The Boring PartsFederalLocal · USLocal · Canada
Amarillo, TX

Amarillo public meetings in 2022

242 substantive meetings from 2022, with official agendas or minutes and plain-English summaries.

Thu Dec 29, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The provided agenda text contains no readable information

The agenda for the Tutbury Public Improvement District Advisory Board meeting on December 29, 2022, consists of unreadable numeric sequences. No specific items, discussions, or decisions can be identified from the provided record.

procedural
✓ Decided: Tutbury PID Advisory Board meeting cancelled

The meeting scheduled for December 29, 2022, was cancelled. No minutes were taken and no actions were recorded.

Thu Dec 29, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

No readable agenda items were found in the provided text

The meeting agenda for the Amarillo Board of Review for Landmarks, Historic Districts, and Downtown Design consists of unreadable numeric sequences. No specific decisions, proposals, or discussions are identifiable from this record.

amarilloboard of reviewunreadable
✓ Decided: Board approves variances for Polk Street streetscape and parking lot projects

The Board of Review approved several variances related to pedestrian way widths and lighting locations for the Polk Street Streetscape Project and two new parking lots. All motions passed unanimously.

Thu Dec 29, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Provided agenda text contains no readable information

The provided text for the Amarillo Board of Review for Landmarks, Historic Districts, and Downtown Design consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from this record.

amarilloboard of review
Wed Dec 21, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

Agenda text for December 21, 2022 meeting is unreadable

The provided agenda text consists of encoded numerical strings and contains no readable information regarding meeting topics or decisions.

unreadable
Mon Dec 19, 2022 · 10:00

Planning and Zoning Commission

No readable meeting items found in the provided agenda

The provided text for the December 19, 2022, Planning and Zoning Commission meeting consists of unreadable numeric sequences. No specific proposals, decisions, or discussions can be identified from this record.

unreadableplanning-and-zoningamarillo
✓ Decided: Planning and Zoning Commission approves three subdivision and plat requests

The Commission unanimously approved a suburban subdivision in Randall County and a replat for duplexes in Potter County. Additionally, a variance for maximum block length was approved for a residential preliminary plan. The body also viewed a training video on comprehensive planning.

Mon Dec 19, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items found in the provided text

The provided meeting agenda consists of unreadable numerical strings and symbols. No identifiable discussion topics, decisions, or projects could be extracted from this record.

none
✓ Decided: Amarillo EDC Board approves November meeting minutes

The Board of Directors approved the minutes from the November 14, 2022, meeting. No other substantive actions were taken during the session. Staff provided updates on sales tax collections and project timelines for Cacique, Amazon, and Albers.

Thu Dec 15, 2022 · 12:00

One Time Event

Unreadable agenda text provided for Amarillo meeting

The provided agenda text consists of numerical sequences and does not contain readable English information. No specific items, decisions, or discussions can be identified from the source.

unreadableincompleteno-content
Thu Dec 15, 2022 · 12:00

One Time Event

No readable agenda items found for this meeting

The provided agenda text consists of numerical sequences and does not contain discernible English information or identifiable topics. No specific decisions, proposals, or items can be identified from the source.

unreadableindecipherableno-content
Thu Dec 15, 2022 · 13:00

Amarillo City Council

✓ Decided: City Council approves $3.3M incentive package for Jax Transport, LLC

The City Council approved a location incentive agreement for Jax Transport, LLC to create up to 200 jobs. Other key actions included establishing a sister-city relationship with Dnipro, Ukraine, and awarding ARPA funding to four senior citizen nonprofit services.

Wed Dec 14, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The board will consider approving landscape maintenance bids.

The Tutbury PID Advisory Board will review minutes from the October 13, 2022 meeting. The board will also discuss ongoing district operations and maintenance and consider approval of landscape maintenance bids.

pidmaintenancelandscapingoperations
Tue Dec 13, 2022 · 11:30

Beautification and Public Arts Advisory Board

The provided meeting agenda contains no readable information

The text for the December 13, 2022, Amarillo Beautification and Public Arts Advisory Board meeting consists of unreadable numerical characters. No specific items, discussions, or decisions can be identified from the provided source.

amarillobeautificationpublic-arts
✓ Decided: Beautification and Public Arts Advisory Board forms 2023 Mural Grant Sub-Committee

The board approved the minutes from November 8, 2022, and appointed four members to the 2023 Mural Grant Sub-Committee. Staff provided updates on a Bloomberg Temporary Art Grant application and the Route 66 Centennial Celebration.

Tue Dec 13, 2022 · 13:00

Amarillo City Council

The provided agenda contains only encoded numerical indices.

The text for the December 13, 2022, Amarillo City Council meeting consists of numerical values rather than readable English. No specific items or decisions are identifiable from the source document.

proceduralunreadableamarillo
✓ Decided: City Council approves $3.3M incentive package for Jax Transport, LLC

The City Council approved a location incentive agreement for Jax Transport, LLC to create up to 200 jobs. Other key actions included establishing a sister-city relationship with Dnipro, Ukraine, and awarding ARPA funding to four senior citizen nonprofits.

Mon Dec 12, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee discusses sidewalk parking and bike trail rights-of-way

The committee will review the minutes from the October 18, 2022 meeting. Members will discuss vehicle parking blocking sidewalks and safety education opportunities. The agenda also includes updates on the TXDOT loop and walkability in Amarillo.

pedestrian-safetybicycle-safetysidewalkstxdotwalkability
Mon Dec 12, 2022 · 15:00

Library Advisory Board

Unreadable agenda text for Amarillo Library Advisory Board

The provided agenda text consists of numerical sequences and does not contain legible English content. No specific items, decisions, or discussions could be identified from the source.

unreadable
✓ Decided: Library Advisory Board approves October meeting minutes

The board unanimously approved the minutes from the October 10, 2022, meeting. The Director of Library Services provided updates on book sale revenues, winter programming, and ESL classes.

Thu Dec 8, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

The board will consider a short-term landscape maintenance contract.

The Heritage Hills PID Advisory Board will meet to approve October 12, 2022, minutes and consider a short-term landscape maintenance contract. The meeting also includes discussion of ongoing district operations and maintenance.

landscapemaintenancepid-operations
✓ Decided: Heritage Hills PID Board approves 6-month landscape maintenance contract

The Advisory Board approved a short-term landscape maintenance contract with Ramirez Lawn and Sprinkler. Tolk Persons volunteered to act as an agent for management and invoice approval until a formal management company contract is established.

Thu Dec 8, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

TIRZ #1 Board to discuss loan agreement and downtown development projects

The Center City Tax Increment Reinvestment Zone #1 Board will review the quarterly financial report ending September 30, 2022. The meeting includes discussions regarding the current loan agreement with the City of Amarillo and the Amarillo Local Government Corporation. Additionally, the Board will discuss updates for the Downtown Wayfinding Project and a potential Food Truck Park Project.

financedowntowndevelopmentamarillo
Thu Dec 8, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

TIRZ #1 Board discusses loan agreement and downtown development projects

The Center City Tax Increment Reinvestment Zone #1 Board will review the quarterly financial report ending September 30, 2022. The meeting includes discussions regarding a loan agreement with the City of Amarillo and updates on the Downtown Wayfinding Project and a potential Food Truck Park Project.

financedowntowndevelopmentamarillo
Wed Dec 7, 2022 · 13:30

One Time Event

Board considers senior services awards and new Warford Activity Center fee

The Parks & Recreation Board will review minutes from September 14, 2022, and receive updates on projects including 9th Street and playgrounds. The board will also consider recommendations for nonprofit senior services and a new room rental fee at the Warford Activity Center Game Room.

parkssenior servicesfeesrecreationamarillo
✓ Decided: Parks and Recreation Board recommends senior service grants and new Warford fee

The board approved the September 14, 2022, meeting minutes. It recommended that City Council award funding to four nonprofit senior service providers and approve a new hourly rental fee for the Warford Activity Center game room.

Tue Dec 6, 2022 · 07:30

Amarillo Hospital District Board of Managers

The provided agenda text contains no readable meeting items

The agenda for the Amarillo Hospital District Board of Managers meeting on December 6, 2022, consists of numerical sequences and does not contain readable information regarding decisions or discussions.

procedural
✓ Decided: Board approves RFP for single money manager to address $6M corpus fund deficit

The Board of Managers approved a request for proposals for a single money manager to coordinate the District's corpus portfolio. They also updated the corpus investment policy to match assets to liabilities and authorized annual funding for indigent care and public health.

Mon Dec 5, 2022 · 10:00

Planning and Zoning Commission

Commission to consider new plats and rezoning requests

The Planning and Zoning Commission will review two plat applications for Hollywood Addition Unit No. 20 and The Vineyards Unit No. 10. The commission will also consider rezoning acreage near Georgia St. and S.W. 58th Ave to Moderate Density and General Retail districts.

zoningplatsrezoningland-use
✓ Decided: Planning and Zoning Commission approves three land development requests

The Commission unanimously approved two final plats and one rezoning request. The decisions allow for the creation of new residential and retail lots in Randall and Potter Counties.

Mon Dec 5, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

Discussion of landscape maintenance specifications and contract details

The Quail Creek PID Advisory Board will discuss ongoing district operations and maintenance. The board will also consider landscape maintenance specifications and contract details.

maintenancelandscapingoperationspublic-improvement-district
✓ Decided: Quail Creek PID Board decides to seek hydroseeding quotes for park maintenance

The board approved the November 4, 2022, meeting minutes. Members decided that resodding the park area was over budget and opted to seek additional quotes for hydroseeding. The board also discussed developing landscape maintenance specifications for a January submission.

Fri Dec 2, 2022 · 07:30

Amarillo Hospital District Finance Committee

Reviewing investment strategy and policy changes for the District’s Corpus Funds

The Finance Committee will review minutes from the August 18, 2022 meeting. The committee will also discuss proposed changes to investment strategies for the District's Corpus Funds and consider updates to the Corpus Investment Policy.

financeinvestmenthospital-districtpolicy
✓ Decided: Finance Committee discusses investment strategy for District corpus funds

The committee reviewed current bond losses and potential strategies to match investment maturities with liabilities. No action was taken on the investment strategy or the updated corpus investment policy.

Mon Nov 21, 2022 · 08:30

Civil Service Commission

Civil Service Commission to elect officers and review exam appeals

The commission will elect a chairman and vice chairman and approve minutes from October 12, 2022. Members will also review personnel actions such as promotions and disciplinary actions. Additionally, the commission will consider examination appeals for Police Corporal and Fire District Chief positions.

policefirepersonnelcivil-serviceelections
✓ Decided: Civil Service Commission removes Police Corporal exam question

The Commission approved a revised eligibility register for Police Corporals after granting an appeal to remove one exam question. Appeals regarding two Fire District Chief exam questions were denied. The board also approved personnel rule revisions and a list of employee actions.

Mon Nov 21, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission meeting on November 21, 2022

The Planning and Zoning Commission will hold a work session and a regular meeting. The agenda consists of procedural items, including reviewing upcoming agenda items and receiving updates on cases sent to City Council. No specific rezonings or ordinances are listed for this meeting.

planningtrainingadministration
✓ Decided: Planning and Zoning Commission approves November 7 meeting minutes

The Commission approved the minutes from its November 7, 2022, meeting. Members also viewed an introductory planning training course and discussed the proper procedures for interacting with citizens regarding active cases.

Fri Nov 18, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider approving or cancelling a landscape maintenance bid

The Colonies Public Improvement District Advisory Board is meeting to discuss ongoing district maintenance items. The board will also consider whether to approve or cancel Landscape Maintenance Bid #7319.

maintenancelandscapepidamarillo
✓ Decided: Colonies PID Advisory Board cancels landscape maintenance bid

The board unanimously voted to cancel Bid #7319 for landscape maintenance after the highest-scoring bidder submitted a proposal double the budget. The board will resubmit for a new bid and decided against holding a pre-bid meeting to avoid delaying the timeline.

Wed Nov 16, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The Board will discuss the Polk Street Streetscape Project and new board policies.

The Amarillo Convention and Visitors Bureau Board will review financial reports and approve October minutes. The meeting includes updates on the Polk Street Streetscape Project and officer election procedures. Members will also discuss potential board policies and requests for the 2023 Strategic Plan.

tourismstreetscapepolicystrategic-planfinance
✓ Decided: Convention and Visitors Bureau approves October meeting minutes

The Board approved the minutes from the October 26, 2022 meeting. Members discussed a 501(c)(3) status approval, the Polk Street Streetscape Project, and potential new board policies. No other formal votes were recorded.

Wed Nov 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no readable information.

The document for the November 16, 2022, meeting of the Amarillo Firemen's Relief and Retirement Fund Board of Trustees consists of unreadable numerical sequences. No discernible agenda items or discussion topics are present in the provided text.

unreadableno-contentno-information
Tue Nov 15, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to review quarterly financials and Amarillo National Center payments

The Board will review quarterly financial reports as of September 30, 2022. Discussion items include updates to the District's investment policy and payments related to the Amarillo National Center. The Board will also receive status updates on approved projects at the Tri-State Fairgrounds and Amarillo Civic Center.

financeinvestmentamarillo-national-centerfairgroundscivic-centerbudget
✓ Decided: Board approves August 2022 meeting minutes

The Board approved the minutes from the August 22, 2022 meeting. The Finance Director presented unaudited quarterly financials for the period ending September 30, 2022.

Mon Nov 14, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided meeting agenda text is unreadable.

The source document contains only numeric sequences and does not provide readable information regarding the Amarillo Economic Development Corporation Board of Directors meeting.

unreadableagenda
✓ Decided: Board approves $3.3M incentive package for Jax Transport, LLC

The Board unanimously approved a job creation and construction incentive package for Jax Transport, LLC. The board also approved the minutes from the October 11, 2022 meeting.

Wed Nov 9, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board discusses potential sale of parking garage and retail spaces

The Board will receive updates on Hodgetown, Embassy Suites, and the Parking Garage and Retail Space. Members will discuss year-end financials and potential changes to loan agreements. The meeting also includes discussions regarding options to sell all or portions of the parking garage and retail spaces.

financeparkingretaildevelopment
✓ Decided: LGC Board to explore converting TIRZ #1 loan into a grant

The Board reached a consensus for staff to approach TIRZ #1 regarding the potential transition of a loan agreement into a grant. The Board also approved the minutes from the October 19, 2022 meeting.

Wed Nov 9, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss project and department updates

The Parks & Recreation Board will review the minutes from the September 14, 2022 meeting. The board will also receive reports on 9th Street, playgrounds, and various departmental divisions.

parksrecreationzooinfrastructurepublic-arts
Tue Nov 8, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Selection of contractor for Scott Park drainage work

The board will discuss addressing drainage at Scott Park and consider selecting a contractor for the project. Additionally, members will review City policies regarding developer reimbursement and PID oversight.

drainagescott-parkdeveloper-reimbursementpid-oversightinfrastructure
✓ Decided: Greenways PID Advisory Board selects contractor for Scott Park drainage

The board approved a contractor to address drainage issues at Scott Park and approved the minutes from the June 9, 2022 meeting. Members discussed PID reimbursement policies, the hiring of a PID Manager, and various landscaping maintenance priorities.

Tue Nov 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

Updates on mural grants, sculptures, and library murals

The Beautification and Public Arts Advisory Board will review minutes from the October 11, 2022 meeting. The board will also receive updates regarding mural grant applications, sculptures, and a library mural project.

artsmuralspublic-artbeautificationgrants
Tue Nov 8, 2022 · 13:00

Amarillo City Council

The November 8, 2022, Amarillo City Council agenda text is unreadable

The provided agenda text consists of encoded numeric sequences that do not contain readable information. No specific items, decisions, or discussions can be identified from the source document.

amarillocity-councilunreadable
Mon Nov 7, 2022 · 10:00

Planning and Zoning Commission

Rezoning Holland’s Addition for a new outdoor auto sales lot

The Planning and Zoning Commission will consider several land use applications, including plats, a rezoning request, and a right-of-way vacation. The meeting also includes a presentation regarding the City Plan Kick-Off by MIG.

zoningland-usecity-planningplatrezoning
✓ Decided: Planning and Zoning Commission denies alley vacation for restaurant drive-thru

The Commission approved two subdivision plats, a rezoning request for an auto sales lot, and variances for Storybook Estates. A request to vacate a public alley for a Chop Chop restaurant drive-thru was denied following public opposition.

Fri Nov 4, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

Discussion of landscape maintenance specifications and contract details

The Quail Creek PID Advisory Board will discuss ongoing district operations and maintenance. The board will also consider landscape maintenance specifications and contract details.

landscapingmaintenanceoperationspublic-improvement-district
✓ Decided: Quail Creek PID Advisory Board approves purchase of pet waste stations

The board approved spending $350 for two green pet waste stations. Members discussed the poor condition of park landscaping and the need for a new maintenance contract, but tabled the approval of bid specifications.

Wed Oct 26, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Amarillo Convention and Visitors Bureau Board to consider arts marketing grants

The Amarillo Convention and Visitors Bureau Board will meet to review financial reports and approve minutes from September 28, 2022. The board is also scheduled to consider actions regarding arts marketing grants, budget adjustment policy, and an amendment to the Certificate of Formation.

tourismgrantsbudgetartsmarketingadministration
✓ Decided: CVB Board approves $139,700 in arts marketing grants

The Board approved arts marketing grants totaling $139,700 and adopted a budget adjustment policy. Members also approved an amendment to the Certificate of Formation to meet IRS requirements for 501(c)(3) status.

Wed Oct 26, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board considers streetscape grant and downtown project reimbursements

The Center City TIRZ #1 Board of Directors will consider a streetscape grant for the Texas Panhandle First Responders Memorial Project at 1018 S Polk Street. The board will also discuss a reimbursement agreement with Texas Blakey Amarillo, LLC regarding design and feasibility study costs for a proposed downtown residential project.

streetscapegrantsredevelopmentdowntownmemorials
Wed Oct 26, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board considers streetscape grant and downtown residential project costs

The Board will consider a streetscape grant for the Texas Panhandle First Responders Memorial Project at 1018 S Polk Street. Members will also discuss reimbursement for design services and feasibility studies for a downtown residential project. Additionally, the board will review the Wayfinding Project and active incentive agreements.

grantsdevelopmentdowntownmemorialsstreetscape
Tue Oct 25, 2022 · 13:00

Amarillo City Council

Council considers $5 million settlement and $28 million building renovation

The Amarillo City Council will consider a $5,000,000 settlement agreement and a construction manager award up to $28,000,000 for the Amarillo Hardware Building renovation. The agenda also includes tax abatement and incentive agreements for Coast Packing Company — South. Additionally, several rezoning requests and airport equipment purchases are up for consideration.

zoningbudgetconstructionairportpolicehousing
✓ Decided: City Council approves $28M construction manager for new City Hall

The City Council approved Western Builders, Inc. as the construction manager for the new City Hall renovation. Other key actions included approving a $5M legal settlement and providing job-creation incentives to Coast Packing Company - South.

Mon Oct 24, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The October 24, 2022, Colonies PID Advisory Board meeting was cancelled.

The scheduled meeting of the Colonies Public Improvement District Advisory Board for October 24, 2022, was cancelled. The agenda included approving minutes and discussing a proxy for Bid #7319.

pidamarillocancelled
✓ Decided: Meeting cancelled, no decisions made

The Colonies Public Improvement District Advisory Board meeting scheduled for October 24, 2022, was cancelled. No minutes were taken and no substantive decisions were made.

Wed Oct 19, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no legible information.

The meeting agenda for the Amarillo Firemen's Relief and Retirement Fund Board of Trustees on October 19, 2022, does not contain readable items or discussion topics. The source text consists only of numerical sequences.

firemenretirementfund
Wed Oct 19, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board to discuss parking garage software, retail pricing, and project updates

The Amarillo Local Government Corporation Board of Directors will review updates for Hodgetown, Embassy Suites, and the Parking Garage. The board will consider Skidata software updates and listing prices for parking garage retail space. Discussions regarding negotiations for the parking garage retail space are also scheduled.

parkingretaildevelopmenthodgetownembassy suites
✓ Decided: Board debated parking garage retail space lease rate, no final decision

The Amarillo Local Government Corporation Board discussed lowering the lease rate for parking garage retail space from $20 to $14 per square foot with no tenant improvement allowance, but no final decision was made. A motion to set the rate at $16 was amended, and the item was tabled for further discussion. The board also received updates on Embassy Suites and Hodgetown projects, and approved minutes from the July 20, 2022 meeting (5-0).

Tue Oct 18, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee discusses safety education and walkability updates in Amarillo

The committee will review minutes from the August 8, 2022 meeting. Members will also discuss safety education and receive updates on right of way availability and walkability in Amarillo. Kim Hooker from TxDOT will be introduced to the committee.

pedestrian-safetybicycle-safetytransportationwalkabilitypublic-safety
Mon Oct 17, 2022 · 10:00

Planning and Zoning Commission

Commission to consider variance for 443.6-acre Storybook Estates plan

The Planning and Zoning Commission will review a variance request regarding alleys and block length for the Storybook Estates preliminary plan near Loop 335 and S. Grand St. The commission will also consider vacation of a 0.10-acre public alley in the Ridgecrest Unit No. 14 area. Additionally, the meeting includes updates on cases previously sent to City Council.

zoningland-usedevelopmentpublic-works
Thu Oct 13, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The October 13, 2022, Center City TIRZ #1 Board meeting was cancelled

This meeting was cancelled due to a lack of quorum. The agenda included discussions regarding streetscape grants and reimbursement agreements for downtown projects.

developmentgrantsdowntownamarillo
✓ Decided: Center City TIRZ #1 Board meeting cancelled

The October 13, 2022 meeting of the Amarillo Center City Tax Increment Reinvestment Zone #1 Board of Directors was cancelled. No minutes were taken and no decisions were made.

Thu Oct 13, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The October 13, 2022, Center City TIRZ #1 Board meeting was cancelled.

The scheduled meeting for the Center City Tax Increment Reinvestment Zone #1 Board of Directors was cancelled due to a lack of quorum. Proposed agenda items included a streetscape grant and reimbursement agreements for downtown projects.

zoninggrantsdowntowndevelopmentmemorial
✓ Decided: Center City TIRZ #1 Board meeting cancelled; no decisions made

The October 13, 2022 meeting of the Center City Tax Increment Reinvestment Zone #1 Board of Directors was cancelled. No minutes were taken and no business was conducted.

Thu Oct 13, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The Tutbury PID Advisory Board will consider landscape maintenance specifications.

The Tutbury Public Improvement District Advisory Board will discuss ongoing district operations and maintenance. The board will also consider the approval of landscape maintenance specifications.

pidmaintenancelandscapingoperations
Thu Oct 13, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board considers sign height variance at 8772 S Coulter Street

The Zoning Board of Adjustment will consider a request for a variance to exceed the height limit for a freestanding sign at 8772 S Coulter Street. The board will also review the minutes from the September 8, 2022 meeting.

zoningsignageland-use
Wed Oct 12, 2022 · 08:30

Civil Service Commission

Commission to consider new member appointment and approve police and fire registers.

The Civil Service Commission will consider appointing a new member and approving minutes from August 24, 2022. The body will also review employee transfers, promotions, and disciplinary actions. Additionally, the commission will consider eligibility registers for police recruits and fire personnel.

policefirepersonnelappointmentscivil-service
✓ Decided: Commission approves new employee actions and eligibility registers

The Civil Service Commission approved minutes from August 24, 2022, a list of personnel actions (new hires, step increases, transfers, promotions, demotions, bypasses, temporary assignments, and disciplinary actions), and eligibility registers for Police Recruit, Fire Lieutenant, and Fire Fighter positions. A new member, Lawrence Walker, was welcomed without a vote. No public comments were received.

Wed Oct 12, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Discussion of phase 3 landscape improvements and district operations

The Heritage Hills Public Improvement District Advisory Board will discuss phase 3 of landscape improvements and ongoing PID operations and maintenance. The board will also consider approving the minutes from the August 10, 2022 meeting.

landscapingpublic-improvement-districtoperationsmaintenance
✓ Decided: Board approves putting Phase III landscape improvements out to bid

The board voted unanimously to put Phase III landscape improvements out to bid, including 122 lights for an estimated $175,935. They also approved requests for quotes for a short-term six-month maintenance contract and a professional services management contract, and voted to put out a bid for a standard one-year maintenance contract with renewal options. The board discussed ongoing issues with the lack of a maintenance contract and non-payment of invoices to W Real Estate.

Tue Oct 11, 2022 · 10:00

Airport Advisory Board

✓ Decided: Airport board approves artwork for terminal building

The Airport Advisory Board approved artwork to be displayed in the terminal building and approved the minutes from the July 12, 2022 meeting. The board also received a presentation on airport activities and projects, including updates on a $1.1 million parking garage elevator project and a terminal basement plumbing project awarded to Panhandle Steel Buildings. No other decisions were made; the remaining items were discussed only.

Tue Oct 11, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items found for October 11 meeting

The provided text for the Amarillo Economic Development Corporation Board of Directors meeting contains unreadable numeric sequences. No specific decisions, proposals, or discussions can be identified from the source.

amarilloeconomic-development
✓ Decided: EDC approves $12K/job incentive for Coast Packing Company

The Amarillo Economic Development Corporation Board of Directors unanimously approved a job creation incentive of $12,000 per job for up to 60 jobs, plus up to $1,000,000 in rail infrastructure and conveyance of 30.03 acres in CenterPort Business Park, for Coast Packing Company, a beef tallow producer. The board also unanimously approved the minutes from the August 29, 2022 meeting. One project (21-11-01) was tabled to a future date. No public comments were received.

Tue Oct 11, 2022 · 11:30

Beautification and Public Arts Advisory Board

Beautification Board to review mural grants and community crosswalk standards

The Beautification and Public Arts Advisory Board will discuss several ongoing projects and updates. This includes reviews of mural grant applications, the HOODOO Mural Festival, and library murals. The board will also receive information on community crosswalk program design standards.

muralpublic-artsbeautificationcrosswalkscommunity-projects
✓ Decided: Board discussed mural grants, crosswalk program, and neighborhood art funds

The meeting was largely informational and procedural. The board approved minutes from July 13, 2022, and received updates on the mural grant application period (opening November 9), the HOODOO Mural Festival sponsorship ($2,500 donated for supplies), a proposed neighborhood mural grant using $10,000 per plan area from council-approved funds, a community crosswalk pilot program, a library mural project, and a junction box art project. No binding votes were taken on new initiatives.

Tue Oct 11, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $18 million agreement for new financial software

The council will consider several large contracts, including an $18 million agreement for enterprise resource planning software and a $2.3 million implementation contract. Other items include rezoning requests and various service awards for city infrastructure. The council will also discuss a potential sister city relationship with Dnipro, Ukraine.

softwarebudgetzoningfinancepublic-works
✓ Decided: Council approved $18M ERP software contract and $7.5M LED lighting upgrade

The council approved a 15-year, $18,067,068 software-as-a-service agreement for a new Financial/ERP system, plus related implementation and cashiering contracts totaling over $4.7 million. They also awarded a $7,551,372 contract for LED field lighting at seven parks. Several zoning changes were approved, including a rezoning for a mini-storage facility and an adult day care use. One rezoning item was tabled to a future meeting.

Mon Oct 10, 2022 · 15:00

Library Advisory Board

Library Advisory Board to review department activities and upcoming exhibition tour

The Library Advisory Board will meet to approve minutes from the August 8, 2022 meeting. The Director of Library Services will present updates on departmental issues, including programming at all APL locations and the Friends of the Library. The board will also receive an update regarding Americans and the Holocaust.

libraryprogrammingpublic-meetingamarillo
✓ Decided: Library board hears report on successful Holocaust exhibition, new programs

The Library Advisory Board approved the August 8, 2022 minutes and received updates from the Director of Library Services on departmental activities. No formal decisions were made beyond the minutes approval; the meeting was largely informational.

Thu Oct 6, 2022 · 12:00

Advisory Committee for People with Disabilities

Advisory Committee for People with Disabilities to discuss transit and MPO plans

The Advisory Committee for People with Disabilities will review meeting minutes from April 7, 2022. The agenda includes updates on current transit projects and a presentation regarding Metropolitan Planning Organization (MPO) plans. Members will also discuss committee powers and brainstorm future projects.

disabilitytransitplanningpublic-forumamarillo
Mon Oct 3, 2022 · 10:00

Planning and Zoning Commission

Commission to review new plats and a rezoning request

The Planning and Zoning Commission will consider three plat applications for residential additions and one rezoning request for an 0.86-acre tract. The meeting also includes updates on previous cases and approval of past meeting minutes.

zoningplatsrezoningland-useamarillo
✓ Decided: Commission approves rezoning for 7 townhomes near Bell St.

The Amarillo Planning and Zoning Commission unanimously approved a rezoning of 0.86 acres at Bell St. and Ventura Dr. from Residential District 3 to Moderate Density District, allowing development of 7 single-family attached townhomes. The commission also approved three residential replats: The Colonies Unit No. 81, Wolflin Estates Unit No. 12, and Wolflin Terrace Unit No. 3, all unanimously. No public comments were made on the consent agenda or most plat items, but one resident voiced concerns about traffic and property maintenance during the rezoning hearing.

Wed Sep 28, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Board to consider staff salaries and receive project updates

The Amarillo Convention and Visitors Bureau Board will consider staff salaries and review presentations from TACVB and Voyage+. The agenda also includes a financial report and the approval of minutes from August 24, 2022.

tourismsalariesfinancepresentations
✓ Decided: CVB Board approves staff salaries, red boots for marketing, and new budget adjustment policy

The Convention and Visitors Bureau Board approved staff salary amounts (with a few receiving more), authorized red boots as a marketing tool, and voted to require any budget adjustments over $10,000 to be an action item on future agendas. The board also discussed staff reviews and salaries in executive session, and noted the Sales and Servicing assistant position will be filled next June or July.

Wed Sep 28, 2022 · 17:00

Animal Management & Welfare Advisory Board

Amarillo Animal Management & Welfare Advisory Board reviews department updates

The board will consider approving the May 11, 2022, meeting minutes. Members will also receive reports regarding department staffing and various animal welfare programs.

animal-welfarereportsstaffingpublic-commentamarillo
✓ Decided: Board approves May 2022 minutes, hears AMW activity report

The board voted 4-0 to approve the minutes from the May 11, 2022 regular meeting. No other decisions were made; the remainder of the meeting consisted of staff reports on intake numbers, new hires, adoption and outreach events, and the transition of rescue placement duties after APHS vacated the city shelter.

Tue Sep 27, 2022 · 13:00

Amarillo City Council

No readable agenda items found for Amarillo City Council

The provided agenda text consists of numeric placeholders and contains no readable information. No specific decisions, discussions, or items can be identified from this record.

proceduralunreadable-text
✓ Decided: Council approved $1.55M in heavy equipment and $1.13M in mowers

The council approved a consent agenda including over $2.6 million in equipment purchases, multiple public improvement district budgets, and several grants. They also passed first readings of ordinances to vacate rights-of-way, rezone properties, and change taxi fares. All votes were 4-0 with one member absent.

Wed Sep 21, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains unreadable encoded text.

The source document for the September 21, 2022, Firemen's Relief and Retirement Fund Board of Trustees meeting consists of non-textual numerical strings. No specific items, decisions, or discussions can be identified from the provided text.

unreadable
✓ Decided: Firefighters' pension board approves $111K investment manager fee

The board unanimously approved payments to investment managers and professional services, including $111,836 to Luther King Capital Management and $600 for audit services. They also tabled a beneficiary change request and approved a refund of retirement contributions. The board discussed preliminary actuarial study results and investment policy changes.

Mon Sep 19, 2022 · 10:00

Planning and Zoning Commission

✓ Decided: Commission approves rezoning for homes and storage, denies adult day care

The Amarillo Planning and Zoning Commission approved two rezoning requests: a 5.24-acre tract from Agricultural to Residential District 3 for single-family homes (Vineyards Subdivision phase), and a 7.08-acre tract from Agricultural to Planned Development District for a mini-storage facility. The commission also approved an amendment to Planned Development District 359 to add adult day care as an allowed use, despite staff recommending denial. Three residential replats were tabled to the next meeting because corrected originals had not been received.

Mon Sep 19, 2022 · 10:00

Planning and Zoning Commission

Commission considers rezoning for residential and mini-storage developments

The Planning and Zoning Commission will review several platting requests and rezoning applications. These include changes to land use for residential, mini-storage, and adult day care uses.

zoninghousingland-usedevelopment
Mon Sep 19, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Tutbury PID Board considers landscape specifications and tree maintenance reimbursement

The Tutbury Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider approving landscape maintenance specifications and tree maintenance reimbursement to the Tutbury Home Owners Association.

maintenancelandscapehousingpublic-improvement-district
Wed Sep 14, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss budget, master plan, and department updates

The Parks & Recreation Board will consider approving the minutes from the August 10, 2022 meeting. The board will also receive reports regarding the budget, master plan, and 9th Street project. Various departmental divisional updates will be presented.

parksbudgetmaster-planrecreationpublic-arts
Tue Sep 13, 2022 · 11:30

Beautification and Public Arts Advisory Board

Beautification Board to review mural grant reimbursements and elect Vice-Chair

The Beautification and Public Arts Advisory Board will receive updates on projects including the Library Mural and Thompson Park. The Board will also consider action on mural grant reimbursement invoices and the election of a Vice-Chair.

beautificationpublic-artsmuralsparkslocal-government
✓ Decided: Board approves mural reimbursements, elects new vice-chair

The board approved two mural grant reimbursements for Color Art and Amarillo Little Theatre, and elected Jason Boyett as vice-chair. No public comments were made. Several updates were received on TxDOT, Keep Texas Beautiful, library mural, Thompson Park, State of the City, and mural grant reallocation.

Tue Sep 13, 2022 · 13:00

Amarillo City Council

The provided meeting agenda contains no readable information.

The source document consists of encoded numerical strings that do not form legible English words or sentences. Consequently, the specific decisions and discussions for this Amarillo City Council meeting cannot be determined from the provided text.

unreadableamarillo-texas
✓ Decided: Council approves $1.3M downtown land purchase for new City Hall

The council authorized the purchase of three buildings and land at 501, 509, and 517 S. Grant Street for $1.3 million plus closing costs, intended for the new City Hall remodel. It also approved a $2 million land purchase at Airport Boulevard and SE 3rd Avenue for economic development. A gas franchise was granted to West Texas Gas, and legislative priorities were adopted on a 4-1 vote.

Thu Sep 8, 2022 · 13:00

Amarillo City Council

Unreadable agenda text provided for Amarillo City Council meeting

The provided agenda text consists of encoded numerical data that cannot be read as English. No specific items, decisions, or discussions can be identified from this source.

unreadableprocedural
✓ Decided: Council adopts FY 2022-23 budget and property tax rate

The council voted 4-0 to adopt the FY 2022-23 budget (Ordinance 8004) and set a property tax rate of $0.40628 per $100 valuation, a 2.35% increase. A separate ratification vote also passed 4-0. A public hearing on the proposed tax rate was held with one speaker for and one against.

Thu Sep 8, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board to consider side yard setback variance at 3405 Golden Chestnut Lane

The Zoning Board of Adjustment will meet to approve minutes from the July 14, 2022 meeting and consider a single variance request. The agenda also includes a public forum for citizen comments.

zoningvarianceamarillosetbacks
✓ Decided: Board approved a variance to reduce side yard setback for a pergola at 3405 Golden Chestnut Lane

The Zoning Board of Adjustments approved Variance V-22-07 for a property at 3405 Golden Chestnut Lane, reducing the required side yard setback for a pergola that was already 90% complete. The vote was unanimous (5-0). The board also unanimously approved the minutes from the July 14, 2022 meeting.

Wed Sep 7, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning 21.24 acres at SW 34th Ave. and Soncy Rd.

The Planning and Zoning Commission will review several land use requests, including a new plat for The Colonies Unit No. 81. The agenda also includes multiple rezoning applications and the vacation of two public rights-of-way.

zoningplattingland-useamarillo
✓ Decided: Commission recommends rezoning for Amarillo Bible Chair expansion

The Planning and Zoning Commission voted unanimously to recommend approval of a rezoning for the Amarillo Bible Chair to allow a new building with increased lot coverage, reduced setbacks, and extended hours. The item will go to City Council for final approval. The commission also approved several other rezoning and plat items, including a replat for The Colonies subdivision and a vacation of rights-of-way for the new City Hall project.

Tue Sep 6, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers 2022/2023 budget and property tax rate increase

The City Council will hold a public hearing on the fiscal year 2022/2003 budget, which includes a $13,211,986 increase in property tax revenue. The council is also considering ordinances to adopt this budget and set a total ad valorem tax rate of $0.49086 per $100 valuation.

budgettaxesordinancepublic-hearingpolicefire
✓ Decided: Council adopts FY 2022/2023 budget and sets property tax rate

The Amarillo City Council unanimously approved the FY 2022/2023 budget (Ordinance 8004) and set the ad valorem property tax rate at $0.49086 per $100 valuation (Ordinance 8005), which includes a 2.35% effective increase. Both ordinances passed 5-0 after a public hearing with no speakers.

Mon Aug 29, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided agenda for the Amarillo EDC contains no readable items.

The source text consists of unreadable encoded characters. No meeting topics, proposals, or decisions can be identified from the provided document.

amarilloeconomic-development
✓ Decided: EDC board approves $2M land purchase for northeast Amarillo site

The board unanimously approved a land purchase at $19,260/acre for 103.84 acres in the northeast quadrant, pending a formal appraisal. They also approved the FY2022-2023 budget with a 9.5% increase, including a 5% cost-of-living adjustment for personnel. The investment report was approved as presented.

Mon Aug 29, 2022 · 14:00

Colonies Public Improvement District Advisory Board

Consideration of landscape maintenance specifications and a management contract

The Colonies PID Advisory Board will discuss ongoing improvement maintenance items. The board will also consider approving landscape maintenance specifications for Bid #7319 and a management contract for maintenance and operations activities.

landscapemaintenancecontractspidamarillo
✓ Decided: PID board tables Spartanburg curb work, advances tree specs

The Colonies PID Advisory Board approved the August 12, 2022 minutes and discussed maintenance items. They agreed to postpone the Spartanburg curb end cap project, pending future need, and directed staff to solicit bids for Valcour pedestal lighting and irrigation repairs. The board also reviewed amendments to the landscape maintenance bid specifications (Bid #7319), including adding a performance bond and mandatory pre-bid meeting, but took no formal action on the bid or the management contract.

Thu Aug 25, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Consideration of the Pavilion at the Santa Fe Depot Project

The Board will consider a project for the Pavilion at the Santa Fe Depot in Holland’s Addition. The meeting also includes a discussion regarding a Comprehensive Plan Update.

landmarkshistoric-districtsdowntown-designplanning
✓ Decided: Board approves variances for Santa Fe Depot pavilion despite opposition

The Board of Review for Landmarks, Historic Districts, and Downtown Design approved variances for the Pavilion at the Santa Fe Depot project, allowing deviations from Downtown Amarillo Urban Design Standards for walkways, building edge, and fencing. The motion passed 5-1, with one board member voting against and an alternate not participating. The project is a city-owned open-air structure for events like the WRCA Rodeo.

Thu Aug 25, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Consideration of the Pavilion at the Santa Fe Depot Project

The Board will consider a project for the Pavilion at the Santa Fe Depot located in Holland’s Addition. The meeting also includes a discussion regarding the Comprehensive Plan Update.

landmarkshistoric-districtsdowntown-designplanningsanta-fe-depot
✓ Decided: Board approves variances for downtown pavilion despite concerns over design and impact

The Board of Review approved variances for the Pavilion at the Santa Fe Depot project, including walkway, building edge, and fencing standards. The vote was 5-1, with one member dissenting over concerns about blocking the historic depot and lack of a site plan. The project is intended to host events like the WRCA Rodeo and other community activities.

Wed Aug 24, 2022 · 08:30

Civil Service Commission

Appointment of new commission member and review of eligibility registers

The Civil Service Commission will consider appointing a new member to the commission. The meeting includes reviewing employee updates such as promotions, transfers, and disciplinary actions. The commission will also review eligibility registers for Fire District Chief and Police Recruit positions.

civil-servicepolicefirepersonnelappointments
✓ Decided: Civil Service Commission approves personnel actions and eligibility lists

The Amarillo Civil Service Commission met on August 24, 2022, and approved minutes from the previous meeting, a list of employee actions (including new hires, step increases, transfers, promotions, demotions, bypasses, temporary assignments, and disciplinary actions), and eligibility registers for Fire District Chief and Police Recruit positions. No public comments were received, and no votes were needed for the appointment of a new member.

Wed Aug 24, 2022 · 08:30

Amarillo Convention and Visitors Bureau

ACVB Board to discuss arts committee structural changes

The Amarillo Convention and Visitors Bureau Board will review financial reports and minutes from July 27, 2022. The meeting includes a presentation by Smith Travel Research and a discussion regarding changes to the ACVB Arts Committee structure.

tourismartsfinancetravel-research
✓ Decided: CVB Board approves July minutes, hears HOT and tourism updates

The board approved the July 27, 2022 minutes unanimously. Staff reported hotel occupancy tax is stable, with Hodgetown payment made and future HOT going to reserves; a $25,000 fall travel campaign is planned. The Arts Committee will eliminate voting members starting next fiscal year, with subcommittees handling airport art and grant decisions. No votes were taken on substantive policy or spending items.

Mon Aug 22, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to discuss 2022/2023 budget and elect new officers

The Board will review quarterly financials as of June 30, 2022, and discuss the 2022/2023 District Budget. The meeting also includes the election of officers and consideration of a lease addendum with the Amarillo Tri-State Exposition.

budgetfinanceelectionsleasingamarillo-national-center
✓ Decided: Board approves $5M budget, denies $30K fair request

The Amarillo-Potter Events Venue District Board approved the 2022/2023 budget of $5,023,737 in expenses with $4,116,543 in anticipated revenues, leaving a projected ending reserve of $5,001,765. The board also denied a $30,000 event assistance request for the Tri-State Fair that was initially proposed in June. Other actions included approving minutes, reelecting officers, and approving payments and a lease addendum.

Thu Aug 18, 2022 · 07:30

Amarillo Hospital District Board of Managers

Finance Committee to consider 2022/2023 Amarillo Hospital District budget

The Finance Committee will consider the Amarillo Hospital District budget for the 2022/2023 fiscal year. The committee will also discuss a recommended funding increase for specialized pediatric services through Texas Tech University Health Sciences Center.

budgethealthcarepediatricspensionpublic-health
Thu Aug 18, 2022 · 07:30

Amarillo Hospital District Finance Committee

Committee to consider 2022/2023 budget and pediatric service funding increase

The committee will discuss the Amarillo Hospital District Budget for the 2022/2023 fiscal year. Members will also consider a recommendation to increase funding for Texas Tech University Health Sciences Center pediatric services. Additionally, staff will present on local suicide prevention efforts and a retirement plan actuarial report.

budgethealthcarepediatricspensionpublic health
✓ Decided: Hospital District Committee approves $250K increase for Texas Tech pediatrics

The Amarillo Hospital District Finance Committee voted unanimously to increase annual funding to Texas Tech Pediatric Subspecialties by $250,000 and to raise Tobacco Free Amarillo funding to $375,000 for fiscal year 2022/2023. The committee also approved the minutes from the previous meeting and received presentations on a local suicide prevention program and the pension plan's actuarial report, noting the plan was 107.6% funded but may decline due to market conditions. No action was taken on the pension plan or the suicide prevention program.

Thu Aug 18, 2022 · 12:00

One Time Event

The East Gateway TIRZ Board will consider the FY2022-23 annual budget.

The Tax Increment Reinvestment Zone #2 Board of Directors is meeting to discuss the FY2022-23 annual budget. The board will also consider approving minutes from the July 21, 2022 meeting.

budgetfinanceeast-gatewaytax-increment
✓ Decided: East Gateway TIRZ #2 Board approves FY2022-23 annual budget

The board unanimously approved the FY2022-23 annual budget, which includes new $100,000 Community Projects and $150,000 Debt Service line items. The debt service line will allow the board to begin repaying the City of Amarillo for installed utility extensions, with a formal agreement to be presented at a later meeting. No public comments were made, and the meeting adjourned after 6 minutes.

Thu Aug 18, 2022 · 12:00

One Time Event

The East Gateway TIRZ #2 Board will consider the FY2022-23 annual budget.

The East Gateway TIRZ #2 Board of Directors is meeting to discuss the FY2022-23 annual budget. The board will also review and approve minutes from the July 21, 2022, meeting.

budgetfinancetax-increment-reinvestment-zone
✓ Decided: TIRZ #2 Board approves FY2022-23 annual budget with new $100K community projects and $150K debt service line items

The East Gateway Tax Increment Reinvestment Zone No. 2 Board approved the FY2022-23 annual budget as presented, which includes a new $100,000 Community Projects line item and a $150,000 Debt Service line item to begin repaying the City of Amarillo for installed utility extensions. The board also unanimously approved the minutes from the July 21, 2022 meeting. No other substantive actions were taken.

Wed Aug 17, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains no readable information

The text for the August 17, 2022, Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numeric data. No specific items, decisions, or discussions can be identified from the source provided.

firemen-retirement-fundamarillo
✓ Decided: Firefighters' pension board approves $230M fund report, investment payments

The board unanimously approved the June 30 investment resolution and July revenue/expenditure summary showing a total market value of $230,013,150.04. They also approved payments to investment managers Kayne Anderson Rudnick ($28,653.27), Rudd & Wisdom ($29,666.25 + $800), and Indus Mokshum ($11,109), along with a Frost Bank fee of $286.02. Several benefit-related actions were approved, including a change of beneficiary, a qualified domestic relations order, termination of a retirement benefit with surviving spouse disbursement, a refund of contributions, and a disability retirement benefit application.

Wed Aug 17, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Review of 2022-2023 budget and parking garage rate recommendations

The Board will consider the 2022-2023 fiscal year budget and recommendations for parking garage rate structures. Updates on Hodgetown, Embassy Suites, and the Parking Garage/Retail Space projects are also scheduled. Additionally, the Board will discuss a rental request from the Panhandle Adult Rebuilding Center.

budgetparkingdevelopmentfinance
✓ Decided: LGC Board approves parking rate hike, FY2022-23 budget

The Amarillo Local Government Corporation Board approved a parking garage rate increase to $11/day and $4/hour, adopted the FY2022-23 budget, and waived parking fees for a nonprofit event. All votes were unanimous except one abstention.

Tue Aug 16, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $16.3 million for water reclamation facility upgrades

The council will review gun violence trends and progress on the Partners for Development project. Members will also consider several contract awards for airport maintenance, vehicle purchases, and IT infrastructure.

waterairportpoliceinfrastructuretechnologybudget
✓ Decided: Council approved $16.3M water reclamation plant upgrades

The council approved a $16.3 million contract for upgrades to the River Road and Hollywood Road water reclamation facilities, and authorized $3.5 million for IT network hardware replacement. They also approved a lease for a 0.13-acre tract at 1018 S. Polk Street with Friends of AJ Swope, and issued $1.8 million in tax notes for capital projects. A resolution on state and federal legislative priorities was postponed for two weeks.

Mon Aug 15, 2022 · 10:00

Planning and Zoning Commission

The Commission will review several subdivision plats and a rezoning request.

The Planning and Zoning Commission will consider four new subdivision plats and one rezoning request. The commission will also discuss a proposed zoning plan for the annexation of 44.26 acres near Soncy Road.

zoningplatsrezoningannexationland-use
✓ Decided: Commission approves rezoning, plat, and street vacation items

The Amarillo Planning and Zoning Commission approved all agenda items unanimously, including a residential replat, three rezoning requests, and a street/alley vacation for the new City Hall project. No public comments were made on any item.

Fri Aug 12, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The Advisory Board will consider landscape maintenance specifications for Bid #7319.

The Colonies PID Advisory Board is meeting to discuss ongoing improvement maintenance and future agenda items. The board will also consider approving landscape maintenance specifications for Bid #7319 and a management contract for maintenance and operations administrative responsibilities.

maintenancelandscapingcontractspid
✓ Decided: PID board delays landscape contract specs vote due to incomplete documents

The Colonies PID Advisory Board met on August 12, 2022, and approved the minutes from the July 20 meeting. The board discussed but did not vote on the Landscape Maintenance Specifications for Bid #7319 because the specs were incomplete; staff said they could not vote on an incomplete packet. The board also discussed a management contract with FIMC but had not received paperwork yet, and agreed to pursue the longest possible contract term. No substantive decisions were made beyond approving the minutes.

Thu Aug 11, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to consider FY2022-23 annual budget and 2022 investment policy

The Center City Tax Increment Reinvestment Zone #1 Board will discuss the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes updates on downtown projects and next steps for a wayfinding project.

budgetfinancedowntowninfrastructure
✓ Decided: TIRZ Board approves FY2022-23 budget and investment policy

The Center City TIRZ #1 Board approved the FY2022-23 annual budget and the 2022 Investment Policy, both unanimously. The board also discussed terminating the wayfinding project contract due to delays and cost increases, and directed staff to bring back options for different scales and electronic wayfinding. No formal action was taken on the wayfinding project or other discussed items.

Thu Aug 11, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to consider FY2022-23 annual budget and 2022 investment policy

The Center City Tax Increment Reinvestment Zone #1 Board of Directors will discuss the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes updates on downtown Amarillo projects and next steps for a wayfinding project.

budgetinvestmentdowntownwayfindingamarillo
✓ Decided: TIRZ board approves FY2022-23 budget, investment policy

The Center City TIRZ #1 Board unanimously approved the FY2022-23 annual budget and the 2022 Investment Policy. The board discussed terminating the wayfinding project contract due to delays and cost overruns, and agreed to review alternative options. No public comments were made.

Wed Aug 10, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Review of the 2022/23 Budget and 5-Year Service Plan

The Heritage Hills Advisory Board will consider recommendations for the 2022/23 Budget and 5-Year Service Plan. The meeting also includes discussions regarding phase 3 landscape improvements and ongoing PID operations and maintenance.

budgetlandscapinginfrastructurepublic improvement district
✓ Decided: Heritage Hills PID board approves revised 2022/23 budget and 5-year plan

The Heritage Hills Public Improvement District Advisory Board unanimously approved the revised 2022/23 budget and 5-Year Service Plan. The board discussed Phase 3 landscape improvements, estimating costs around $1.25 million, but concluded they could not start within the next fiscal year under the current budget. They also addressed landscape maintenance issues, noting that payments to W Real Estate and The Landscape Company have been stopped due to missing contracts.

Wed Aug 10, 2022 · 13:30

One Time Event

Parks & Recreation Board to review minutes and receive various program updates

The Parks & Recreation Board will consider approving the minutes from the July 13, 2022, meeting. The board will also receive progress reports on several city services, including aquatics, the zoo, and park maintenance.

parksrecreationzooaquaticscity-government
✓ Decided: Parks board approves July minutes, hears updates on pools, zoo, playgrounds

The Amarillo Parks and Recreation Board held a regular meeting on August 10, 2022, and unanimously approved the minutes from the July 13, 2022 meeting. The board received informational updates on aquatics, programs and events, zoo operations, playground renovations, park maintenance, beautification, Six Pack Outdoors, and senior services. No formal decisions were made beyond the minutes approval; all other items were discussion or reports.

Tue Aug 9, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will consider Mural Grant Program rule amendments and deadline extensions.

The Beautification and Public Arts Advisory Board will discuss updates on various projects, including the Library Mural and Thompson Park. The meeting includes consideration of Mural Grant Program rule amendments and reimbursement deadline extensions. The board will also hold an election for a Vice-Chair.

muralgrantspublic-artsbeautification
Tue Aug 9, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Tutbury PID Advisory Board to consider 2022/23 budget and service plan

The board will review the minutes from the June 3, 2022, meeting. Members will also discuss ongoing operations and maintenance for the district and consider recommendations for the 2022/23 budget and a five-year service plan.

budgetmaintenanceoperationsplanning
✓ Decided: Tutbury PID board approves 2-year landscape contract with 3-year renewal option

The Tutbury Public Improvement District Advisory Board approved a two-year landscape maintenance contract with an option to renew for three years, using a maintenance schedule provided by board member Cheryl. The board also approved the minutes from the August 9, 2022 meeting as corrected, and tabled a discussion on tree maintenance reimbursement to the Tutbury Home Owners Association. No other substantive decisions were made.

Mon Aug 8, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to discuss bike master plan and walkability improvements

The committee will review the minutes from the June 13, 2022, meeting. Members will also receive an update on the Bike Master Plan and a presentation regarding the process for acquiring right of way for future bike trails. Additionally, the group will discuss ways to improve walkability in Amarillo.

pedestrianbicyclewalkabilitytransportationamarillo
✓ Decided: Committee discusses bike master plan, walkability, tables video review

The committee approved the June 13, 2022 minutes (4-0). They discussed the Bike Master Plan, right-of-way acquisition for trails, and improving walkability in Amarillo, focusing on schools and elderly facilities. The review of 'Not Just Bike Videos' was tabled. No binding decisions were made on substantive policy or funding.

Mon Aug 8, 2022 · 15:00

Library Advisory Board

Library Advisory Board to discuss departmental issues and library activities

The Library Advisory Board will review the minutes from its June 13, 2022 meeting. The Director of Library Services will present on departmental issues, including programming and library events. The board will also hear updates regarding the East Branch and Downtown Library.

libraryprogrammingpublic-servicesamarillo
✓ Decided: Library board approves June minutes; hears Friends' mural, book sale plans

The Amarillo Library Advisory Board approved the June 13, 2022 meeting minutes unanimously. The board heard reports on upcoming events, including the Friends of the Library's first in-person book sale since 2019 and a planned mural at the Downtown Library, but took no other formal votes.

Thu Aug 4, 2022 · 19:00

Amarillo Area Public Health Board

The meeting agenda contains only unreadable numerical sequences.

The provided agenda for the Amarillo Area Public Health Board dated August 4, 2022, consists of numerical strings that do not form readable English text. No specific items, discussions, or decisions can be identified from the source document.

procedural
Tue Aug 2, 2022 · 13:00

Amarillo City Council

Council considers $50 million aerospace development incentive

The Amarillo City Council is reviewing the proposed tax rate for the 2022/2023 fiscal year. The agenda includes incentive agreements for Albers Aerospace and Austin Hose involving significant capital improvements. The council will also consider several rezoning ordinances and various city contracts.

economic-developmentzoningtax-ratebudgetcontracts
✓ Decided: Council approves $8M incentive for Albers Aerospace, tax abatements

The Amarillo City Council approved a proposed tax rate of $0.49086 for the FY2022/2023 budget (3-1), and approved multiple economic development incentives, including a $8 million Location Incentive Agreement and a 100% tax abatement for 10 years for Albers Aerospace, as well as a $300,000 incentive and 60% tax abatement for Austin Hose. The council also approved the consent agenda, which included ordinances creating two reinvestment zones, two rezoning requests, and a grant for tuberculosis control.

Mon Aug 1, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to elect leaders and review seven plat applications

The commission will hold elections for a Chairman and Vice Chairman. The meeting includes the consideration of seven plat applications for various additions and subdivisions. Additionally, the commission will review one rezoning request near Wichita Ave. and Mirror St.

zoningplatelectionland-useamarillo
✓ Decided: Commission approves 7 plats, denies rezoning for auto sales lot

The Amarillo Planning and Zoning Commission unanimously approved seven plats, including residential and commercial subdivisions, and denied a rezoning request for a new/used auto sales lot. The commission also elected Royce Gooch as Chairman and Renee Whitaker as Vice Chairman. All decisions were made without public comment.

Thu Jul 28, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to discuss FY2022-23 budget and Wayfinding Project next steps

The Board will review the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes discussions on the Wayfinding Project and updates regarding projects at Santa Fe Depot.

budgetinvestmentwayfindingsanta-fe-depotamarillo
Thu Jul 28, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to discuss FY2022-23 annual budget and investment policy

The Board will review the FY2022-23 annual budget and consider the 2022 Investment Policy. The meeting also includes discussions on next steps for the Wayfinding Project and updates on projects at the Santa Fe Depot.

budgetinvestmentwayfindinginfrastructure
Wed Jul 27, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Review of 2022.23 CVB operating budget and final audit report

The Amarillo Convention and Visitors Bureau Board will review the 2022.23 operating budget and a final audit report. The board is also scheduled to approve minutes from the June 22, 2022 meeting.

budgetaudittourismfinance
✓ Decided: CVB Board approves $2.65M operating budget for 2022-23

The Amarillo Convention and Visitors Bureau Board unanimously approved the 2022-23 operating budget totaling $2,647,467, which includes funding for a film commissioner, more trade shows, increased Arts Marketing grants, and Route 66 festival projects. The board also accepted the final audit report as presented. No public comments were made, and no other substantive decisions were taken.

Tue Jul 26, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers purchasing up to 15,768 acres of groundwater rights

The Amarillo City Council will review several ordinances regarding rezoning and annexation. The agenda also includes consideration of an $11,100,000 settlement agreement and the potential purchase of groundwater rights in Roberts County.

groundwaterzoningbudgetcontractspublic-worksannexation
✓ Decided: Council approves $29.6M groundwater rights purchase

The Amarillo City Council approved a contract to purchase up to 15,768 acres of groundwater rights in Roberts County for up to $29,565,000, plus closing costs, and authorized the City Manager to execute documents. The council also approved a $3 million agreement with Amarillo College for the Innovation Outpost job training facility, a $150,000 high-demand job training agreement, and an $11.1 million settlement in the Mission Clay Pipe lawsuit. All votes were unanimous (4-0 or 5-0).

Mon Jul 25, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided agenda text is unreadable

The meeting agenda for the Amarillo Economic Development Corporation Board of Directors on July 25, 2022, consists of unreadable numeric sequences. No specific items, discussions, or decisions can be identified from the provided source.

unreadable
✓ Decided: Amarillo EDC approves $4M Albers Aerospace incentive deal

The Amarillo EDC Board approved a $4 million upfront incentive for Albers Aerospace to move its manufacturing and research facilities to Amarillo, with an additional $4 million after 12 months if performance criteria are met. The board also awarded contracts for utilities and paving at South Georgia Business Park, approved a $3 million job training program with Amarillo College, and adopted updated policies and procedures. All votes were 4-0.

Thu Jul 21, 2022 · 12:00

One Time Event

Discussion of the FY2022-23 East Gateway TIRZ #2 annual budget

The East Gateway TIRZ #2 Board will discuss the FY2022-23 annual budget and the 2022 investment policy. The board is also scheduled to approve minutes from the May 19, 2022 meeting.

budgetfinanceinvestmenttirez
✓ Decided: TIRZ #2 board discusses FY2022-23 budget, defers action

The East Gateway TIRZ #2 Board reviewed the FY2022-23 annual budget, including projected revenues of $386,171 and an estimated ending balance of $891,178, and discussed using excess funds to pay off utility debts. No formal action was taken on the budget; the board directed staff to bring back exact figures and a payment agreement for consideration at the next meeting. The board also unanimously approved the 2022 Investment Policy and the minutes from May 19, 2022.

Thu Jul 21, 2022 · 12:00

One Time Event

Discussion of the FY2022-23 annual budget for East Gateway TIRZ

The East Gateway TIRZ Board will discuss the FY2022-23 annual budget. The board is also scheduled to consider the 2022 Investment Policy and approve minutes from the May 19, 2022 meeting.

budgetfinanceinvestment-policytax-increment-reinvestment-zone
✓ Decided: East Gateway TIRZ Board discusses FY2022-23 budget, defers action

The East Gateway Tax Increment Reinvestment Zone No. 2 Board reviewed the FY2022-23 annual budget and discussed potential debt payment for utility projects, but took no formal action, deferring consideration to the next meeting. The board approved the May 19, 2022 minutes and the 2022 Investment Policy, both unanimously.

Wed Jul 20, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no readable information.

The source document for the July 20, 2022, Amarillo Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numerical sequences. No specific decisions, proposals, or items can be identified from the provided text.

unreadableprocedural
✓ Decided: Firemen's Relief Board approves investment resolution and annual financial report

The Amarillo Firemen's Relief and Retirement Fund Board of Trustees met and unanimously approved the Fund's Investment Resolution as of June 30, 2022, and the Annual Financial Report for the year ended December 31, 2021. The board also approved several payments for professional services and trust fees, as well as retirement benefits and other administrative actions. All decisions were made unanimously.

Wed Jul 20, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Review of 2022-2023 fiscal year budget and parking garage agreements

The Board will discuss the 2022-2023 fiscal year budget and consider the 2022 Investment Policy. The meeting also includes updates on Hodgetown, Embassy Suites, and parking garage retail space.

budgetdevelopmentparkinginvestmentamarillo
✓ Decided: LGC Board approves Potter County parking garage expansion to 50 spaces

The Amarillo Local Government Corporation Board approved changes to Potter County's parking garage agreement, increasing spaces from 30 to 50 with 24/7 access and extending the term by two years. The Board also approved the 2022 Investment Policy and the May 25, 2022 minutes with a corrected attendance record. No public comments were made, and the Board discussed the 2022-2023 budget, including potential parking rate increases and loan renegotiations, but took no action.

Wed Jul 20, 2022 · 14:00

Colonies Public Improvement District Advisory Board

Board to consider 2022/23 Budget and 5-Year Service Plan recommendations

The Colonies PID Advisory Board will discuss ongoing maintenance items and landscape maintenance specifications for Bid #7319. The board will also consider recommendations for the 2022/23 Budget and a 5-Year Service Plan.

budgetmaintenancelandscapingpidamarillo
✓ Decided: PID board approves 2022/23 budget with $0.13/sq ft assessment increase

The Colonies PID Advisory Board unanimously approved the 2022/23 budget and 5-year service plan, which includes a rate increase from $0.10 to $0.13 per square foot, a $700,000 payment to Rockrose, and a $3 million bond issuance. The board also discussed landscape maintenance bid specs but did not vote, deciding to wait for revisions. Minutes from the June 7 meeting were approved.

Mon Jul 18, 2022 · 10:00

Planning and Zoning Commission

Commission to discuss proposed 44-acre annexation near SW 34th Ave.

The Planning and Zoning Commission will consider a plat for Chaparral Hills Unit No. 12 near Western St. and Big Horn Trl. The commission will also discuss the proposed annexation of a 44.26 acre tract at SW 34th Ave. and Sony Rd.

zoningannexationplatland-use
✓ Decided: Commission approves Chaparral Hills replat creating 3 residential lots

The Amarillo Planning and Zoning Commission approved a replat (P-22-60) for Chaparral Hills Unit No. 12, creating three residential lots from a previously platted tract in the extraterritorial jurisdiction. The approval was contingent on receipt of corrected originals before plat expiration. The commission also held a public hearing on a proposed annexation of a 44.26-acre tract near SW 34th Ave. and Soncy Rd., but took no action.

Fri Jul 15, 2022 · 13:00

Amarillo City Council

The July 15, 2022, Amarillo City Council agenda contains unreadable text

The provided agenda text consists of numeric sequences and does not contain legible information regarding meeting items or decisions. The record appears to be corrupted or contains only unreadable data.

unreadableprocedural
✓ Decided: Amarillo City Council holds budget workshop, no action taken

The Amarillo City Council met for a special meeting on July 15, 2022, to conduct a budget workshop. No formal decisions were made; the workshop was informational only. The meeting was recessed for lunch and reconvened before adjourning.

Thu Jul 14, 2022 · 13:00

Amarillo City Council

No readable agenda information available

The provided text for the July 14, 2022, Amarillo City Council meeting consists of unintelligible numeric sequences and contains no readable details regarding decisions or discussions.

unreadable
✓ Decided: Amarillo City Council holds budget workshop, no action taken

The Amarillo City Council met for a special meeting on July 14, 2022, primarily to conduct a budget workshop. No formal decisions or votes were made during the meeting, which was adjourned after the workshop concluded. The meeting was procedural in nature, with no substantive actions taken.

Thu Jul 14, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board to consider setback variance for 2213 S Hughes Street

The Amarillo Zoning Board of Adjustment will meet to approve minutes from the May 12, 2022 meeting. The board will also consider a request to reduce rear and side yard setbacks at 2213 S Hughes Street.

zoningvarianceland-use
✓ Decided: Zoning board approves Hughes Street garage variance with firewall

The Amarillo Zoning Board of Adjustment unanimously approved a variance (V-22-05) for a property at 2213 South Hughes Street, allowing reduced rear and side yard setbacks for a new attached garage. The approval requires a two-hour firewall. The board also approved the minutes from the May 12, 2022 meeting.

Wed Jul 13, 2022 · 13:00

Amarillo City Council

No readable agenda items are present in the provided text

The document for the July 13, 2022, Amarillo City Council meeting contains only numerical sequences and does not provide any readable information regarding proposed or decided actions.

procedural
✓ Decided: Amarillo City Council holds budget workshop, no action taken

The Amarillo City Council met for a special meeting on July 13, 2022, primarily to conduct a budget workshop. No formal decisions or votes were made during the meeting; the only action was to establish a quorum and adjourn.

Wed Jul 13, 2022 · 13:30

One Time Event

Amarillo Parks & Recreation Board to review various city projects and updates

The Parks & Recreation Board will discuss several ongoing municipal projects and department reports. This includes reviewing the minutes from the June 8, 2022 meeting. The board will also receive updates on items such as the Martin Road Complex and the Botanical Gardens.

parksrecreationbudgetinfrastructurepublic-arts
✓ Decided: Parks board approves June minutes, hears updates on pools, playgrounds, budget

The Amarillo Parks and Recreation Board held a regular meeting on July 13, 2022, and approved the minutes from the June 8, 2022 meeting unanimously. The board received updates on aquatics (all four city pools open), Martin Road Complex progress, playground renovations (including ribbon cuttings and groundbreaking ceremonies), budget status, park maintenance, beautification projects, athletic lighting bid evaluation, and a potential agreement with Amarillo College. No formal decisions were made beyond the minutes approval.

Tue Jul 12, 2022 · 10:00

Airport Advisory Board

No readable agenda items found for the July 12, 2022 meeting

The provided text for the Amarillo Airport Advisory Board contains unreadable numeric sequences. No specific decisions, discussions, or proposals can be identified from the source document.

amarilloairport-advisory-board
Tue Jul 12, 2022 · 11:30

Beautification and Public Arts Advisory Board

Board to discuss mural grant reimbursements and project updates

The Beautification and Public Arts Advisory Board will review minutes from the June 14, 2022 meeting. Members will receive reports on the Apache Tree Grant, budget status, and temporary art reimbursements. The board will also consider action on mural grant reimbursement invoices.

artsbudgetgrantsbeautification
✓ Decided: Board approves June minutes; discusses art funding and budget

The Beautification and Public Arts Advisory Board unanimously approved the June 14, 2022 meeting minutes as written. The board discussed potential reimbursement for temporary art startup costs, ongoing art pad projects, a budget update proposing the division's establishment as its own department, and the Apache Tree Grant application. No formal decisions were made on these discussion items.

Tue Jul 12, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $5,343,549 in transit grants and several rezoning requests

The council will consider applications for $5,343,549.00 in federal and state grants for Amarillo City Transit. The agenda also includes public hearings for land annexation and multiple zoning changes. Additionally, the council will review several contract awards for city equipment and furniture.

transitzoningannexationcontractspublic-hearing
✓ Decided: Council approves $2M AT&T fiber broadband contract for Amarillo Connected project

The Amarillo City Council approved a $2,000,000 contract with AT&T for fiber broadband internet service for the Amarillo Connected Broadband Project (5-0). The council also approved the consent agenda, which included several contracts and purchases, and passed ordinances for an alley vacation and a rezoning. Public hearings were held for transit grant applications, a 244.97-acre annexation, and multiple zoning changes, but no final votes were recorded on those items in the minutes.

Mon Jul 11, 2022 · 10:00

Pinnacle Public Improvement District Advisory Board

Pinnacle PID Advisory Board to consider 2022/23 Budget and 5-Year Service Plan

The Pinnacle Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsmaintenanceplanning
✓ Decided: PID board approves 2021/22 budget and 5-year service plan

The Pinnacle Public Improvement District Advisory Board unanimously approved the 2021/22 budget and 5-Year Service Plan, with a change to rename the Botany and Agriculture line item to Horticulture. The board also approved the minutes from the June 22, 2022 meeting. No other substantive decisions were made; discussion items included PID operations and maintenance and future agenda items.

Wed Jul 6, 2022 · 10:00

Planning and Zoning Commission

Commission to consider rezoning 8.29 acres from Agricultural to Residential District 3

The Planning and Zoning Commission will review two rezoning applications and a subdivision replat. The meeting also includes a work session for updates on cases previously sent to City Council.

zoningrezoningland-usehousingamarillo
✓ Decided: Commission approves two rezoning requests and tables one plat

The Amarillo Planning and Zoning Commission approved two rezoning requests and tabled a plat for resubmission. The plat P-22-53 was tabled due to missing surety and corrected originals. Both rezoning requests were approved unanimously.

Tue Jun 28, 2022 · 13:00

Amarillo City Council

The provided agenda text for Amarillo City Council is unreadable

The source document consists of numerical sequences and does not contain readable text, names, or descriptions of meeting items.

unreadable
Tue Jun 28, 2022 · 13:00

Amarillo City Council

City Council considers $2 million AT&T broadband contract

The Amarillo City Council will consider a $2 million contract for fiber broadband internet service through the Amarillo Connected Broadband Project. The agenda also includes public hearings regarding rezoning requests and a utility franchise agreement. Additionally, several infrastructure repairs and vehicle purchases are scheduled for approval.

broadbandzoningutilitiesinfrastructurepublic-works
✓ Decided: Council approves $2M AT&T fiber broadband contract for Amarillo Connected project

The Amarillo City Council approved a $2,000,000 contract with AT&T for fiber broadband internet service for the Amarillo Connected Broadband Project, passing unanimously 5-0. The council also approved the consent agenda (excluding item 2Q) and several non-consent items, including ordinances for alley vacation, rezoning, a gas utility franchise, and a resolution setting a public hearing for annexation. All votes were 5-0.

Mon Jun 27, 2022 · 13:00

Amarillo City Council

No readable agenda items found for June 27, 2022 meeting

The provided text for the Amarillo City Council meeting contains no readable English content or identifiable agenda items. The source consists of unreadable numerical data.

unavailableunreadableno-content
✓ Decided: Amarillo City Council holds governance workshop, no action taken

The Amarillo City Council met in a special session on June 27, 2022, for a governance workshop. No formal decisions or votes were made; the meeting was procedural and adjourned without action.

Fri Jun 24, 2022 · 10:00

Vineyards Public Improvement District Advisory Board

Review of Vineyards PID 2022/23 Budget and 5-Year Service Plan

The Vineyards Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider recommendations for the 2022/23 Budget and a 5-Year Service Plan.

budgetpidoperationsplanning
✓ Decided: Vineyards PID board approves 2022/23 budget and 5-year plan

The Vineyards Public Improvement District Advisory Board approved the 2022/23 budget and 5-Year Service Plan unanimously. The board also approved the June 3, 2021 meeting minutes. Discussions included lighting safety concerns, landscaping contractor issues, and a potential planter box project, but no formal action was taken on these items.

Wed Jun 22, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Discussion of the Civic Center Project

The Amarillo Convention and Visitors Bureau Board will review financial and audit reports. The meeting also includes a discussion regarding the Civic Center Project.

tourismcivic-centerfinancemarketingamarillo
✓ Decided: CVB board reviews audit, discusses $260M Civic Center funding options

The Amarillo Convention and Visitors Bureau Board met on June 22, 2022, and approved the May 25, 2022 meeting minutes unanimously. The board reviewed a tentative audit report for the year ended September 30, 2021, with no discrepancies or misstatements; formal approval is scheduled for next month. Staff discussed four funding options for the $260 million Civic Center Complex renovation, including naming rights, an additional 2% HOT tax, a third-party operator, and increased sales tax and HOT. No formal decisions were made on these items.

Wed Jun 22, 2022 · 10:00

Pinnacle Public Improvement District Advisory Board

The board will consider recommending the 2022/23 Budget and 5-Year Service Plan

The Pinnacle PID Advisory Board is meeting to discuss ongoing operations and maintenance. The board will also consider making a recommendation regarding the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsplanning
✓ Decided: PID board tables 2021/22 budget and 5-year service plan

The Pinnacle Public Improvement District Advisory Board tabled the 2021/22 budget and 5-year service plan for further discussion, after noting that cost projections were off track and needed adjustments. The board also approved the minutes from the May 21, 2021 meeting unanimously. No other formal decisions were made; the meeting focused on operational updates and future agenda items.

Wed Jun 22, 2022 · 10:00

Point West Public Improvement District Advisory Board

Review of 2022/23 Budget and 5-Year Service Plan for Pinnacle PID

The Pinnacle Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetoperationsplanningpid
✓ Decided: Point West PID Board approves 2022/23 budget and 5-year service plan

The Point West Public Improvement District Advisory Board approved the 2022/23 budget and 5-Year Service Plan as presented, with a 2% inflation increase included. The board also unanimously approved the minutes from the June 02, 2021 meeting. Discussion covered ongoing maintenance items, including a shut-off valve, grass replacement, and tree replacement, with no future agenda items.

Tue Jun 21, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to discuss fairgrounds project revisions and event development payments

The Board will review the status of fiscal year 2021-2022 projects at the Tri-State Fairgrounds and consider revisions to the project list. Discussion includes event development payments for the Amarillo Limousine Show and the Amarillo Tri-State Fair. The agenda also covers quarterly financials and an update on the Civic Center project.

fairgroundseventsfinancebudgetcivic-center
✓ Decided: Board approves fairgrounds project revisions and extra payments

The board unanimously approved revisions to fairgrounds projects, using $143,657 in savings for new items like fiber optics and LED retrofits. It also approved an additional $10,000 for the Amarillo Limousin Show and tabled a $30,000 request for the Tri-State Fair pending more details.

Tue Jun 21, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a five-year service plan.

The Quail Creek PID Advisory Board will discuss the 2022/23 budget and a five-year service plan for recommendation. The meeting also includes discussions regarding ongoing district operations and maintenance.

budgetoperationsmaintenanceplanning
✓ Decided: Quail Creek PID board approves adjusted budget, keeps assessments at $350

The Quail Creek Public Improvement District Advisory Board approved the adjusted 2022/23 budget and 5-year service plan, keeping the assessment cost at $350 per lot. The board also unanimously approved the minutes from the May 25, 2021 meeting. Discussions covered ongoing maintenance, water usage, and future budget concerns, but no other formal decisions were made.

Mon Jun 20, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning Commission to review subdivision, rezoning, and annexation requests

The Planning and Zoning Commission will consider several land use applications, including a new subdivision and two rezoning cases. The commission will also discuss a preliminary plan for the 224.59-acre Homestead project and a proposed zoning plan for a large annexation.

zoningsubdivisionrezoningannexationland-use
✓ Decided: Commission approves rezoning for townhomes near Western St. and Arden Rd.

The Amarillo Planning and Zoning Commission approved a rezoning request for a 13.50-acre tract near Western St. and Arden Rd., changing it from Residential District 1 and 2 to Moderate Density District to allow for single-family attached (townhomes) and detached homes. The commission also approved a rezoning for a property on SW 8th Ave. and Monroe St. to Planned Development District for increased lot coverage and reduced parking, and approved a variance for no alleys in the Homestead Preliminary Plan, a 224.59-acre development with 569 residential lots. A plat for the Road Ranger Subdivision was withdrawn at the applicant's request.

Mon Jun 20, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Unreadable agenda text for Amarillo Economic Development Corporation

The provided text for the June 20, 2022, meeting contains only unreadable numeric characters. No legible information regarding specific agenda items, decisions, or discussions is present in the source.

unreadableagendaamarillo
✓ Decided: AEDC approves Austin Hose project with land conveyance and job incentives

The Amarillo EDC Board unanimously approved a project for Austin Hose to construct a new facility, with land conveyance and job creation incentives. They also approved a TWC grant match and an EDA grant for infrastructure. No public comments were made, and the meeting included an executive session with no action taken.

Fri Jun 17, 2022 · 13:00

Amarillo City Council

The provided meeting agenda contains no readable information or identifiable items

The source text consists of numeric sequences and placeholders rather than legible English. No specific decisions, proposals, or discussions can be identified from this record.

amarilloproceduralunreadable
✓ Decided: Council authorizes $3M events pavilion at Santa Fe Depot

The Amarillo City Council held a special meeting and voted 3-0 to authorize the City Manager to execute all documents for construction of a new steel events pavilion at the Santa Fe Depot. The pavilion will be approximately 60,000 square feet, with costs not to exceed $3,000,000, funded by hotel occupancy taxes. No public comments were made, and the meeting adjourned after this single item.

Wed Jun 15, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The June 15, 2022, meeting agenda contains no readable text.

The provided agenda text consists of numerical sequences that do not contain legible English information. No specific items, decisions, or discussions can be identified from the source document.

unreadable
✓ Decided: Firemen's pension board approves $231M fund report and 2021 actuarial valuation

The Amarillo Firemen's Relief and Retirement Fund Board of Trustees unanimously approved the May 31, 2022 investment resolution, the 2021 actuarial valuation, and payments to investment managers. The board also approved retirement benefits for David W. Dunn and physicals and Form 100s for new fire recruits. All votes were unanimous.

Tue Jun 14, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will review mural grant reimbursements and various project updates.

The Beautification and Public Arts Advisory Board will consider approving minutes from the May 10, 2022 meeting. Members will also receive updates on several projects, including Xcel Junction Box and Mural Plaques. Additionally, the board will discuss action regarding mural grant reimbursement invoices.

artbeautificationgrantsmuralscity-projects
✓ Decided: Board approves May minutes; hears Xcel art box approval

The board unanimously approved the May 10, 2022 meeting minutes as written. Members received updates on the Xcel junction box art installation (approved by Xcel), the first art pad installed in Sam Houston Park, mural plaques with QR codes, and a trademarked phrase gifted to the city. No mural grant reimbursements were submitted, so that item remains on the agenda.

Tue Jun 14, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $1.58 million pavilion for Santa Fe Depot

The Amarillo City Council will consider several rezoning requests and contract awards, including infrastructure upgrades for the airport and Santa Fe Depot. The meeting includes updates on homeless services and the Amarillo Broadband Project. Additionally, the council will review economic development agreements for senior housing.

zoninghousinginfrastructurebudgethomelessnessaviation
✓ Decided: Council approves ARPA funds, consent agenda, and multiple rezonings

The Amarillo City Council approved the consent agenda (excluding items 2J and 2K), which included several rezonings, contracts, and resolutions. Item 2J (water/electrical utilities at Santa Fe Depot) was approved, while item 2K (steel events pavilion) received no action. The council also passed five non-consent items: four rezonings (Ordinances 7986-7989) and two resolutions (authorizing water bond refunding and approving ARPA funds). All votes were 5-0.

Mon Jun 13, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to discuss process for acquiring right of way for future bike trails

The committee will review minutes from the April 11, 2022 meeting. Members will also discuss improving walkability in Amarillo and receive an update on Six Pack Outdoors. A presentation regarding the process for acquiring right of way for future bike trails is scheduled.

bicyclepedestriansafetytrailswalkability
✓ Decided: Amarillo bike/pedestrian committee tables video review, plans walkability audits

The Pedestrian and Bicycle Safety Advisory Committee met and approved the April 11, 2022 minutes (6-0). They tabled the 'Not Just Bike Videos' discussion to the next meeting. Members discussed updates on the Six Pack Outdoors pump track and right-of-way acquisition for bike trails, and agreed to develop a community-based walkability plan with audits. The next meeting was scheduled for August 8, 2022.

Mon Jun 13, 2022 · 15:00

Library Advisory Board

Library Advisory Board to review library services and departmental updates

The Library Advisory Board will review departmental activities, including updates on the Mobile Hotspot Lending Program and Seed Library. The board will also consider approving minutes from the April 11, 2022 meeting. A presentation regarding North Branch activities is scheduled.

librarypublic-servicesprogramming
✓ Decided: Library board approves April minutes, hears updates on programs

The Amarillo Library Advisory Board approved the minutes from its April 11, 2022 meeting unanimously. The board heard reports on the Friends of the Library partnership with Panhandle PBS, the Summer Reading Club, the Mobile Hotspot Lending Program, and the upcoming Americans and the Holocaust exhibition. No other formal decisions were made.

Fri Jun 10, 2022 · 10:00

Point West Public Improvement District Advisory Board

Point West PID Advisory Board to discuss 2022/23 Budget and 5-Year Service Plan

The board will consider recommending the 2022/23 Budget and a 5-Year Service Plan. The meeting also includes discussions regarding ongoing maintenance items for the district.

budgetmaintenanceplanningpublic-improvement-district
Thu Jun 9, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Board to consider 2022/23 Budget and 5-Year Service Plan

The board will discuss the 2022/23 Budget and 5-Year Service Plan for recommendation. Other discussions include Scott Park drainage issue reimbursement and contractor criteria for Greenways projects.

budgetinfrastructuremaintenancepublic-worksdrainage
✓ Decided: Greenways PID board approves 2022/23 budget and 5-year plan

The board unanimously approved the 2022/23 budget and 5-Year Service Plan, including $35,000 annual reimbursement payments with a final year around $6,000. They also agreed Eddie Scott was not responsible for the Scott Park drainage issue and should be reimbursed, and moved $20,000 into maintenance to cover potential drainage costs. Minutes from the April 21 meeting were approved with a correction.

Wed Jun 8, 2022 · 13:30

One Time Event

Parks & Recreation Board to consider approval of athletic complex study

The Parks and Recreation Board will meet to discuss several park projects and updates. The board will consider action on the athletic complex study and review minutes from the May 11, 2022 meeting. Updates are scheduled for the Martin Road Complex, Rick Klein Field Renovation, and 9th Street Trails.

parksrecreationinfrastructurebudgetpublic-forum
✓ Decided: Parks board adopts Sports Complex study for capital requests

The Parks and Recreation Board unanimously approved the adoption of the Athletic Complex Study into the department's capital requests, following a presentation by Parkhill and support from the West Texas Youth Baseball Association. The board also approved the May 11, 2022 meeting minutes as written. No other formal votes were taken; remaining items were informational updates.

Tue Jun 7, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a 5-year service plan

The Colonies PID Advisory Board will meet to discuss ongoing maintenance items and approve minutes from May 27, 2022. The board will also consider recommending the 2022/23 Budget and 5-Year Service Plan.

budgetmaintenanceplanningpublic-improvement-district
✓ Decided: PID board discusses 2022/23 budget, defers approval

The Colonies PID Advisory Board discussed the 2022/23 budget and 5-year service plan but did not vote on it, deferring action to a later date. They also discussed ongoing maintenance issues, including plans to terminate a contract with Amarillo Integrated and split the landscape contract into separate line items. The board approved the minutes from the previous meeting unanimously.

Mon Jun 6, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

The board will consider a change order for phase 2 landscape improvements.

The Heritage Hills Public Improvement District Advisory Board will meet to approve May 23, 2022 minutes and discuss a change order for Bid 7106 regarding phase 2 landscape improvements. The meeting also includes discussion of future agenda items.

landscapeinfrastructurepublic-improvement-district
✓ Decided: PID board approves change orders for phase 2 landscape work

The Heritage Hills PID Advisory Board approved two change orders for Bid 7106 (phase 2 landscape improvements), including removal of a $2,400 supervision fee and acceptance of an optional bid for future work. The board also approved the May 23, 2022 minutes and discussed future agenda items, including budget and a possible bond issuance for phase three.

Mon Jun 6, 2022 · 10:00

Planning and Zoning Commission

Commission to consider residential to office rezoning and new subdivision plats

The Amarillo Planning and Zoning Commission will meet on June 6, 2022. The agenda includes reviews of subdivision plats, a rezoning request for Coulter Acres, and a public right-of-way vacation.

zoningplatsrezoningland-useamarillo
✓ Decided: Commission approves three plats, one rezoning, and one alley vacation

The Amarillo Planning and Zoning Commission approved all five agenda items unanimously. These included two residential replats (River Falls Unit No. 63 and La Paloma Estates Unit No. 14), a rezoning from R-1 to O-2 for an office park, and a vacation of a public alley for a proposed carwash. The meeting was brief and procedural, with no items denied or tabled.

Mon Jun 6, 2022 · 13:00

Town Square Public Improvement District Advisory Board

Consideration of 2022/23 Budget and 5-Year Service Plan for Town Square PID

The Advisory Board will discuss ongoing operations and maintenance for the Town Square Public Improvement District. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetmaintenanceplanningpublic-improvement-district
✓ Decided: PID board approves 2022/23 budget and 5-year service plan

The Town Square PID Advisory Board unanimously approved the minutes from June 15, 2021, and the 2022/23 budget and 5-Year Service Plan as presented. They discussed an upcoming operations and maintenance contract, including plans to bid on median and lighting work, and considered options for funding, including a possible bond issuance. No final decision was made on the bond or contract.

Fri Jun 3, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a five-year service plan.

The Tutbury PID Advisory Board will discuss ongoing operations and maintenance for the district. The meeting includes consideration of recommendations for the 2022/23 budget and a five-year service plan.

budgetoperationsmaintenanceplanning
✓ Decided: Tutbury PID board postpones budget approval to study costs

The Tutbury Public Improvement District Advisory Board voted unanimously to postpone approval of the 2022/23 budget and 5-year service plan until the next meeting. The board wants more time to gather cost estimates for brick repointing and landscape maintenance before finalizing the budget. No other substantive decisions were made.

Fri May 27, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will discuss the landscape maintenance contract and potential termination

The Colonies Public Improvement District Advisory Board will discuss a landscape maintenance contract and consider its termination. The meeting also includes a review of ongoing PID improvement maintenance items.

landscapemaintenancepidpublic-improvement
✓ Decided: PID board votes to terminate landscape contract with Amarillo Integrated

The Colonies PID Advisory Board unanimously voted to recommend terminating the landscape maintenance contract with Amarillo Integrated, following the HOA's recommendation. The City will initiate the rescission process upon receiving HOA documentation, requiring signed releases and a City Council vote. The board also discussed the bidding process for a new contract, with an expedited timeline of about three weeks for advertising, though the full process may take 90-120 days.

Wed May 25, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The board will review April hotel performance and summer staff activities.

The Amarillo Convention and Visitors Bureau Board will meet to approve minutes from April 27, 2022, and review financial reports. The agenda includes presentations regarding National Travel and Tourism Week and upcoming summer staff activities.

tourismhospitalityfinancial-reportcommunications
✓ Decided: CVB board hears city approved 75,000 sq ft convention center

The Amarillo Convention and Visitors Bureau Board met and heard that the city council approved construction of a 75,000-square-foot convention center east of Entrance 4, with ADA improvements and a patron elevator, and a pavilion at the Santa Fe Depot. The board approved the April 27, 2022 minutes unanimously. No other formal decisions were made; the meeting included reports on finances, hotel performance, and upcoming events.

Wed May 25, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board to consider parking garage rates and agreements

The Board will review project updates for Hodgetown, Embassy Suites, and the Parking Garage and Retail Space. Members will consider ratifying the 2022 Sod Poodles Parking Garage Agreement and discuss future parking garage rate structures. Discussion is also scheduled regarding Potter County’s agreement for spaces in the parking garage.

parkingdevelopmentinfrastructurebudget
✓ Decided: LGC Board accepts audit, ratifies Sod Poodles parking garage agreement

The Amarillo Local Government Corporation Board accepted the September 30, 2021 audit with a clean opinion and ratified the annual Sod Poodles Parking Garage Agreement for the 2022 season. The board also discussed future parking garage rate increases and a potential amendment to Potter County's agreement for garage spaces. No final decisions were made on parking rates or the Potter County amendment.

Tue May 24, 2022 · 07:30

Amarillo Hospital District Board of Managers

Board to hold public hearing on mandatory health provider assessments

The Board will conduct a public hearing and consider a resolution regarding the LPPF Mandatory Payment Assessment rate for the fiscal year ending August 31, 2022. Members will also review annual financial audits and quarterly investment performance reports.

hospitalfinanceaudittaxinvestment
✓ Decided: Hospital district sets 2.27% LPPF assessment for 2022

The Amarillo Hospital District Board of Managers approved a 2.27% LPPF mandatory payment assessment for state fiscal year 2022, expected to generate over $20 million for local hospitals. The board also accepted the AHD audit and NWTH Pension Plan audit, both with clean opinions, and approved a Potter County Sheriff Sale property. All votes were unanimous.

Tue May 24, 2022 · 13:00

Amarillo City Council

Council considers economic incentives and various city contracts

The Amarillo City Council is reviewing incentive agreements for industrial projects, including Producer Owned Beef, LLC. The agenda also includes rezoning requests and several contracts for police vehicles and utility maintenance.

zoningeconomic-developmentpoliceutilitiespublic-works
✓ Decided: Council approves $20M incentive for CVMR and $8M for Producer Owned Beef

The Amarillo City Council approved major economic development incentives, including a $20 million Location Incentive Agreement with CVMR (Texas) Inc. and an $8 million agreement with Producer Owned Beef, LLC, both with 100% tax abatements for 10 years. The council also approved a consent agenda with numerous contracts and purchases, and adopted several zoning changes. All votes were 5-0 except for the issuance of tax notes, which passed 4-1.

Mon May 23, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Heritage Hills PID Advisory Board to consider 2022/23 Budget and Service Plan

The board will consider recommendations for the 2022/23 Budget and a 5-year Service Plan. Members will also discuss a change order for Bid 7106 phase 2 landscape improvements. Additionally, the meeting includes discussions on ongoing district operations and maintenance.

budgetlandscapingmaintenanceoperations
✓ Decided: Heritage Hills PID board tables change order and budget

The Heritage Hills Public Improvement District Advisory Board tabled a $7,950 change order for phase 2 landscape improvements, pending further review of water pressure concerns and boring costs. The board also tabled the 2022/23 budget and 5-year service plan after adjusting the Parks Improvement line item to $336,017 to avoid a negative year. No substantive decisions were finalized; both items were postponed to the next meeting.

Thu May 19, 2022 · 12:00

One Time Event

Discussion of East Gateway TIRZ #2 project plans and financing

The East Gateway TIRZ #2 Board will discuss the final project and financing plan, City Economic Development Guidelines, and TIF policy and procedures. The board is also scheduled to receive the audit for the period ending September 30, 2021.

financeauditeconomic-developmentamarillo
Thu May 19, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to discuss project financing plan and policies

The East Gateway TIRZ Board will meet to approve minutes from March 31, 2022 and receive the September 30, 2021 audit. The board is also scheduled to discuss the final project and financing plan along with TIF policy and procedures.

financeauditeconomic-developmentzoning
Wed May 18, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

No readable agenda items were found for the May 18, 2022 meeting

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees contains only numeric sequences. No identifiable decisions or discussions are present in the record.

proceduralunreadable
✓ Decided: Firemen's Relief Board approves investment resolution, payments, retirement benefits

The Amarillo Firemen's Relief and Retirement Fund Board of Trustees approved the investment resolution, several vendor payments, retirement benefits for Wesley D. Hall, and actuarial assumptions. They also postponed a refund request and an education discussion item. The board directed a disability retirement applicant to be evaluated by the Board's Physician.

Mon May 16, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning for an asphalt or concrete batching plant

The Planning and Zoning Commission will review four rezoning applications. These include requests for an asphalt or concrete batching plant, a manufactured home district, and changes to commercial and development districts.

zoningland-usehousingcommercialindustrial
✓ Decided: Commission approves four rezoning requests, including concrete plant

The Amarillo Planning and Zoning Commission unanimously approved all four rezoning requests on the agenda. These included a light industrial rezoning with a specific use permit for a concrete batching plant, a heavy commercial rezoning for a telecommunications tower, a manufactured home district rezoning, and a planned development district rezoning to reduce parking requirements for an apartment complex. The commission also approved the minutes of the May 2, 2022 meeting with corrections.

Mon May 16, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Meeting agenda text is unreadable

The provided text for the Amarillo Economic Development Corporation Board of Directors meeting contains only numeric strings and symbols. It is not possible to identify any specific items, decisions, or discussions from this record.

unreadable
✓ Decided: AEDC approves $11M incentive for 650,000sf beef facility

The Amarillo EDC Board unanimously approved two major incentive packages. The first, for Producer Owned Beef, includes an $11 million total incentive (including $8 million job creation) for a $650 million, 650,000sf facility on 400 acres, with an additional 600 acres to be conveyed. The second, for CVMR, includes a $20 million job incentive and conveyance of 400+ acres for a $1.5 billion rare earth processing plant. Both projects were approved as presented with no opposition.

Thu May 12, 2022 · 16:00

Zoning Board of Adjustment

The board will consider a setback variance for a monument sign.

The board will review the minutes from the April 14, 2022 meeting. They will also consider a request to reduce front and side yard setbacks for a monument sign at 4301 Ridgecrest Circle.

zoningvariancesignageland-use
✓ Decided: Zoning board denies monument sign variance at 4301 Ridgecrest Circle

The Amarillo Zoning Board of Adjustment denied a variance request (V-22-04) to reduce front and side yard setbacks for a monument sign at 4301 Ridgecrest Circle. The motion to deny was made by Claudia Stuart, seconded by Cory Mathis, and passed unanimously 4-0. The board also approved the minutes from the April 14, 2022 meeting. No other substantive decisions were made.

Wed May 11, 2022 · 13:30

One Time Event

Parks & Recreation Board to review minutes and project updates

The Parks & Recreation Board will consider approving the minutes from the April 13, 2022 meeting. The board will also receive reports regarding staff, budget, athletic lighting, playgrounds, and a Senior Services RFP.

parksbudgetsenior-servicesrecreation
✓ Decided: Parks board approves April minutes, hears updates on projects

The Amarillo Parks and Recreation Board held a regular meeting with no public comments and no substantive votes beyond approving the April 12, 2022 minutes. The board received updates on staff changes, the fiscal year 2022 budget, the athletic lighting project, playground renovations, and tabled the Senior Services RFP.

Wed May 11, 2022 · 17:00

Animal Management & Welfare Advisory Board

Board to discuss animal management activity, staffing, and adoption updates

The Amarillo Animal Management & Welfare Advisory Board will review reports on department activity, staffing, and community outreach. The board will also consider approving minutes from the February 23, 2022 meeting.

animal-welfarecity-governmentpublic-commentdepartment-updates
✓ Decided: Animal board hears reports, sets next meeting for Sept. 28

The Amarillo Animal Management & Welfare Advisory Board met on May 11, 2022, and received updates on shelter intakes, staffing, adoption, outreach, grants, and a Texas Tech veterinary partnership. No formal votes or decisions were taken; the board only set its next meeting for September 28, 2022.

Tue May 10, 2022 · 11:30

Beautification and Public Arts Advisory Board

Beautification board to review mural grant reimbursements and project updates

The Beautification and Public Arts Advisory Board is holding a regular meeting to discuss and potentially approve minutes from April, receive updates on crosswalk/underpass beautification and mural plaques, and consider action on mural grant reimbursements. The agenda is largely routine, with no major policy decisions or public hearings listed.

beautificationpublic-artsmuralsgrantsminutescrosswalks
✓ Decided: Board approves April minutes; hears updates on murals, crosswalks

The Beautification and Public Arts Advisory Board unanimously approved the April 12, 2022 meeting minutes as written (6-0). No substantive policy decisions were made; the board received updates on crosswalk/underpass beautification permits, mural plaque orders, and future agenda items. No mural grant reimbursement invoices were submitted, so that item was carried forward.

Tue May 10, 2022 · 13:00

Amarillo City Council

Amarillo Council considers new tax abatement zones for commercial and industrial use

The council will hold public hearings on creating two new tax abatement zones. They are also considering amendments to the sidewalk cost-share program and various city contracts for infrastructure and services.

zoningtax-abatementinfrastructureutilitiespublic-works
✓ Decided: Council approves consent agenda, tax abatement zones, sidewalk program

The Amarillo City Council approved the consent agenda, including contracts for federal lobbying, smart meters, and various infrastructure projects. It also adopted ordinances creating two reinvestment zones for tax abatement, added a sidewalk cost-share program, amended a tax increment financing plan, and accepted a Safe Kids grant. All votes were 5-0.

Thu May 5, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board discusses updates to Center City TIRZ #1 project and financing plan

The Board of Directors will consider updates to the Center City TIRZ #1 Final Project and Financing Plan. The meeting also includes receiving the September 30, 2021 audit and receiving updates on specific projects.

financeaudithousingplanningzoning
✓ Decided: TIRZ Board approves plan update adding Civic Center arena project

The Center City TIRZ #1 Board approved an update to the Final Project and Financing Plan to include language about the Amarillo Civic Center Complex expansion and renovation, including an arena, and improvements to the Santa Fe Depot. The update does not change the TIRZ boundary or financing terms, and the total estimated cost of TIRZ-financed initiatives remains $34 million net present value. The board also accepted the September 30, 2021 audit, which showed $4 million in total assets and an unmodified opinion.

Thu May 5, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The Board will discuss updates to the Center City TIRZ #1 project and financing plan

The Board of Directors will review the September 30, 2021 audit for TIRZ #1. The meeting includes discussions regarding updates to the final project and financing plan. Updates on the Wayfinding Project and a housing study are also scheduled.

auditfinancehousingzoning
✓ Decided: TIRZ board approves plan update adding Civic Center arena project

The Center City TIRZ #1 Board unanimously approved an update to the Final Project and Financing Plan to include language about the Amarillo Civic Center Complex expansion and renovation, including an arena, and improvements to the Santa Fe Depot. The update does not change the TIRZ boundary or financing terms, and the costs are not anticipated to be financed with TIRZ revenues. The board also accepted the September 30, 2021 audit, which showed an unmodified opinion and $4 million in total assets.

Mon May 2, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to consider several rezoning requests

The commission will review multiple rezoning applications and a new plat for Hillside Terrace Estates. These items include changes to residential, agricultural, and office districts across various locations. A work session will also provide updates on previous cases.

zoningrezoninghousingland-usedevelopment
✓ Decided: Commission approves 53-lot Hillside Terrace Estates final plat

The Amarillo Planning and Zoning Commission approved the final plat for Hillside Terrace Estates Unit No. 30, creating 53 residential lots, pending return of corrected originals and acceptance of public improvements. The commission also approved four rezoning requests, including changes for an assisted living facility, single-family homes, and a manufactured home permit, while denying one request for a Type A manufactured home. All decisions were unanimous.

Mon May 2, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Review of Tutbury PID 2022/23 budget and 5-year service plan

The Advisory Board will discuss ongoing operations and maintenance for the Tutbury Public Improvement District. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsmaintenance
✓ Decided: PID board approves 2021/22 budget, discusses brick wall repair

The Tutbury PID Advisory Board unanimously approved the minutes from the May 18, 2021 meeting. They discussed ongoing operations, including the need to rebid the landscaping contract and the deteriorating brick wall at the front entrance, with repair costs estimated at $15 per linear foot. The board considered the 2021/22 budget and 5-year service plan, including a potential assessment increase from $679 to $700, but no formal vote was recorded on the budget. The meeting was adjourned with no other business.

Wed Apr 27, 2022 · 08:30

Amarillo Convention and Visitors Bureau

ACVB Board to discuss staff attendance and the Great Outdoors Fund

The Amarillo Convention and Visitors Bureau Board will review financial reports and minutes from March 23, 2021. The meeting includes discussions regarding the Cross Bar, The Great Outdoors Fund, and staff attendance for the Texas Association of CVBs.

tourismbudgetcommitteetexas
✓ Decided: CVB board approves staff attendance at TACVB conference

The Amarillo Convention and Visitors Bureau Board approved closing the office so all staff can attend the Texas Association of CVBs conference. The board also approved the March 23, 2022 minutes and heard reports on tourism's economic impact, including $947.3 million in direct visitor spending in 2021.

Tue Apr 26, 2022 · 13:00

Amarillo City Council

City Council considers $1.1 million contract for Polk St. Streetscape Improvements

The Amarillo City Council will consider several zoning changes, land annexations, and various service contracts. This includes a public hearing on the annexation of 77.29 acres in Randall County. The council will also discuss federal funding programs like the Infrastructure Investment and Jobs Act.

zoningannexationinfrastructurebudgetpublic hearingutilitiescybersecurity
✓ Decided: Council annexes 77-acre tract, rezones land, approves consent agenda

The Amarillo City Council approved the consent agenda, including a $1.13M Polk St. streetscape design contract and a $294K cybersecurity purchase. It also annexed a 77.29-acre tract near Helium and Arden Roads and rezoned a 1.40-acre tract near McKenna Square to General Retail, all by 4-0 votes. Councilmember Powell was absent.

Mon Apr 25, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The PID Advisory Board will discuss the 2022/23 budget and tree care maintenance.

The Colonies Public Improvement District Advisory Board will meet to discuss the 2022/23 Budget and 5-Year Service Plan. The board will also consider a recommendation for a landscape maintenance agreement regarding tree care. Additionally, members will discuss ongoing maintenance items and a budget amendment.

budgetmaintenancelandscapingpublic-improvement-district
✓ Decided: PID board approves tree care contract scope, moves to rebid

The Colonies PID Advisory Board approved the landscape maintenance agreement for tree care, with the scope drawn up by Cleve Turner, and moved to separate contracts for mowing, tree care, and flower beds due to a misunderstanding with Amarillo Integrated. The board also agreed to proceed with Renu Painting's bid for bridge house repainting at about $8,000 with wood preservative. No budget amendment was needed, and the board discussed the 2022/23 budget, noting a potential increase in city admin fees.

Thu Apr 21, 2022 · 08:30

Civil Service Commission

Civil Service Commission to consider firefighter exam appeals and personnel updates

The commission will review appeals filed by firefighters regarding specific questions on the Fire Driver exam. The meeting also includes consideration of a new commission member appointment and the police recruit eligibility register. Additionally, the body will review various personnel actions including promotions, transfers, and disciplinary actions.

policefirepersonnelappointmentscivil-service
✓ Decided: Fire Driver exam appeals partially upheld; eligibility register approved

The Civil Service Commission approved routine personnel items and an eligibility register for Police Recruit. It denied most Fire Driver exam appeals but eliminated question #86, then approved a revised Fire Driver eligibility register. The appointment of a new commission member was tabled.

Thu Apr 21, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of 2022/23 Budget and 5-Year Service Plan

The board will discuss the 2022/23 budget, a five-year service plan, and potential budget amendments. Members will also consider the dedication of Parcel R-370-0390-0001.0 to the City or PID.

budgetinfrastructureland-use
✓ Decided: Greenways PID board raises Class D lot assessment multiplier to 1.5

The board unanimously approved raising the Class D lot assessment multiplier from 1.2 to 1.5 of the base rate. They discussed the 2022/23 budget and 5-year service plan, including a $35,000 annual developer reimbursement over 5 years, but took no formal vote on the budget. The board also discussed but did not decide on installing four lamp posts at King's Gate Bridge ($20,000 total) and a potential reduction in the $170,000 developer reimbursement due to drainage issues.

Thu Apr 21, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Board considers design variances for First Baptist Church Project

The Board will consider design variances regarding walkways, building edges, and signage for the First Baptist Church Project near Harrison St. and SW 12th Ave. This project includes a parking garage and church facility. The board will also approve minutes from the February 24, 2022 meeting.

zoningdowntowndevelopmentsignage
Thu Apr 21, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Design variances for the First Baptist Church Project

The Board will consider design variances for the First Baptist Church Project near Harrison St. and SW 12th Ave. These involve walkways, building edges, and signage. The meeting also includes approval of February 24, 2022, meeting minutes.

zoningdowntownlandmarksdevelopment
Wed Apr 20, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

No readable agenda items were found for the April 20, 2022 meeting

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numeric sequences. No substantive information regarding decisions or discussions is present in the record.

amarillofiremen-relief-and-retirement-fundboard-meeting
Mon Apr 18, 2022 · 10:00

Planning and Zoning Commission

The Commission will discuss a 244.97 acre annexation and four subdivision plats

The Planning and Zoning Commission will consider four subdivision plat applications in Randall and Potter Counties. The commission will also hold a discussion regarding the proposed annexation of a 244.97 acre tract.

zoningsubdivisionsannexationplanning
Mon Apr 18, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items are present in the provided text

The document for the April 18, 2022, Amarillo Economic Development Corporation meeting contains only unreadable numeric sequences. No specific decisions, projects, or discussions can be identified from this record.

amarilloeconomic-development
✓ Decided: Amarillo EDC board approves quarterly investment report

The Amarillo EDC Board of Directors approved the minutes from the March 22, 2022 meeting and the quarterly investment report as presented. No other formal decisions were made; the board heard staff updates on projects and events. The meeting included an executive session with no action taken.

Thu Apr 14, 2022 · 16:00

Zoning Board of Adjustment

The Zoning Board of Adjustment will consider two side yard setback variances.

The Zoning Board of Adjustment will meet to consider two requests for side yard setback reductions. The board will also review the minutes from the December 9, 2021 meeting.

zoningvarianceland-useamarillo
✓ Decided: Amarillo zoning board approves side-yard setback variance at 15 Carnoustie Lane

The Amarillo Zoning Board of Adjustment unanimously approved a variance to reduce the side yard setback for a new home at 15 Carnoustie Lane, despite two letters of opposition. A second variance request at 1024 S Georgia was pulled from the agenda. The board also approved the minutes from its December 9, 2021 meeting.

Wed Apr 13, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss park ordinances and various project updates

The Parks & Recreation Board will meet to receive reports on several ongoing projects and maintenance. The board will also consider approving minutes from the March 9, 2022, meeting. Discussion topics include ordinance updates and a financial sustainability plan.

parksrecreationordinanceproject-updatespublic-art
Tue Apr 12, 2022 · 10:00

Airport Advisory Board

Unreadable agenda text for Amarillo Airport Advisory Board

The provided source text consists of undecipherable numerical sequences and does not contain readable English content. No specific items, decisions, or discussions can be identified from the record.

unreadable
✓ Decided: Airport Advisory Board approves Jan. 11 minutes, hears project updates

The Amarillo Airport Advisory Board met virtually and approved the minutes from the January 11, 2022 meeting unanimously. The board received updates on various airport projects, including the near-complete Taxiway P4 & J rehabilitation and ongoing demolition of old buildings. No other formal decisions were made.

Tue Apr 12, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will review project updates and consider mural grant reimbursements.

The Beautification and Public Arts Advisory Board will discuss several project updates, including the Park Education Signage Campaign. The board will also consider action on mural grant reimbursements for submitted invoices.

beautificationpublic-artparksgrantssignage
✓ Decided: Board approves mural reimbursement for Pergola Shop

The Beautification and Public Arts Advisory Board approved a reimbursement invoice for the completed Pergola Shop mural. The board also discussed updates on art pad leases, a public art campaign, and future agenda items. No other substantive decisions were made.

Tue Apr 12, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $1.3 million airport recapitalization contract

The council will discuss updates on Earth Day, residential housing studies, and zoning revisions. Proposed actions include rezoning property in Miller Heights and approving various equipment purchases for police, public works, and IT. Several resolutions regarding state funding for local events are also on the agenda.

zoningairportpoliceinfrastructurebudgetpublic-works
✓ Decided: Council approves $1.27M housing stability program and multiple contracts

The Amarillo City Council approved a $1,274,112 ERA2 Housing Stability Services Program award, a demolition contract for the old Amarillo Hardware Building, and numerous consent agenda items including equipment purchases and contracts. Several zoning changes and resolutions were also adopted. The meeting included proclamations and an executive session on economic development incentives.

Mon Apr 11, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Election of 2022 Chair and Vice Chair for the committee

The Pedestrian and Bicycle Safety Advisory Committee will elect a chair and vice chair for the 2022 calendar year. The meeting also includes a review of Not Just Bikes videos and an update on Six Pack Outdoors.

pedestrianbicyclesafetyelectionleadership
✓ Decided: Amarillo bike/pedestrian committee re-elects chair, approves minutes

The Pedestrian and Bicycle Safety Advisory Committee held a routine meeting with no substantive policy decisions. Members unanimously approved the February 14, 2022 minutes and re-elected Steve Rogers as Chairman and Tim Ingalls as Vice Chairman. A discussion on 'Not Just Bike Videos' was tabled, and the next meeting was scheduled for June 13, 2022.

Mon Apr 11, 2022 · 15:00

Library Advisory Board

The Board will consider a mobile hotspot borrowing agreement.

The Library Advisory Board will review updates to the policy for unattended children and consider an agreement for mobile hotspot borrowing through the FCC's Emergency Connectivity Fund. The meeting also includes a report on departmental activities and programming.

librarypolicytechnologypublic-services
✓ Decided: Library board approves mobile hotspot borrowing agreement

The Amarillo Library Advisory Board unanimously approved the Mobile HotSpot Borrowing Agreement, allowing patrons to check out internet hotspots. The board also approved the February 14, 2022 meeting minutes and reviewed the Policy for Unattended Children, finding it in order. No other substantive decisions were made.

Thu Apr 7, 2022 · 12:00

Advisory Committee for People with Disabilities

Advisory Committee for People with Disabilities to elect leaders and review transit plans

The committee will hold elections for Chair and Vice Chair positions. Members will also discuss committee duties and brainstorm projects for disability awareness. Amarillo City Transit staff will present updates on transit projects and the city's transit safety plan.

disabilitiestransitelectionspublic-safetyamarillo
✓ Decided: ACPD elects Ali Ramos as Chair, Jimmy Clemmer as Vice Chair

The Advisory Commission for People with Disabilities held a regular meeting on April 7, 2022, and elected Ali Ramos as Chair and Jimmy Clemmer as Vice Chair. The board approved the previous meeting's minutes. No public comments were made, and no other substantive decisions were taken; the rest of the meeting consisted of informational presentations on the commission's powers, the city transit safety plan, and bus shelter projects.

Mon Apr 4, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider a Wolflin Terrace replat and a retail rezoning request

The Planning and Zoning Commission is scheduled to review a plat for Wolflin Terrace Unit No. 3 and a rezoning request for a 1.40 acre tract. The meeting also includes the approval of previous meeting minutes.

zoningplatrezoningretailamarillo
✓ Decided: Commission approves replat and rezoning for dental clinic

The Amarillo Planning and Zoning Commission approved a residential replat for Wolflin Terrace Unit No. 3, contingent on a demolition permit and corrected originals, and approved a rezoning of 1.40 acres from Agricultural to General Retail for a dental and orthodontics clinic. Both motions passed unanimously.

Thu Mar 31, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to consider developer agreement at 7580 East Interstate 40

The East Gateway TIRZ Board of Directors will meet to discuss a developer agreement with ATC Realty Investment, LLC for a project located at 7580 East Interstate 40. The board will also review minutes from the March 17, 2022 meeting.

tirzdevelopmentreal estate
Thu Mar 31, 2022 · 12:00

One Time Event

The board will consider a developer agreement for 7580 East Interstate 40.

The East Gateway TIRZ Board of Directors will hold a special meeting on March 31, 2022. The board will discuss a developer agreement with ATC Realty Investment, LLC for a project at 7580 East Interstate 40. The agenda also includes approval of minutes from the March 17, 2022, meeting.

developmentreal estatetax increment reinvestment zone
Tue Mar 29, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

The Board will consider budget amendments and event trust fund requests.

The Board will review annual and quarterly financial reports and consider budget amendments for Civic Center projects. They will also discuss requests from CMSA and USTPA to participate in the Event Trust Fund for October 2022 events.

budgetfinancecivic-centerfairgroundseventsamarillo-potter
Mon Mar 28, 2022 · 15:00

Planning and Zoning Commission

Proposed revisions to Amarillo zoning and subdivision ordinances will be considered.

The Planning and Zoning Commission is holding a special meeting to consider proposed revisions to the City of Amarillo Zoning and Subdivision Ordinances. The applicant for these revisions is the City of Amarillo.

zoningsubdivisionordinance
Fri Mar 25, 2022 · 08:30

Civil Service Commission

The Commission will approve the Police Captain eligibility register.

The Civil Service Commission will review minutes from the March 16, 2022, meeting. The body will also consider various personnel actions, including promotions and disciplinary actions. Additionally, the Commission will review the eligibility register for the Police Captain position.

policepersonnelcivil-serviceamarillo
Wed Mar 23, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Amarillo Convention and Visitors Bureau Board to consider arts marketing grants

The Amarillo Convention and Visitors Bureau Board will review arts organization marketing grants. The agenda also includes an update on the Route 66 Centennial and a discussion regarding the Founders Book. Staff will provide reports on sales and servicing.

tourismartsmarketingroute-66finance
✓ Decided: CVB Board approves $79,950 in arts marketing grants

The Amarillo Convention and Visitors Bureau Board approved spending $79,950 in marketing assistance funding for arts organizations, as recommended by the Arts Committee. The board also approved the minutes from the February 16, 2022 meeting. No other formal decisions were made; other items were informational or discussion-only.

Tue Mar 22, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Provided agenda text for March 22, 2022 meeting is unreadable

The provided source document consists of an unintelligible sequence of numbers and symbols. No specific items, decisions, or discussions can be identified from the text.

unreadableno-contentnon-textual
✓ Decided: Amarillo EDC approves $100K grants to four startups

The Amarillo EDC Board approved the annual audit as presented and accepted the EnterPrize Challenge grant recipients, awarding $100,000 each to Think Metal, Fat Mama Feed, Vvntus, and 11 Marketing (Vyntus requested $99,000). The board also approved the February meeting minutes. No action was taken during executive session.

Tue Mar 22, 2022 · 13:00

Amarillo City Council

City Council considers $7 million bond issuance for park and recreational lighting

The Amarillo City Council will consider several rezoning requests and infrastructure contracts, including utility relocations for a future City Hall. The agenda also includes public hearings on the city's Comprehensive Plan and a $7 million bond issuance for park lighting.

zoningbudgetinfrastructureparkspublic-works
✓ Decided: Council approves $2.2M park maintenance contracts, 5-0 votes on zoning

The Amarillo City Council approved a consent agenda and several ordinances, including the Five-Year Community Investment Program and multiple rezoning requests. It also awarded contracts for park landscape maintenance totaling $2,207,074.60 and authorized the issuance of $2.2M in certificates of obligation for park lighting. All votes were unanimous except for a 3-1 vote on the certificates of obligation, with Councilmember Stanley dissenting.

Mon Mar 21, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning to review city ordinance revisions and rezonings

The Planning and Zoning Commission will consider proposed revisions to the City of Amarillo Zoning and Subdivision Ordinances. The agenda includes reviews of two plats, P-22-15 and P-22-18. Additionally, the Commission will discuss rezoning requests for South Side Acres Unit No. 20 and Johnson and McCluskey Addition.

zoningland-useordinancesplatsamarillo
✓ Decided: Planning Commission tables major zoning ordinance rewrite to March 28

The Amarillo Planning and Zoning Commission tabled the proposed comprehensive revisions to the City's Zoning and Subdivision Ordinances until a special meeting on March 28, 2022, after extensive public comment and discussion. The commission also approved several plats and rezoning requests, including a replat for manufactured homes and a rezoning for an office warehouse development. No final decision was made on the zoning ordinance rewrite.

Thu Mar 17, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to appoint Vice Chair and discuss future items

The East Gateway TIRZ Board of Directors will meet to approve minutes from the February 17, 2022, meeting. The agenda includes the appointment of a Vice Chair. The Board may also convene in executive session to discuss an economic development incentive request within the TIRZ #2 boundary.

tax-increment-reinvestment-zoneeconomic-developmentappointmentsamarillo
✓ Decided: Amarillo TIRZ #2 board appoints David Walker as vice chair

The East Gateway Tax Increment Reinvestment Zone No. 2 Board met on March 17, 2022, and approved the minutes from the February 17, 2022 meeting unanimously. The board also unanimously appointed David Walker as Vice Chair. No other substantive decisions were made; the board discussed future agenda items and held an executive session.

Thu Mar 17, 2022 · 12:00

One Time Event

Potential discussion of economic development incentives for East Gateway TIRZ #2

The Board will meet to approve minutes from the February 17, 2022 meeting and appoint a Vice Chair. The Board may also convene in executive session to discuss an economic development incentive request within the TIRZ #2 boundary.

economic-developmenttax-increment-reinvestment-zoneappointments
Wed Mar 16, 2022 · 08:30

Civil Service Commission

Civil Service Commission to review Police Captain exam appeal by Lt. Shane Chadwick

The Civil Service Commission will meet to approve minutes from the January 5, 2022 meeting and review various personnel actions. The commission will also consider the firefighter eligibility register and an appeal regarding a police captain written examination.

policefirefighterpersonnelcivil-serviceexaminations
✓ Decided: Civil Service Commission denies police captain exam appeal

The commission denied Lt. Shane Chadwick's appeal regarding the Police Captain written exam, upholding the eligibility register. They also approved the January 5, 2022 minutes, personnel actions, and the Firefighter eligibility register.

Wed Mar 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

Meeting agenda content is unreadable from the provided text

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of numeric sequences that do not contain legible information regarding items to be discussed or decided.

amarillofiremen-relief-and-retirement-fund
Thu Mar 10, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of drainage fees and lot assessments for Greenways at Hillside PID

The Greenways at Hillside PID Advisory Board will discuss City of Amarillo drainage fees and possible related actions. The board will also consider Class C and D lot assessments, developer reimbursement, and a budget amendment.

drainagefeesbudgetassessmentsdevelopment
✓ Decided: Greenways PID board approves minutes, discusses drainage fee and Scott Park fix

The board approved the January 12th minutes with corrections. They discussed the city's drainage fee, developer reimbursement to Eddie Scott, and maintenance of PID improvements, but took no formal votes on these items. The next meeting is set for April 21st.

Wed Mar 9, 2022 · 13:30

One Time Event

Proposed special event fee changes and subcommittee appointments

The Parks & Recreation Board will consider proposed changes to special event fees. The board will also discuss appointing members to the Strategic Planning and Outreach subcommittees. Additionally, officials will provide updates on playgrounds.

parksrecreationfeessubcommitteeplanningoutreach
✓ Decided: Parks board approves updated special event fees

The Parks and Recreation Board approved updated Special Event Fees with suggested changes, including one additional change discussed at the meeting. The board also unanimously approved the minutes from the February 13, 2022 meeting. No public comments were made, and no other substantive decisions were taken.

Tue Mar 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will discuss Bloomberg Foundation opportunities and beautification projects.

The board will review minutes from the February 8, 2022 meeting. Members will also discuss potential beautification project ideas and opportunities through the Bloomberg Foundation.

public-artbeautificationamarillo
✓ Decided: Board approves February minutes, sets April meeting

The Beautification and Public Arts Advisory Board held a regular meeting with a quorum. They unanimously approved the February 12, 2022 meeting minutes with recommended changes. No public comments were made. The board discussed Bloomberg Foundation grant opportunities and received an update on beautification staffing. The next meeting was set for April 12, 2022.

Tue Mar 8, 2022 · 13:00

Amarillo City Council

City Council considers $1.9 million contract for sewer main rehabilitation

The City Council will review ordinance updates regarding food hygiene inspections and towing fees. The agenda includes several contract awards for police uniforms, park maintenance, and public health services. A public hearing is also scheduled for the Five-Year Community Investment Program.

zoninginfrastructurebudgetpublic healthpoliceutilities
✓ Decided: Council adopts 5-year Community Investment Program, approves consent agenda

The Amarillo City Council unanimously approved the consent agenda, which included ordinances updating food hygiene inspection scoring, rezoning two properties, updating non-consent towing fees, and awarding contracts for chemicals, uniforms, luminaires, temporary labor, video management, sewer rehabilitation, and interpretation services. The council also adopted the five-year Community Investment Program for FY 2021-2022 through 2025-2026 and approved two rezoning ordinances near Amarillo Blvd. and Mirror St. All votes were 5-0. The meeting recessed for executive session, which continued the following day.

Mon Mar 7, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning to consider adopting the Eastridge Neighborhood Plan

The Commission will consider several rezoning requests and new land plats. Members will also review the adoption of the Eastridge Neighborhood Plan as an amendment to the city's Comprehensive Plan. The meeting includes a work session to review agenda items and project updates.

zoningplanninghousingland-useamarillo
✓ Decided: Commission recommends Eastridge Neighborhood Plan for City Council adoption

The Amarillo Planning and Zoning Commission recommended approval of the Eastridge Neighborhood Plan as an amendment to the Comprehensive Plan, forwarding it to City Council for final adoption. The commission also denied two rezoning requests, approved one rezoning, and approved two plats while withdrawing one plat. All votes were unanimous except for one abstention.

Wed Mar 2, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Amarillo Local Government Corporation Board to elect officers and review projects

The Board will elect new officers for one-year terms and appoint members to a standing committee. Staff will provide updates on the Hodgetown, Embassy Suites, and Parking Garage and Retail Space projects. The meeting also includes a presentation of quarterly financials.

developmentgovernmentfinanceparkingretail
✓ Decided: LGC board votes to discuss ending retail management contract with Bob Garrett

The Amarillo Local Government Corporation Board voted 5-2 to have the Executive Committee discuss with Bob Garrett the remaining fees under the retail space management agreement, potentially seeking early termination. The board also reappointed officers, added Jennifer Gallardo to the Executive Committee, and discussed raising parking garage rates to address operating losses.

Tue Mar 1, 2022 · 07:30

Amarillo Hospital District Board of Managers

Board considers pension plan amendments and actuarial contract updates

The Board will consider amending an actuarial contract with Arthur J. Gallagher & Co. regarding pension risk transfer services. They will also discuss amendments to the retirement plan for Northwest Texas Healthcare System employees. Additionally, a member will be appointed to the TIRZ #1 Board.

pensionhealthcarecontractretirement
Thu Feb 24, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Discussion on the Polk Street Streetscape Project

The Board of Review will hold a presentation and discussion regarding the Polk Street Streetscape Project. The meeting also includes the nomination and election of a Chairman and Vice Chairman.

downtownstreetscapelandmarksplanning
✓ Decided: Board re-elects Knapp and Bliss, reviews Polk Street project

The Board of Review for Landmarks, Historic Districts, and Downtown Design held a special meeting on February 24, 2022. It approved the December 30, 2021 minutes and unanimously re-elected Wesley Knapp as Chairman and Gregg Bliss as Vice Chairman. The board also received a presentation and discussed the Polk Street Streetscape Project, including potential variances, but took no formal action on the project.

Thu Feb 24, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Presentation and discussion on the Polk Street Streetscape Project

The Board of Review will hold a presentation and discussion regarding the Polk Street Streetscape Project. The meeting also includes the election of a Chairman and Vice Chairman.

landmarksdowntown-designpolk-streetpublic-meeting
Wed Feb 23, 2022 · 17:00

Animal Management & Welfare Advisory Board

The Board will elect a Chair and Vice Chair for 2022.

The board will conduct elections for leadership positions and consider approving minutes from October 6, 2021. Members will also receive updates on department staffing, veterinary services, and adoption programs.

animal-managementelectionsveterinary-servicesadoptiondepartment-updates
✓ Decided: Amarillo animal board re-elects Sauer as chair, Sanchez as vice chair

The Amarillo Animal Management & Welfare Advisory Board approved the October 2021 minutes and unanimously re-elected Eddy Sauer as chair and Charlie Sanchez as vice chair. The board received reports on 2021 shelter statistics, staffing updates, veterinary services, and community outreach programs. No public comments were made, and no other substantive decisions were taken.

Tue Feb 22, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Meeting agenda text is unreadable

The provided document for the Amarillo Economic Development Corporation meeting on February 22, 2022, consists of non-textual numeric characters and contains no readable information regarding decisions or discussions.

unreadable
✓ Decided: AEDC approves innovation hub plan and Caviness Beef Packers incentive

The Amarillo EDC Board approved a strategic plan for an innovation hub, including a feasibility study and three phases, and approved a job creation incentive for Caviness Beef Packers of up to $1,000,000 over five years. Both motions passed 4-0. No public comments were made, and no action was taken during executive session.

Tue Feb 22, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers several rezonings and various municipal contracts

The Amarillo City Council will review updates from advisory boards and discuss the Five-Year Community Investment Program. The agenda includes second and final readings for multiple land rezoning ordinances. The council will also consider several contract awards for public health grants, police equipment, and park maintenance.

zoningpoliceparksbudgetpublic-healthinfrastructure
✓ Decided: Council approves $1M Caviness Beef incentive and multiple rezonings

The Amarillo City Council approved a $1,000,000 Location Incentive Agreement with Caviness Beef Packers for up to 100 new full-time jobs, and a Chapter 380 Agreement for the Commons at St. Anthony's project with property tax rebates and ARPA funds. The council also passed several zoning changes, including rezonings near Soncy Rd. and Heritage Hills Pkwy, and adopted a new food hygiene inspection scoring system. All votes were 5-0.

Mon Feb 21, 2022 · 10:00

Planning and Zoning Commission

The commission will consider several subdivision plats and rezoning requests.

The Amarillo Planning and Zoning Commission is reviewing six plat applications for various subdivisions. The meeting also includes consideration of three rezoning requests to change properties to the General Retail District.

zoningplatssubdivisionretailamarillo
✓ Decided: Commission approves multiple plats and rezoning, withdraws two items

The Amarillo Planning and Zoning Commission approved several plats, including Bayless Addition Unit No. 2, Hamilton Acres Unit No. 2, South Side Acres Unit No. 27, Bishop Estates Unit No. 11, and Looby Acres Unit No. 1, with variances and conditions as noted. The commission also approved two rezoning requests (Z-22-05 and Z-22-06) for a car wash development. Two items were withdrawn: Hollywood Addition Unit No. 20 and rezoning Z-21-21.

Thu Feb 17, 2022 · 12:00

One Time Event

The East Gateway TIRZ Board will review quarterly financials and discuss future goals

The Tax Increment Reinvestment Zone #2 Board of Directors is meeting to approve minutes from August 26, 2021, and appoint a Vice Chair. The agenda also includes a presentation of quarterly financials and a discussion regarding current and future goals for the East Gateway TIRZ.

financegovernanceeast-gateway-tirzamarillo
✓ Decided: East Gateway TIRZ Board postpones vice chair appointment, reviews finances

The East Gateway Tax Increment Reinvestment Zone No. 2 Board met and approved the minutes from August 26, 2021. The board postponed the appointment of a Vice Chair due to no volunteers and low attendance. Staff presented the quarterly financials, showing a net position of $332,311.00 with no liabilities. The board discussed future goals, including sports facilities, an aquatics center, and new developments, but took no formal action on these items.

Thu Feb 17, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to review financials and discuss future goals

The East Gateway TIRZ Board of Directors will meet to review quarterly financial reports and discuss current and future goals for the zone. The board also intends to appoint a Vice Chair and approve minutes from the August 2021 meeting.

financegovernanceeast-gateway-tirzamarillo
✓ Decided: East Gateway TIRZ board postpones vice chair appointment, reviews finances

The East Gateway Tax Increment Reinvestment Zone No. 2 Board met and approved the minutes from August 26, 2021. The board postponed the appointment of a Vice Chair due to no volunteers and low attendance. Staff presented quarterly financials showing a net position of $332,311.00 with no liabilities. The board discussed future goals, including sports facilities, an aquatics center, and new development projects.

Wed Feb 16, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Review and possible action on the 2022 Strategic Plan

The Amarillo Convention and Visitors Bureau Board will meet to discuss several organizational updates. The agenda includes a review of the 2022 Strategic Plan and an update regarding The Great Outdoors Fund. The board will also review the EOY Smith Travel Research Report.

tourismstrategic-plantravel-researchfinance
✓ Decided: Amarillo CVB Board adopts 2022 Strategic Plan unanimously

The Amarillo Convention and Visitors Bureau Board unanimously approved the 2022 Strategic Plan as presented. The board also heard updates on the Ambassador Program, a Mural Run, hotel owner meetings, and a travel research report showing 2021 performance exceeded 2019. No other formal votes were taken.

Wed Feb 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda contains no readable text for review.

The meeting agenda for the Amarillo Firemen's Relief and Retirement Fund Board of Trustees consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the provided text.

amarillofiremen-retirement-fund
✓ Decided: Board approves investment resolution, reappoints civilian member, and elects firefighter trustee

The Board approved the Fund's Investment Resolution as presented, reappointed Rodney Ruthart as a civilian board member, and confirmed Shane Rankin's election as the firefighter board member after a runoff vote. It also approved several payments, including $140,938 to Luther King Capital Management and $33,730.04 to Kayne Anderson Rudnick, and tabled the trading report and a disability retirement application for later meetings.

Mon Feb 14, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to review accident maps and public education ideas

The committee will consider approving minutes from the November 15, 2021, meeting. Agenda items include a safety presentation featuring accidents on a map and a discussion regarding educational ideas for the public. The committee will also welcome a new member and report on current vacancies.

safetyeducationcommittee-updatespedestrian-safetybicycle-safety
✓ Decided: Committee approves September 2021 minutes, welcomes new member

The Amarillo City Pedestrian and Bicycle Safety Advisory Committee met on February 14, 2022, and approved the September 20, 2021, minutes by a 5:0 vote. The committee welcomed new member Chris Podzemny and discussed two vacancies, though staff clarified only one is open. Staff reported on pedestrian accident data and potential intersection upgrades using TXDOT HSIP funds, with the first three intersections identified as Amarillo Blvd & Hughes, 3rd & Adams, and 26th & Georgia. The next meeting was scheduled for April 11, 2022.

Mon Feb 14, 2022 · 15:00

Library Advisory Board

Amarillo Library Advisory Board discusses potential Seed Library partnership

The board will consider electing a Chair and Vice-Chair. Members will also discuss a potential partnership with the Randall County Master Gardener Board to create a Seed Library at the Downtown Library.

librarygardeninggovernmentelectionspublic-meetings
✓ Decided: Library Board elects new chair, advances seed library partnership

The Amarillo Library Advisory Board unanimously elected Shawn Read as Chair and Howard Rodriguez-Mori as Vice-Chair. The board also voted to continue pursuing a seed library partnership with the Randall County Master Gardeners, a pilot project at the Downtown Library funded with an initial $500 investment. The board approved the October 11, 2021 meeting minutes as written. No other substantive decisions were made; the remaining agenda items were informational presentations and discussions.

Sun Feb 13, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Election of committee chair and vice chair for the 2023 calendar year

The committee will consider electing a chair and vice chair for 2023 and approving minutes from December 12, 2022. Members will also receive updates on bike trail right-of-way availability, the TXDOT loop, and walkability in Amarillo.

bikingwalkingtransportationamarillocommittee
Thu Feb 10, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Discussion of Polk Street Streetscape Project and regional organizations

The Board will review quarterly financials and approve minutes from the December 13, 2021 meeting. The agenda includes discussions regarding the Polk Street Streetscape Project and Neighborhood Empowerment Zones. Additionally, the Board will discuss Ports-to-Plains and TEX-21 Organizations.

infrastructurefinanceamarillostreetscape
Thu Feb 10, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Discussion of Polk Street Streetscape Project and quarterly financials

The Board will review quarterly financial reports and approve minutes from the December 13, 2021 meeting. The agenda also includes discussions regarding the Polk Street Streetscape Project and Neighborhood Empowerment Zones.

financestreetscapedevelopmentneighborhood-empowerment
✓ Decided: TIRZ board hears streetscape, NEZ, highway updates; no votes taken

The Center City TIRZ #1 Board met and took no formal votes beyond approving the previous meeting's minutes. Members heard presentations on the Polk Street streetscape project, a proposed downtown Neighborhood Empowerment Zone, and regional highway advocacy groups. No decisions were made on these items.

Wed Feb 9, 2022 · 13:30

One Time Event

Amarillo Parks and Recreation Board to consider special event fee changes

The board will review minutes from the January 12, 2022 meeting and discuss several ongoing park projects. The agenda also includes consideration of proposed changes to special event fees.

parksrecreationfeespublic-policy
✓ Decided: Parks board tables special event fee structure for changes

The Parks and Recreation Board tabled adoption of a new special event fee structure after suggesting changes, and approved minutes from the January 12, 2022 meeting. The board also received updates on park maintenance contracting, the Martin Road project, and other ongoing matters, but took no other formal votes.

Tue Feb 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

Board to consider FY22 mural grant awards and discuss park art pads

The board will review the January 11, 2022, meeting minutes and consider recommendations for FY22 Mural Grant Project Awards. Members will also discuss Bloomberg Foundation opportunities and Art Pads installed in several city parks.

muralgrantspublic-artparksbeautification
✓ Decided: Board awards $29,500 in FY22 mural grants to 7 projects

The Beautification and Public Arts Advisory Board unanimously approved $29,500 in FY22 Mural Grant Project awards to seven applicants, with one grant reduced from the requested amount. The board also approved the January 11, 2022 meeting minutes as written, tabled a discussion on Bloomberg Foundation opportunities, and received an update on Art Pads in the Parks. No public comments were made.

Tue Feb 8, 2022 · 13:00

Amarillo City Council

Council considers economic development agreement for new Buc-ee's travel center

The Amarillo City Council will discuss the 311 Project and progress on the City Hall project. The agenda includes economic development agreements for a new Buc-ee's travel center and Horizon Ag Products. Several contract awards for airport equipment, waste collection, and public health marketing are also up for consideration.

zoningeconomic-developmentbudgetinfrastructurepublic-healthaviation
✓ Decided: Council approves $2.446M COVID-19 marketing contract in 4-1 vote

The Amarillo City Council approved a $2,446,000 contract for communications and marketing services to support the COVID-19 vaccination program, with Councilmember Stanley voting no. The council also approved a Chapter 380 Economic Development Agreement with Buc-ee's Amarillo, LLC for a new travel center, and several other economic development and zoning items. All other items passed unanimously.

Mon Feb 7, 2022 · 10:00

Planning and Zoning Commission

Commission to consider 313.75-acre Mesquite Ridge West preliminary plan

The Amarillo Planning and Zoning Commission will review several subdivision plats and rezoning requests. The agenda includes the 313.75-acre Mesquite Ridge West preliminary plan and various changes to residential and retail districts.

zoningsubdivisionrezoningdevelopmenthousing
✓ Decided: Amarillo P&Z denies manufactured home rezoning, approves plats and variances

The Amarillo Planning and Zoning Commission approved several plats and rezoning requests, denied two rezoning requests, and tabled one. The commission denied a rezoning for a manufactured home in San Jacinto Heights and a truck parking lot in Pleasant Valley, while approving a restaurant rezoning and a manufactured home in another area. It also approved variances for two preliminary plans and tabled a rezoning request for Edgehill Addition.

Thu Feb 3, 2022 · 12:00

Advisory Committee for People with Disabilities

The Feb 3, 2022, Advisory Committee for People with Disabilities meeting was cancelled

The scheduled meeting of the Advisory Committee for People with Disabilities was cancelled due to a lack of quorum. The planned agenda included the election of leadership and presentations regarding Amarillo City Transit.

disabilitytransitamarillogovernment
✓ Decided: Meeting cancelled; no minutes taken

The Advisory Committee for People with Disabilities meeting scheduled for February 3, 2022, was cancelled. No minutes were recorded, and no decisions were made.

Wed Feb 2, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider a landscape maintenance agreement addendum for tree care.

The Colonies PID Advisory Board will discuss ongoing improvement maintenance items. The meeting also includes consideration of a recommendation for a landscape maintenance agreement addendum regarding tree care.

landscapingmaintenancetree-carepublic-improvement-district
✓ Decided: PID board tables $56K tree care addendum, seeks legal review

The Colonies PID Advisory Board tabled a decision on a $56,000 landscape maintenance addendum for tree care, after concerns about contract terms and pricing. The board will revisit the item at a future meeting, with legal and purchasing staff to review the contract. Other maintenance items were discussed but no formal action was taken.

Tue Feb 1, 2022 · 07:30

Amarillo Hospital District Board of Managers

Amarillo Hospital District to discuss pension risk transfer and indigent care agreement

The Board of Managers will elect officers and review quarterly investment performance. The meeting includes discussions regarding the Indigent Care Agreement and options for pension risk transfer services.

pensionfinancehealthcareindigent-careboard-election
✓ Decided: Board reappoints officers, approves pension study motion

The Amarillo Hospital District Board of Managers unanimously reappointed Dr. Biggs as Chairman, Mary Bearden as Vice Chairman, and Dean Frigo as Investment Officer, and appointed Michelle Bonner to the East Gateway TIRZ No. 2. The board approved the October 26, 2021 minutes and directed actuaries to estimate effects of a lump sum payout window for eligible actives and vested terminated employees, with an amended Gallagher agreement to be brought to a special meeting. Presentations on pension and corpus investment performance, indigent care, and quarterly financials were received. No other substantive decisions were made.

Thu Jan 27, 2022 · 13:00

Amarillo City Council

The provided agenda contains no readable information.

The text for the January 27, 2022, Amarillo City Council meeting consists of encoded numeric strings and does not contain legible items or discussions. The document contains only unreadable data rather than procedural boilerplate or substantive items.

amarillocity council
Thu Jan 27, 2022 · 15:00

Planning and Zoning Commission

Discussion of the Zoning and Subdivision Ordinance Revision Project

The Amarillo City Council and Planning and Zoning Commission will receive updates on the ongoing Zoning and Subdivision Ordinance Revision project. This is an informational meeting for presentation and public comment. No votes or decisions will be taken during this session.

zoningsubdivisionordinanceplanning
✓ Decided: No minutes taken during meeting

The minutes for the Amarillo Planning and Zoning Commission meeting on January 27, 2022, state only that no minutes were taken during the meeting. No decisions, discussions, or actions are recorded.

Wed Jan 26, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The January 26, 2022, Amarillo Convention and Visitors Bureau meeting was cancelled.

The scheduled meeting of the Amarillo Convention and Visitors Bureau Board was cancelled due to a winter weather event. No agenda items were discussed or decided.

amarillomeeting cancellationwinter weathertourism
✓ Decided: Meeting cancelled; no minutes taken

The Amarillo Convention and Visitors Bureau meeting scheduled for January 26, 2022, was cancelled. No minutes were taken, and no decisions or actions were recorded.

Wed Jan 26, 2022 · 17:00

Animal Management & Welfare Advisory Board

The January 26 Animal Management & Welfare Advisory Board meeting was cancelled.

The scheduled meeting for the Amarillo Animal Management & Welfare Advisory Board was cancelled due to a lack of quorum or potential severe weather. The agenda included elections for Chair and Vice Chair and several department updates.

animal-welfareelectionsdepartment-updatesamarillo
✓ Decided: Animal Management & Welfare Advisory Board meeting cancelled

The meeting scheduled for January 26, 2022, was cancelled. No minutes were taken, and no decisions were made.

Tue Jan 25, 2022 · 13:00

Amarillo City Council

AEDC considers $6.6 million purchase of 1,329 acres at US Hwy 60 and Parsley Road

The City Council will discuss funding options for repairing athletic field lighting, including potential bond issuances totaling up to $16 million. The agenda also includes a public hearing for a new tax abatement zone and several zoning changes. Additionally, the council will consider various contract awards for software, equipment, and architectural services.

zoningbudgeteconomic-developmentpublic-workspolice
✓ Decided: Council approves $6.65M land purchase for AEDC, advances tax zone

The Amarillo City Council approved a consent agenda including a $6,647,650 land purchase by the Amarillo Economic Development Corporation at US Hwy 60 and Parsley Road, and approved first readings of ordinances creating Reinvestment Zone No. 16 for tax abatement and rezoning 8.49 acres near Hillside Road. The council also authorized publication of notice to issue up to $7 million in certificates of obligation for athletic field lighting repairs, with one dissenting vote.

Thu Jan 20, 2022 · 19:00

Amarillo Area Public Health Board

The Amarillo Area Public Health Board agenda contains no readable text

The provided agenda text consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the source document.

proceduralunreadable
Wed Jan 19, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains no readable content

The source document for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numerical sequences. No specific items, decisions, or discussions can be identified from the provided text.

procedural
✓ Decided: Board approves investment resolution, payments, and benefit actions

The board approved the investment resolution, several vendor payments, and a retirement benefit termination with survivor benefits. It also tabled the civilian board member appointment, trading report, and ethics policy discussions to the next meeting. Election results were canvassed, and officers were appointed.

Wed Jan 19, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to review multiple rezoning requests

The commission will consider several rezoning requests involving residential, retail, and moderate density districts. The agenda also includes reviews of multiple plats and a utility easement vacation. A work session is scheduled to discuss previous cases and upcoming agenda items.

zoningrezoningplatsland-useamarillo
✓ Decided: Commission approves multiple rezoning and plat requests

The Amarillo Planning and Zoning Commission approved several rezoning requests, including changes from Agricultural to Residential, Moderate Density, and General Retail districts, and approved plats with variances. One plat was withdrawn, one tabled, and one rezoning tabled to a later meeting. All votes were unanimous.

Wed Jan 19, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Unreadable agenda text for January 19, 2022 meeting

The provided document for the Amarillo Economic Development Corporation Board of Directors contains only unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the record.

unreadableprocedural
✓ Decided: AEDC approves $480K job incentive for Horizon Ag-Products

The Amarillo EDC Board approved a job creation incentive of $12,000 per job for up to 40 jobs (total $480,000) for Project HAP/Horizon Ag-Products, which will invest $23 million in capital improvements. The board also approved the purchase of 1329.53 acres at Hwy 60 and Parsley Road for $6,647,650, contingent on appraisal. Additionally, they approved the President/CEO's contract and a 20% one-time performance award. All votes were 3-0.

Wed Jan 12, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of City of Amarillo drainage fees and PID budget calculations

The Greenways at Hillside Public Improvement District Advisory Board will discuss the history of City of Amarillo drainage fees and potential actions regarding them. The board will also review commercial acreage calculations for the PID Budget and five-year service plan.

drainagebudgetmaintenance
✓ Decided: Greenways PID board discusses drainage fees, no refunds; sets March meeting

The board approved the October 2021 minutes with changes. They discussed the history of drainage fees, confirming no refunds will be issued, and reviewed current charges. They also discussed commercial acreage, maintenance, and set the next meeting for March 10 at 10 AM.

Wed Jan 12, 2022 · 13:30

One Time Event

The Parks & Recreation Board will elect a Chairman and Vice Chairman.

The Parks & Recreation Board will elect a Chairman and Vice Chairman for one term. The board will also consider appointing members to the Strategic Planning and Outreach sub-committees. Updates are scheduled for several projects, including the Zoo Disposition Policy and Sports Complex Study.

parkselectionssubcommitteezoosportsplanning
✓ Decided: Parks board elects new chairman, vice chairman, reappoints subcommittees

The Parks and Recreation Board elected Luke Austin as Chairman and Tiffany Podzemny as Vice Chairman by a 9-0 vote. The board also reappointed members to the Strategic Planning and Outreach subcommittees, adding Shelby Massey to the Outreach subcommittee. No other formal actions were taken; remaining items were informational updates or discussions.

Tue Jan 11, 2022 · 10:00

Airport Advisory Board

Airport Advisory Board discusses various terminal repairs and infrastructure projects

The Airport Advisory Board will vote on updated art policies and meeting minutes. The board will also hear presentations regarding several airport maintenance and infrastructure projects.

aviationinfrastructuremaintenanceairportpublic-works
Tue Jan 11, 2022 · 11:30

Beautification and Public Arts Advisory Board

The Board will consider electing officers and reallocating funds for staff support.

The Beautification and Public Arts Advisory Board will meet to elect a Chair and Vice-Chair. The meeting includes discussions on reallocating funds for a full-time staff member and updates on the FY22 Mural Grant Project and art pads in city parks.

artsstaffingbudgetparksgrants
✓ Decided: Board elects new officers, moves to Parks and Recreation

The Beautification and Public Arts Advisory Board elected Eric Barry as Chair and Sterling McKinney as Vice Chair, and approved moving the board under the Parks and Recreation Department. The board also discussed reallocating beautification funds to support a parks staff position, but no final decision was recorded on that item.

Tue Jan 11, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $10.8 million contract for Martin Road Lake improvements

The Amarillo City Council will consider several contracts and ordinances during this meeting. Items include a $10.8 million project for Martin Road Lake and incentives for the Mateen Bar USA manufacturing facility. The council will also hold public hearings on a nocturnal curfew ordinance and various rezoning requests.

zoningbudgetpublic-safetyinfrastructureeconomic-development
✓ Decided: Council approves $10.9M Martin Road Lake contract and Mateen Bar USA incentives

The Amarillo City Council approved a $10,888,000 contract for phases three and four of the Martin Road Lake Improvements Project, and approved a Location Incentive Agreement and Tax Abatement with Mateen Bar USA for a new 800,000-square-foot manufacturing facility. The council also passed several ordinances on first reading, including a nocturnal curfew for minors, code enforcement vehicle impoundment authority, and multiple rezoning and right-of-way vacations. All votes were 4-0 with one member absent.

Wed Jan 5, 2022 · 08:30

Civil Service Commission

Civil Service Commission to review police and fire department personnel updates

The Civil Service Commission will elect a chairman and vice-chairman for the year. The commission will also review employee changes, including promotions and disciplinary actions. Additionally, it will consider approving eligibility registers for Police Sergeant and Fire Lieutenant positions.

policefirepersonnelcivil-serviceamarillo
✓ Decided: Civil Service Commission approves personnel actions and exam registers

The Civil Service Commission met and approved routine personnel actions including new hires, step increases, transfers, promotions, demotions, bypasses, temporary assignments, and disciplinary actions. It also approved eligibility registers for Police Sergeant and Fire Lieutenant exams. All motions passed unanimously with no public comments.

Mon Jan 3, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning an 8.49-acre tract to General Retail District

The Planning and Zoning Commission will elect a Chairman and Vice Chairman. The agenda includes reviewing two plat applications for South Georgia Place and Spring Lake. Additionally, the commission will consider rezoning an 8.49-acre tract at Hillside Rd. and Nancy Ellen St.

zoningplatsrezoningland-use
✓ Decided: Commission approves 114-lot residential plat with variances

The Amarillo Planning and Zoning Commission approved a final plat for South Georgia Place Unit No. 40, creating 114 residential lots with variances for lot depth and area, pending surety for public improvements. They also approved a replat for Spring Lake Unit No. 4 with a variance for a substandard remaining lot, and a rezoning of an 8.49-acre tract from residential/agricultural to general retail. The commission re-elected Rob Parker as Chairman and Royce Gooch as Vice Chairman.