

The Cayuga County Civil Service Commission will hold a regular business meeting on February 11, 2025, to approve minutes, establish eligible lists for positions including Emergency Medical Technician and Psychiatric Nurse Practitioner, and adopt new class specifications for Coordinator of Substance Use Initiatives and Fire Coordinator. They will also review new position duties for several roles, including Assistant District Attorney, and review exempt class positions. The HR administrator's report notes upcoming layoffs on April 1, 2025, and recruitment efforts.

civil-servicepersonnelhiringlayoffsjob-classificationseligible-listscounty-government
✓ Decided: Civil Service Commission approves appointments, eligible lists, and class specs

The Cayuga County Civil Service Commission approved two permanent appointments, extended or expired multiple eligible lists, adopted two class specifications, approved new position duties statements, accepted exempt classification reviews, and approved a candidate reinstatement. All motions passed unanimously.

Tue Feb 11, 2025

Judicial & Public Safety Committee

Cayuga committee reviews $573K DV grant, patrol vehicle purchases, 911 hires

The Judicial & Public Safety Committee will consider multiple resolutions including creating two HELP program dispatcher positions for the 911 Center, authorizing the purchase of four new patrol vehicles for the Sheriff's Office, and contracting with Farnham Family Service for a CASAC counselor in the jail. The committee will also receive updates from the District Attorney on a $573,407 STRIVE grant for domestic violence reduction and a proposed MOA allowing two lieutenants and a captain to leave the Sheriff's bargaining unit.

policesheriff911dispatchersdomestic-violencegrantspatrol-vehiclesjails
✓ Decided: Committee approves 911 staffing, patrol vehicles, and jail substance abuse counselor

The Judicial & Public Safety Committee approved resolutions to create two Emergency Services (HELP) positions in the 911 Center, fill a vacant part-time dispatcher position, and fill a part-time Account Clerk Typist in the Coroner Department. It also authorized the Sheriff to fill seasonal Marine Patrol positions, purchase and equip four new patrol vehicles (three marked, one unmarked), purchase two additional vehicles, and enter into an agreement with Farnham Family Service for a Credentialed Alcoholism and Substance Abuse Counselor in the jail. A resolution to purchase three Motorola dispatch consoles was pulled, and a memorandum of agreement regarding sheriff's employees' bargaining unit was tabled to next month.

Thu Feb 6, 2025

Water Quality Management Agency (WQMA)

Water Quality Agency discusses future of working groups and receives updates

The Cayuga County Water Quality Management Agency will meet to discuss the future of its working groups and work plan, along with receiving routine updates from member agencies and lake associations. The agenda is largely informational, with no major votes or financial decisions listed.

water-qualityenvironmentcounty-governmentcommitteeslakesreports
✓ Decided: WQMA abolishes Nutrient and Sediment Working Group

The Cayuga County Water Quality Management Agency accepted its 2024 Year End Report and unanimously voted to abolish the Nutrient and Sediment Working Group due to lack of participation. No other substantive decisions were made; the meeting consisted of reports from member agencies and lake associations.

Wed Feb 5, 2025

Alcohol & Substance Use Sub-Committee

Cayuga County Alcohol & Substance Abuse Sub-Committee meeting with no substantive items

The agenda contains only procedural items: roll call, public comment, minutes review, reports, and unfinished/new business. No specific decisions, proposals, or financial items are listed for discussion or action.

alcohol-and-substance-abusecayuga-countycommunity-services-boardprocedural-meeting
✓ Decided: Subcommittee approves December minutes; hears agency reports

The Alcohol & Substance Abuse Subcommittee approved the December 4, 2024 minutes and received December 2024 reports from Farnham FS, Nick's Ride, and the Cayuga County Sheriff's Office. No substantive policy decisions were made; the meeting focused on updates and announcements.

Fri Jan 31, 2025

Human Resources & Civil Services Commission

Reinstatement request from County Clerk's Office on agenda

The Cayuga County Civil Service Commission is holding a special meeting to discuss one item: a request for reinstatement from the County Clerk's Office. No other business is listed.

civil-servicepersonnelcounty-clerkspecial-meeting
✓ Decided: Cayuga County Civil Service Commission approves reinstatement request

The commission held a special meeting and approved a reinstatement request from the County Clerk's Office, directing staff to notify the appointing authority. The meeting was opened and adjourned with unanimous votes, and no other substantive decisions were made.

Tue Jan 28, 2025

Board of Health

Board to receive H5N1 and communicable disease updates

The Cayuga County Board of Health will discuss updates on communicable disease and immunization clinic reports, including H5N1, as well as WIC program vacancies, rabies program updates, and hearing and consent orders. The board will also approve claims and consider position vacancies and a regional site visit for WIC.

public-healthcommunicable-diseaseh5n1rabieswicenvironmental-healthbudget
✓ Decided: Cayuga County Board of Health approves claims and consent orders

The Cayuga County Board of Health approved the December 17, 2024 meeting minutes with typographical corrections, approved claims and credit card statements, and approved multiple hearing and consent orders. The board also received updates on budget proposals, staffing vacancies, and disease surveillance, but took no other formal votes.

Tue Jan 28, 2025

Legislature

County seeks state approval to extend 1% sales tax through 2026

The Cayuga County Legislature will vote on a resolution requesting state home rule legislation to extend the additional 1% sales tax until November 30, 2026. The meeting includes multiple contract and hiring authorizations for health, social services, public works, and sheriff’s office. A public hearing is scheduled at 6:00 PM, and several appointments to county boards are proposed.

sales-taxhiringappointmentspublic-safetyroadsbudget
✓ Decided: Cayuga County Legislature approves 2025 paving and equipment purchases

The Cayuga County Legislature approved a $4.3 million paving list for 30 miles of roads, a $650,400 surface treatment list for 50 miles, and authorized the purchase of highway equipment and trucks. They also approved numerous contracts for social services, health department positions, and other county operations. A resolution for non-bargaining salary adjustments was tabled.

Fri Jan 24, 2025

Human Resources & Civil Services Commission

Civil Service Commission to review Sheriff's Department transfer request

The Cayuga County Civil Service Special Commission is meeting to conduct business. The primary agenda item is the review of personnel actions, specifically a transfer request from the Sheriff's Department.

personnelsheriffcivil-serviceemployment
✓ Decided: Civil Service Commission approves Sheriff's Dept transfer request

The Cayuga County Civil Service Commission held a special meeting on January 24, 2025, and approved a transfer request from the Sheriff's Department. The motion passed unanimously, and staff were directed to notify the appointing authority. No other substantive decisions were made.

Thu Jan 23, 2025

Community Services Board

Community Services Board to review welcome packet, hear reports

This is a standard monthly meeting with roll call, approval of prior minutes, public comment, and reports from the director and subcommittees. New business includes a review of the welcome packet. No major decisions or funding actions are listed.

community-servicesboard-meetingproceduralmental-healthdevelopmental-disabilitiessubstance-use
✓ Decided: Sarah VanDoren appointed to CSB and Alcohol/Substance Abuse Subcommittee

The Cayuga County Community Services Board approved Sarah VanDoren to fill open seats on both the Board and the Alcohol and Substance Abuse Subcommittee, with abstentions from two members. The board also approved a welcome packet for new members. No other substantive decisions were made; most subcommittees lacked a quorum.

Thu Jan 23, 2025

Health Insurance Consortium Board of Directors

Health insurance consortium to elect 2025 officers, review claims

The board will elect officers for 2025 and review medical and dental claims financials. They will also receive updates on wellness programs, marketing, and a hospital network. The consent agenda covers approval of previous minutes and financial reports.

health-insuranceconsortiumboard-meetingelectionsfinancial-reports
✓ Decided: Health insurance board re-elects officers, reviews 2024 claims

The Cayuga County Health Insurance Consortium Board approved the consent agenda, minutes, and financials, and re-elected the 2025 officers as they stood from last year. USI presented financial updates showing the medical plan at 108.4% and dental at 96.5% for 2024. The board discussed strategic planning, including specialty RX costs and self-insurance options, and tabled open enrollment until the next meeting. Contract negotiations with Excellus and St. Joseph's Health and Family Care were resolved.

Wed Jan 22, 2025

Parks & Trails Commission

Parks & Trails Commission reviews budget cuts and facility design projects

The commission is discussing 2025 budget reductions to capital projects and reviewing design services for Emerson Park. The body is also monitoring ongoing infrastructure repairs and museum programming funded by private donations.

budgetparksinfrastructuremuseumtrailszoning
✓ Decided: Parks Commission approves December minutes, reviews budget cuts

The Cayuga County Parks Commission approved the December meeting minutes and reviewed the 2025 budget reductions, which preserved island dredging, park office sewer refit, and pavilion repairs. No new resolutions were proposed. The commission also heard updates on Emerson Park projects, including a bridge replacement estimate of $2.75 million, and discussed contract renewals for the Rev Theatre and A&M Catering.

Tue Jan 21, 2025

Ways & Means Committee

Committee to consider extending 1% sales tax, approve contracts, and hear department updates

The Ways & Means Committee will hear updates from the Treasurer, Finance, Real Property, HR, and Purchasing departments, including tax collection, year-end processing, and recruitment. The committee will vote on resolutions including requesting state home rule to extend an additional 1% sales tax through November 2026, authorizing contracts with various social service agencies, and adjusting non-bargaining employee salaries for 2025.

sales-taxcontractssocial-serviceshealthreal-propertyemployee-compensationbudget
✓ Decided: Ways & Means Committee approves numerous contracts, hires, and 2025 paving list

The Cayuga County Ways & Means Committee approved a wide range of resolutions, including contracts for social services, health programs, and legal services, as well as authorizations to fill multiple positions across various departments. They also approved the 2025 paving and surface treatment lists, and tabled a resolution to create a Principal Environmental Planner position. All votes were unanimous unless noted.

Thu Jan 16, 2025

General Municipal Law 239-l, m & n Review Committee

Cayuga County reviews zoning and site plans for four towns

The GML 239-l, m & n Review Committee is meeting to evaluate local actions for potential intermunicipal or countywide impacts. The body will review several site plans, variances, and a zoning amendment. Decisions will be made on whether these actions are of local concern or require recommendations for approval or disapproval.

zoningland-useindustrialrestaurantssite-plans
✓ Decided: Committee recommends disapproval of Sterling restaurant site plan

The Cayuga County GML 239-l, m & n Review Committee reviewed seven municipal referrals. It recommended disapproval of a restaurant site plan in Sterling due to insufficient drainage, procedural errors, and construction without permits. It approved or found no intermunicipal concern for other items, and requested additional materials for a warehouse proposal in Aurelius.

Thu Jan 16, 2025

Mental Health Sub-Committee

Mental Health Subcommittee to hear Veterans Agency on mental health services

The Mental Health Subcommittee will meet to discuss veterans' mental health, the Local Services Plan, and the status of the Mental Health Task Force. Members will also receive reports from several behavioral health agencies and consider old and new business.

mental-healthveteranscayuga-countycommunity-servicestask-forcelocal-services-plan
✓ Decided: Mental Health Subcommittee January meeting cancelled due to lack of quorum

The January 16, 2025 meeting of the Mental Health Subcommittee was cancelled because a quorum was not present. No decisions were made or items discussed.

Wed Jan 15, 2025

Planning & Public Works Committee

Planning & Public Works Committee reviews municipal grants and land use updates

The committee is receiving updates on various planning and economic development projects, including grant implementations and zoning revisions. The session also includes the appointment of municipal representatives for several towns and villages.

zoninggrantseconomic-developmentplanninginfrastructure
Wed Jan 15, 2025

Legislature

Legislature to vote on amended rules separating Planning from Public Works committees

The Cayuga County Legislature will vote on adopting amended Rules of Order that restructure committees, separating Planning and Economic Development from Public Works, redefine the Personnel Committee, and set the Ways and Means Committee to five members. Following the resolution, the board will enter executive session to discuss the financial and employment history of a particular person and matters leading to an appointment.

legislaturerules-of-ordercommitteesplanningpublic-workspersonnelexecutive-sessioncounty-government
✓ Decided: Cayuga County Legislature adopts amended Rules of Order

The Cayuga County Legislature held a special meeting on January 15, 2025, and adopted Resolution No. 002-25, which amends the Legislature's Rules of Order. The amendments separate the committees overseeing Planning and Economic Development from Public Works, better define the Personnel Committee's function, and confirm that the Ways and Means Committee will have five members. The Legislature also entered executive session to discuss the financial and employment history of a particular person and matters leading to an appointment, then adjourned.

Wed Jan 15, 2025

Government Operations Committee

Board of Elections seeks contracts for ballot printing and mail processing

The Government Operations Committee will consider two contracts for the Board of Elections. The body will also receive IT updates regarding the 63 Genesee Street project and a transition to a new door access control system.

electionscontractsit-infrastructuregovernment-operationspublic-safety
✓ Decided: Committee approves ballot printing and mail machine contracts for Board of Elections

The Government Operations Committee approved two resolutions authorizing contracts for the Board of Elections: one with Phoenix Graphics for ballot printing and related services, and one with Pitney Bowes for mail management hardware and software. Both motions passed unanimously. The committee also received updates from various departments, including IT projects and Veterans Services activities, but took no other formal actions.

Wed Jan 15, 2025

Water & Sewer Authority Board

Board to hear updates on Auburn water contract, waterline project, strategic plan

The Cayuga County Water & Sewer Authority Board will review routine approvals, financial reports, and committee updates. Key discussion items include an update on the City of Auburn water contract negotiations, the Genesee Street Waterline Project, and the Cayuga Lake Protection Plan sanitary sewer work on Honoco Road. The board will also discuss developing a strategic plan and hold an executive session on board interview findings.

watersewercontractsinfrastructureplanningboard-meeting
✓ Decided: CCWSA approves $94K excavator and $32K sewer pump

The Cayuga County Water & Sewer Authority board approved the purchase of a spare sewer pump and repair kit for Eagle Drive totaling about $32K, and a new excavator for $94K from Fingerlakes Bobcat. They also approved signing agreements with the Town of Fleming and Town of Springport for water and sewer districts. The board approved prior meeting minutes and payment of open invoices. No other substantive decisions were made.

Tue Jan 14, 2025

Human Resources & Civil Services Commission

Civil Service Commission to adopt rules, establish eligible lists

The Cayuga County Civil Service Commission will conduct a routine business meeting, including appointing a chair for 2025, adopting or amending civil service rules, establishing and extending eligible lists for several positions, and adopting class specifications. The agenda also includes a human resources administrator's report covering recruitment, FMLA updates, and union salary increases.

civil-servicepersonneleligible-listsclass-specificationsappointments
✓ Decided: Civil Service Commission approves multiple personnel actions and rule updates

The Cayuga County Civil Service Commission approved routine personnel actions including a permanent appointment, establishment of eligible lists, adoption and amendment of class specifications, and new position duties statements. The commission also extended or expired several eligible lists as specified. No disciplinary actions, appeals, or reclassifications were considered.

Thu Jan 9, 2025

People with Development Disabilities Sub-Committee

Cayuga subcommittee meets to review agency reports and past minutes

The People with Developmental Disabilities Sub-Committee will convene at 12:00 pm on January 9 at 180 North Street in Auburn. The meeting includes a public comment period, approval of November 2024 minutes, and reports from eight local agencies serving individuals with developmental disabilities.

developmental-disabilitiescommunity-servicesagency-reportspublic-commentminutes-approval
✓ Decided: Subcommittee meeting cancelled due to inclement weather

The People with Developmental Disabilities Subcommittee meeting scheduled for January 9, 2025, was cancelled due to inclement weather. No substantive decisions were made.

Wed Jan 8, 2025

Health & Human Services Committee

Health & Human Services Committee to review multiple service contracts and staffing fills

The committee is considering several resolutions to fill vacancies in the Health and Social Services departments and authorize contracts for interpreting, foster parent recruitment, and homeless shelter services. The body will also receive updates on Medicaid reimbursements and Office for the Aging programs.

public-healthsocial-servicescontractsstaffinghomeless-servicessenior-services
✓ Decided: Committee approves contracts, hires, and budget amendments for health and social services

The Cayuga County Health & Human Services Committee approved a series of resolutions authorizing contracts, personnel hires, and budget amendments for the Health Department, Department of Social Services, and other agencies. All votes were unanimous. The committee also approved the December 3, 2024 minutes and received updates from department heads, including the lifting of a Medicaid reimbursement freeze and the Office for the Aging's 2024 service statistics.

Wed Jan 8, 2025

Judicial & Public Safety Committee

Committee to vote on $28K annual tower lease for emergency communications

The Judicial & Public Safety Committee will consider eight resolutions, including a $28,222.44 annual lease with American Tower Corporation for a colocation site in Spafford as part of the county's new Emergency Communications System. Other resolutions authorize filling multiple vacant deputy and probation officer positions, appoint the Administrator of Indigent Defendants at $45/hour, and recognize a new Cayuga County Search and Rescue Team. Department heads reported on jail population, probation caseloads, and emergency services operations.

public-safetyemergency-communications911sheriffprobationsearch-and-rescuepersonnelbudget
Wed Jan 8, 2025

Alcohol & Substance Use Sub-Committee

Alcohol & Substance Use Sub-Committee to vote for 2025 Chair

The Cayuga County Community Services Board's Alcohol & Substance Abuse sub-committee will meet to conduct agency and director reports. The body is scheduled to vote for its 2025 Chair.

substance-abusecommunity-servicesappointments
✓ Decided: ASAS Subcommittee meeting cancelled due to lack of quorum

The January 8, 2025 meeting of the Alcohol and Substance Abuse Subcommittee was cancelled because a quorum was not present. No decisions were made or items discussed.

Thu Jan 2, 2025

Legislature

Cayuga County Legislature to elect leaders and adopt Rules of Order at reorganization meeting

This is the annual reorganization meeting of the Cayuga County Legislature. The Legislature will elect a Chairperson and Vice Chairperson, designate Majority and Minority Leaders, and vote to adopt the County Legislature Rules of Order (Resolution 1-25-LEG-1). The meeting also includes a moment of prayer, roll call, and a death acknowledgement.

reorganizationleadershiprules-of-ordercounty-legislaturecayuga-county
✓ Decided: Cayuga County Legislature reorganizes, elects Anna as chairperson

The Cayuga County Legislature held its 2025 reorganization meeting, electing Anna as Chairperson and Nightengale as Vice Chairperson. Daly was named Majority Leader and Strong as Minority Leader. The Legislature also adopted Resolution No. 01-25, adopting the amended Rules of Order for 2025, which includes changes to committee structures and the Personnel Committee.

Thu Jan 2, 2025

Water Quality Management Agency (WQMA)

Water Quality Management Agency to review agency and lake reports

The Water Quality Management Agency will meet to review reports from various county departments, lake associations, and partner organizations. The agenda includes updates from working groups focused on invasive species, nutrients, and sediment.

water-qualityenvironmentinvasive-specieslake-management
✓ Decided: WQMA approves December minutes; hears grant and project updates

The Cayuga County Water Quality Management Agency met on January 2, 2025, and approved the December 5, 2024 meeting minutes unanimously. No new business was discussed. Members reported on recent grants, including REDC awards for a Brownfield Opportunity Area study and a countywide strategic plan, plus SWCD grants for shoreline stabilization and a culvert assessment. Several lake and partner updates were shared, but no substantive decisions were made beyond the minutes approval.